Homepage - https://www.sya.de/

RELATIVITÄTEN DES SEINS

THE RELATIVITY OF (HUMAN) BEING

Divider

Die Bi-Sexualität

Ihre Wesensart abseits der Ambisexualität

» Vorwort
Die Bewandtnis der Inbetrachtziehung
» Einleitung
Der sprach-sachtechnische Erörterungsgrund
» Kinsey-Reports
Initialinitiative des Öffentlichkeitswesens
» Der Sexualitätsbegriff
Ursprung und Entwicklung
» Der Geschlechtsbegriff
Die Verwicklungen der zeitlichen Wandel
» Anatomie
Die körperliche Inbetrachtziehung
» Der binäre Gen-o-Typ
Der latinsierte Ursprung
Die Geschlechtlichkeit «
Ursprung des Ermessungswesens
Substanz und Funktion «
Die wissenschaftliche Ausgrenzung
Pathologie - Teratologie «
Von der Anatomie zur Pathologie
Psychopathia sexualis «
Die Psychopathologie
Homosexuellenkonzepte «
Entstehung und Entwicklung
Sprachtechnische Barrieren «
Ursachen und deren Wirken
Quellenwerke «
Spezialisierte Werke
» Vorbereitung «
Sammlung vorbereiteter Inputs
» Filme «
mediale Darstellungen
» Facebook-Seite «
Informationen zum Aufbereitungsablauf

Als » Bisexualität (eigentlich Ambisexualität) « trifft man es in lexikalischen und enzyklopädischen Werken an und besagt, daß es sich um Ambisexuelles handelt, was als Bisexuelles bezeichnet wird. In der Ergründung dieser Gegebenheit zeigt sich jedoch, daß es sich tatsächlich um weder noch handelt, sondern die Anwendungen ganz andere Bedeutungen haben, als die begrifflichen Deklarationen als solches besagen.

Nachfolgend die systematische Ordnung, gemäß dem die Deklarationen gebildet wurden. Der Ursprung basiert auf der aus dem Griechischen abgeleiteten Deklaration der Zweigeschlechtlichkeit des Hermaphroditen. Hierin geht es um die beide Geschlechter beinhaltende Präsenz des in Betracht ziehenden Organismus.

Die aus dem Lateinischen begründeten Deklarationen fußen hingegen auf der sich davon unterscheidenden Inbetrachtziehung der zweigeschlechtlichen Fortpflanzung - der zweigeschlechtlichen (lat.: bi-sexu[ellen]) Vereinigung des männlichen und weiblichen Verbundwesens und ambivalenten Varianten. In Verbindung mit der Ergründung der Fortpflanzung in der Pflanzenwelt gebildet, zur Spezifizierung und Unterscheidung gegenüber der ungeschlechtlichen Vermehrung, fand es im weiteren auch im Bezug auf Tiere und den Menschen seine Anwendung.

Nachfolgend tabellarisch im Nebeneinander die Parallelen dargelegt, verdeutlich sich darüber auch der jeweilige spezifizierende Bedeutungsinhalt. In seinem biologischen Ursprungsbezug bezeichnet die Bisexualität das, was man auf den Menschen spezifiziert zwischenzeitlich als Heterosexualität deklariert.

Hermaphroditismus / Bisexualität (Zweigeschlechtlichkeit)
Deklaration (grch.)
Geschlechtlichkeit
Typus Geschlechtspräsenz Deklaration (lat.)
Geschlechtsverbund
Hermaphroditismus
verus
Geschlecht
nicht wechselnd
beide
präsent
konstant Bisexualität
simultaner
Hermaphroditismus
Geschlechtsfähigkeit
wechselnd
simultan Ambisexualität
sequentieller
Hermaphroditismus
Geschlecht
wechselnd
eines
präsent
sequentiell

Darauf basiert auch indirekt dessen Entstehung seiner neuerlichen Spezifikation. Ausgangspunkt war hierin die Ergründung, ob und inwiefern beim Menschen die Zweigeschlechtlichkeit mit dem der Geschlechtsvereinigung im Verbund einher geht. Inbetrachtziehungsgegenstand wurden hierin die Anomalien gegenüber der normierten Heterosexualität, worin sich dies mit der Ergründung des Hermaphroditismus, Transsexualismus und der Homosexualität verband. Die maßgebliche Veränderung basiert jedoch darauf, daß gegenüber der ursprünglichen Inbetrachtziehung der Einheit des Sexualverbundes, hierin das Eine für sich seine inbetrachtziehungsgemäße Spezifikation erfuhr und man daraus das Gemeinsame herausbildet. Nicht der Sexualverbund ist hierin der ausgehende Inbetrachtziehungsgegenstand, sondern der einzelne Homosexuelle, Heterosexuelle und Bisexuelle und dessen Bezug zum 'körperlichen Geschlecht'. Hierauf begründete sich auch die Abwandlung der Bisexualität 'der Zweie' auf das bisexuelle zu-Zweien und das zu-Dritt, wie auch generell das Ermessen der Gesinnung der Involvierten, erfährt darin gar keine Inbetrachtziehung. Der isolierte subjektbezogene Geschlechtsbezug bildet hierin den Grundsatz.

Dem gemäß haben sich jedoch darin auch die Deklarationen der Homosexualität (des Gleichgeschlechtlichen) und der Heterosexualität (des Gegengeschlechtlichen) als solche etabliert. Diese Erfindung griechisch-lateinischer Vermischung basiert, in seinem unterscheidenden Bestandteil, auf der physikalischen Fundierung des Homogenen und Heterogenen und es handelte sich gar nicht um das Sexualwesen, sondern um das Geschlechtswesen, was darüber deklariert wurde. Ein gravierender Unterschied, den man jedoch bis heute gar nicht in seiner vor allem auch sprachtechnischen Bewandtnis wahrnimmt. Die Deklarationen der Bisexualität und Ambisexualität wurden dem gegenüber zwar aus ihrem Ursprung heraus übernommen, jedoch werden darüber regulär einzig die Abweichungen monogamer hetero- und homosexueller Verhältnisse gekennzeichnet. Die Inbetrachtzierung bisexueller und ambisexueller Veranlagungen als solche, findet einzig in Ausnahmefällen statt. Entsprechend stellt es sich auch in der späteren kombinierten Anwendung, sodaß es der Bisexualität einzig ihre Bennenung bewahrt, da sie als überbegriffliche Deklaration, gleich der Homosexualität, ihren veranlagungsbezogenen Status erlangt hatte, man jedoch fast ausschließlich die Ambivalenzen überhaupt handhabt. Darauf bezieht sich das, was man als "Bisexualität (eigentlich Ambisexualität)" antrifft. Nur, kennt man in der Allgemeinheit die begriffstechnisch Anwendung der Ambisexualität gar nicht und es besteht überhaupt kein Bezug dazu und somit hat dies darin auch gar keinen Bedeutungsinhalt und alles miteinander gerät somit gänzlich durcheinander.

Sachstand ist dem gegenüber jedoch, daß über diese spezifische Inbetrachtziehung des Ambivalenten, letztendlich als unterenwickeltes Hetero- und Homosexuelles in Betracht ziehend, in der Anwendung sich äußerst klar darüber aufwies, daß es sich nicht als ein Derartiges erweist. Die Bisexualität, konkret, deren Präsenz des Dreiecksverbundes, hat hingegen bisher noch in keiner Weise ihre Inbetrachtziehung erfahren. Aufgrund des sprachtechnisch Wirrwarrs ist es auch gar nicht möglich, sie darüber in Erscheinung treten zu lassen. Nachfolgend das Anwendungswesen des sexualwissenschaftlichen Händlings, worüber sich die völlige Veränderung der Deklarationen ergibt. Es ist darin weder noch der Sachstand. Für sowohl als auch weist sich eine völlig andere Definition auf, als diese Spezifikationen als solche besagen. Es hat von Grund auf überhaupt nicht den Bezug dazu. Somit können sich weder Bisexuelle, noch Ambisexuelle, darüber identifizieren.

Inbetrachtziehung Geschlechtspräsenz Anwendungsweise
Heterosexualität konstant Heterosexualität
Ambisexualität
(eigentlich Heterosexualität)
ambivalent Bisexualität
(eigentlich Ambisexualität)
Bisexualität
Ambisexualität
(eigentlich Homosexualität)
ambivalent
Homosexualität konstant Homosexualität

Bei der Veranlagung der Bisexualität und Ambisexualität handelt es sich, gleichermaßen wie bei der Hetero- und Homosexualität, um eine Spezifikation der veranlagten Sinnlichkeitspräsenz und der damit einhergehenden triebhaften Erfüllungsbedürftigkeit mit dem/den Sexualpartner/n, in welchem das Verbundwesen enthalten ist - es beinhaltet das ausfüllende Sinneswesen. Die veranlagte Individualität des sinnlichen Sexualwesens differenziert sich substanziell in seinem Wirkwesen gegenüber dem des Geschlechtswesen, geht jedoch als koordiniertes Einheitswesen damit einher. Die relative Präsenz der Triebwirkung beruht auf der Varianz der veranlagten Ausgeprägtheit, dem gegenüber das Relative des geistig Beurteilenden und Be(ur)kundenden darauf beruht, daß es sich nicht um geistige Veranlagungen handelt und sich erst ein Identitätsverhältnis darin ausbilden muß, sodaß man dies dem entsprechend, (passenderweise) separierend als sexuelle Orientierung deklariert. Man achte auf die unterstrichene Hervorhebung zur Unterscheidung von Geschlechtswesen und Sexualwesen, was weitläufig undifferenziert einher geht, dessen Unterscheidung jedoch des Wesens Kern (vor allem auch der Mißverhältnisse) darlegt.

Nachfolgend der substanzielle Einheitsverbund. Maßgeblich hierin ist, daß die bedürftige Erfüllung in der Veranlagung präsent ist. Dies stellt sich unerfüllt als ein Fehlstand, gemäß eines Vakuums, woraus sich die Triebwirkung der Leidenschaft heraus entfaltet (Leiden schafft Leidenschaft). In Anbetracht der Gegenseitigkeit der erfüllenden Einheiten verdeutlicht sich auch, daß die Erfüllung über das gegenseitig Ergänzende sich ergibt - die Einheit der Gemeinsamkeit auf dieser Ergänzung beruht und sich gemäß der Widersprüchlichkeiten gegenüber anderem abgrenzt. Maßgeblich hierin ist die Triebwirkung, deren Intensität auf der Ausgeprägtheit beruht, die nicht bei jedem Menschen gleich ist, sodaß sich das Regulierungswirken dem entsprechend auch relativ dem stellt. Während dies bei den Einen besonders stark ausgeprägt ist, kann es bei anderen nur schwach ausgeprägt sein und reguliert sich über dessen Wirkungsintensität. Hinzu kommt die kulturelle Erfordernis des Maßstabes des geistigen Leitwesens, dem gegenüber das Sinneswesen aus sich selbst heraus regulär instinktiv und intuitiv umsetzt, auch ohne geistige Beteiligung. Der Geist beinhaltet indess die Veranlagung nicht, sodaß sich hierin überhaupt erst eine Identität entwickeln muß, worin es sich gleichmaßen stellt, gemäß des Wirkens der Ausgeprägtheit der Veranlagung darauf, sodaß bei den Einen diese entsprechend maßgeblich darauf einwirkt und es sich aufeinander einrichtet, hingegen bei anderen eventuell auch gar nicht seine Wirkungsgrundlage erfährt.

Hetero-, Homo- und Bisexuelle(r) sein, ist gemäß der Varianz der Ausgeprägtheit und seiner Umsetzung ein Relativa. Es ist eine abstrakte Deklaration des jeweiligen Spezifischen, in Abgrenzung zum Unterscheidenden und dies tritt entsprechend der Ausgeprägtheit mehr oder weniger spezifisch in Erscheinung. Es ist kein isoliertes Sein des Selbst, welches durch die Ausfüllung sich bildet, sondern es beinhaltet in sich die Einheit der Erfüllung. Das ist es, was sich über dessen Wirken vermittelt und Erfüllendes gemäß dieser Präsenz seine resonierende harmonische oder dismarmonische Wirkung erfährt und entsprechend das Verbundswirken im Miteinander reflektiert, sodaß sich darüber das Einheitswesen umsetzt. Dem entsprechend stellt sich die Unbestimmtheit dem gegenüber als Eigenart der Unausgeprägtheit der Veranlagung und deklariert sich als Ambisexualität, dessen Bedeutung der Ambivalenz sich nicht über den Bezug 'zu-Zweien' impliziert und auch nicht über die Unbestimmtheit gegenüber beiderlei, sondern auf der Unbestimmtheit aufgrund der relativen Unausgeprägtheit der Veranlagung - es ist unbestimmt.

Aufgrund dessen trifft man ambisexuelle Verhältnisse derart weitläufig in den diversesten Bezugsverhältnissen an, da einerseits das Relative der Ausgeprägtheit für sich kein absolutes ist und auch in der Anwendung/Umsetzung diverse andere Wirkungsfaktoren mit involviert sind, sodaß es sich auch mit anderem, dies unspezifzierent erscheindend vermischt. Die drei elementaren Wirkungsbestandteile, worüber es sich substanziert, sind jedoch die Veranlagung der sexuellen Konstitution (dessen Triebwirkung zur Erfüllung), die geistige Identität (dessen Einrichtung darauf) und das konstellative Erfüllungswesen (die umsetzende Erfüllung), worüber es sein regulierendes Umsetzungswesen erfährt. Über die Inbetrachtziehung der Wesensart der Einheit verdeutlicht auch, daß die maßgeblichen Ursachen der Mißverhältnisse darauf beruht, daß man einzig das Geschlecht in Betracht zieht. Nicht nur für Bisexuelle ist es maßgeblich, daß im Gegenüber die spezifische Ergänzungserfüllung sich ergibt, sondern auch für Hetero- und Homosexuelle stellt es sich derart, sodaß der reine Geschlechtsbezug die Gegebenheiten völlig durcheinander bringt. Das Geschlecht ist einzig anteiliger Bestandteil und geht im Verbund mit der Gesinnung einher. Generell bedingt es somit hierin von Grund auf der Inbetrachtziehung dessen Verbundes, gemäß seiner Einheit spezifiziert, in Betracht zu ziehen und trennt sich darüber von dem, worin es nicht seine Erachtung findet.

Geschlecht
männlich weiblich
sexuelle Konstitution

 heterosexuell 

Identität
der
Heterosexuelle
die
Heterosexuelle
Konstellation
Geschlecht
männlich männlich
sexuelle Konstitution

 homosexuell 

Identität
der
Homosexuelle
der
Homosexuelle
Konstellation
Geschlecht
weiblich weiblich
sexuelle Konstitution

 homosexuell 

Identität
die
Homosexuelle
die
Homosexuelle
Konstellation
Geschlecht
weiblich männlich weiblich
sexuelle Konstitution

 bisexuell 

Identität
weibliches
bisexuelles
Pondant
der
bisexuelle
Dritte
weibliches
bisexuelles
Pondant
Konstellation
Geschlecht
männlich weiblich männlich
sexuelle Konstitution

 bisexuell 

Identität
männliches
bisexuelles
Pondant
die
bisexuelle
Dritte
männliches
bisexuelles
Pondant
Konstellation

Hierüber verdeutlicht sich auch, daß die bisexuellen Dritten, aufgrund dieser Anwendung des reinen Geschlechtsbezuges, gar nicht in Erscheinung treten können und somit auch die Umsetzung der Pondants sprachtechnisch gar nicht stattfinden kann. Gerade in dem Bezug kann man sich unmißverständlich vor Augen führen, daß einzig die eine Seite der Inbetrachtziehung stattfindet und darin die Gegenüber gar nicht Bestandteil sind, da sich in dieser Handhabe die Ausfüllung als ein irriges/widersprüchliches Verhältnis stellt. Gerade dieser Aspekt ist jedoch nirgends anzutreffen, vielmehr wird über die stattfindende Inbetrachtziehung des beide Geschlechter beinhaltens, gar nicht wahrgenommen, daß es sich für einen Bestandteil der Dreie anders stellt, wobei gerade in dem reinen Geschlechtsbezug es sich doch als solches darlegt. So verdeutlicht sich hierüber aber auch, daß gleichermaßen, wie bei den Ambisexuellen, nicht die Bisexuellen das verlautende Mißverhältnis begründen, sondern das Anwendungswesen die Ursache ist, für die diversen Mißverhältnisse, welche damit einher gehen.

Gerade dieses Spezifische der Unbestimmtheit - des Ambivalenten, hat jedoch über den Verlauf auch ausgiebig in Erfahrung bringen können und bei den Ambisexuellen ein Identitätswesen erwirkt, worüber diese ihre Unbestimmtheit zwischenzeitlich auch entsprechend demonstrativ vermitteln. Die Inakzeptanz dessen beruht dem gegenüber einzig noch darauf, daß man das ist-Nicht als inakzektabel erachtet und man erfordert, daß diese sich darauf einrichten, gemäß des Erachtungswesens des Konstanten zu handeln, ohne zu berücksichtigen, daß es diesen gar nicht möglich ist. Es sind auch keineswegs diese, welche alles durcheinander bringen, sondern vielmehr verdeutlichen diese die Unklarheiten des Antreffenden, worin obige Darlegung des Einheitswesens derart gar nicht die Richtlinie bildet. Es hat sich jedoch vor allem vermittelt, daß es sich prinzipiell um keine Konstante darin handelt und darüber erfährt es auch seine allgemeingültige Abgrenzung zur Bisexualität. Es ist somit vor allem jedoch noch ein sprachtechnisches Handikäp, worauf dessen Unersichtlichkeit beruht. Das Ersichtliche des eigentlichen Bezugswesens der veranlagten Konstanten des Bisexuellen, erfährt man hingegen nach wie vor in seinem althergebrachten Bezugswesen von » Dreiecksbeziehungen « und im Darstellungswesen dessen als » Dreiecksgeschichten « (FMF/MFM), jedoch auch dort mit anderem, vor allem jedoch Ambisexuellem vermischt. Als solches erfährt dies generell nur in speziellen Bezügen seine spezifische Erachtung, worüber auch ersichtlich wird, wie es sich mit dieser Wesensart verhält und was es damit auf sich hat.

Divider

Vorwort

Divider

Die Aufbereitung zur Ermittlung präsenter Kenntnisse über die Bisexualität und dessen Anwendungswesen, findet gemäß des weitreichenden und sich als gravierend verklärend stellenden Umfanges, fragmentarisch statt. Dem entsprechend wurde im ersten Schritt zunächst die Gegenwart erfaßt, ausweitend auf die Ursprünge hin, um ein Bildnis über die bestehende sprachtechnische Anwendung aufzubereiten. Hierzu gilt es hervorzuheben, daß nicht nur dieser Sachverhalt derart verklärt im Raume steht, sondern sich auch die Grundlage des substanziellen sprachtechnischen Sexualwesens derart stellt. Hierzu einmal einen Ausschnitt über den Sachstand des Begriffs der Sexualität, welcher angeblich von dem lateinischen sexus (eigentlich secare) abstammt, was tatsächlich so nicht der Fall ist und sich hierin die Ergründungen gleichermaßen fortsetzen. Über die Sprache ergibt sich der Leitfaden zu den Ursprüngen des Mißwesens, worüber sich dann auch die koordinierende Einheit der Aufklärung ergibt - sich das Eine gegenüber dem Anderen abklärt.


Verlag: Heinrich Ludwig Brönner
» «

sexus, us, m- secus, n. das Geschlecht. (scheint von secere, secare, schneiden, theilen, in der Bedeutung von Abtheilung, Theil, zu kommen, wozu dann virorum, mulierum zu denken wäre. Unwahrscheinlicher wäre die Ableitung von secere, sequi, in der Bedeutung von secta, obgleich secta mulierum vorkommt, denn in dieser Zusammenstellung ist es nur von secta im Allgmeinen einmal speciell eintlehnt).


Verlag: Hahn'sche Buchhandlung
» «

sexus, -us ist sicherlich von den hier angeführten Wörtern dasjenige, wo die Entstehung des u-Stammes aus einem alten Dual am wahrscheinlichsten ist. Die Erklärung aus *sec-tu- (sec-are "Abteilung", Vaniček a. a. O. 292) ist durch die bekannten lautgesetzlichen Verhältnisse ausgeschlossen; sexu- kann nur auf älterem sec(qu)-su- beruhen, da kein Anlass vorliegt dasselbe aus *sect-tu- zu erklären. Entweder muss also sexu- ein secundärer, aber ursprünglicher, vom s- Stamm seques- (secus) abgeleiteter u-Stamm sein, wofür mir jedoch keine Analogien bekannt sind, oder seine u-Flexion ist von der bezeichneten hysterogenen Art. Der Ausgangspunkt dieser Umbildung wäre, wie im vorigen Beispiele, der Gen. Du. gewesen: *sequ(e)s-ous = sexus "der beiden Arten" z. B. virilis et muliebris sexus (unbelegt), welche Form dann bei dem Zugrundegehen der Dualkategorie zum Singular (utriusque sexus) überführt wurde.

Man wird vielleicht gegen diese Etymologie einwenden, dass die dabei im Gen. Du. *sequ(e)s-ous anzunehmende Synkope des Stammsuffixes auffällig sei; denn so häufig diese Synkope in den Ableitungen der s-Neutra ist (anxius : angor augustus, saxun : sac(e)sna etc., s. Brugmann K. Z. XXIV, 10 f., Joh. Schmidt K. Z. XXV, 26), so selten erscheint sie im Paradigma selbst, so dass man sogar die Regel aufgestellt hat, dass in der Deklination der Vokal des Suff. -es gar nicht schwinden dürfe. Indessen, da es wohl nunmehr ausser Zweifel steht, dass auch diese Stämme von Haus aus den freien indog. Accent besessen haben (s. Möller Paul-Braunes Beitr. VII, 503 f., Osthoff M. U. IV, 182 m. d. Anm.), so wird diese an sich sehr verdächtige Verschiedenheit der Derivation und der Deklination auf sekundärer Uniformierung der letzteren beruhen. Sollte es übrigens, was ich nicht glaube, durchaus nötig sein, den alten Gen. Du. von seques- mit vollem Stammauslaut als *seques-ous anzusetzen, so könnte man in dieser sehr leicht als isoliert zu denkenden Form eine vor dem Rhotazismus liegende einzelsprachliche Synkope des mittleren e annehmen.

Somit beginnt der Einstieg auch zunächst in der zurückführenden Gegenwart und die detaillierte Ergründung der Ursprünge und dessen Entwicklungswesen ist gegenwärtig der nächste Schritt des konstruktiven Ausbaues. Auf dieser Seite trifft man dem entsprechend auf die Aufbereitung der aktualisierenden konstruktiven Ordnung und » auf einer weiteren Seite « auf den noch zu überarbeitenden vorigen Stand der Aufbereitung. Um die Bisexualität als solche vermitteln zu können, bedingt es, wie es sich unmißverständlich darlegt, primär der Aufklärung des Sprachgehaltes, in dessen Verbund darüber die Natürlichkeit des Seins sein Abbild erfahren kann. Als maßgeblich erweist sich hierin vor allem auch, daß spezifische Präsenzen überhaupt nicht ihre Inbetrachtziehung erfahren, was jedoch ebenfalls einzig im Verbund mit der Aufklärung der sprachlichen Präsenz der Abwegigkeit erfolgen kann. 'An sich' beruht dieses außen vor stehen darauf, daß das innere Sinnenerleben den äußeren Sinnen nicht zugänglich ist, erfährt jedoch seine Behinderung über die äußerlichen Maßgaben und da gerade darin die Sprache als das Ermessende gilt, so erfährt im Nachfolgenden diese auch ihr entsprechendes Gegenübertreten.

Würfel

Wie man diesem Bildnis entnehmen kann, so kann man über die Außenperspektive, in dem Fall der Inbetrachtnahme der Kugel, das Innere von außen gar nicht ersichten, dem gegenüber es dem Ersichten aus dem Inneren heraus bedingt, um auch dies ersichtlich werden zu lassen. Gemäß dem verhält es sich auch mit unseren äußeren und inneren Sinnen, wie auch den damit verbundenen Wirkwesen, sodaß in dem Fall jedoch, aufgrund ihrer Besonderheit der substanziellen funktionalen Differenzierung, in keiner Weise über die äußeren Sinne ein inneres Ersichten dessen, was die inneren Sinne in Erscheinung bringen, erlangt werden kann. Auch kann man nicht zu des anderen Innensichten gelangen, denn sie sind einzig dem eigenen selbst möglich. Es ist jedoch möglich, über das eigene Erleben Verhältnismäßigkeiten über des anderen Erleben zu erlangen, über Gleiches und Ähnlichkeiten des erfahrenden Erlebens. Vor allem auch über die resonierende sinnliche Verbindung, worüber die Sinne einander reflektieren. Das Sexualwesen ist hierin gerade das, worüber es sich am umfangreichsten und intensivsten vermittelt, sodaß es sich hierüber auch in aller Deutlichkeit darstellen läßt, wie es sich damit verhält. Die Wahrnehmung ist somit auch hierin das wesentliche Bindeglied, um die Gegebenheiten zu (v)ermitteln. Hierin gilt es somit auch primär, sich zu verdeutlichen, daß die angewandte Objektivität, welche man als Standard praktiziert, das Subjekt gar nicht beinhaltet, dem gegenüber die Subjektivität des Menschen Daseinsverhältnis zum Sein repräsentiert und generell nicht außer Acht stehen kann, da dieser selbst darüber als solches außen vor gerät - sein Selbst darüber nicht in Erscheinung tritt.


Wie ist es, eine Fledermaus zu sein?
» «

Thomas Nagel bringt die Gegebenheit auf den Punkt: das sinnliche Erfahren kann man einzig im Verhältnis gleicher Sinnlichkeit erlangen. Die Besonderheit dieser Veranlagung beruht jedoch darauf, daß sie regelrecht die sinnliche Erfüllung enthält und das triebhafte Wirken daraufhin eingerichtet ist, dies ausgefüllt zu bekommen. Das sinnliche Begehren ist somit auch auf einen Ist-Zustand ausgerichtet und stellt sich gemäß eines Vakuums. Es ist somit auch nicht des anderen Selbst, sondern die resonierende Sinnlichkeit im Selbst, worüber es seine reflektive Erfüllung, wie auch Abgrenzung zu nicht Erfüllendem erfährt. Hierin dreht es sich somit auch primär nicht darum, sich in das Andere hinein zu versetzen, sondern auf der Grundlage des Wirkens des Anderen auf das eigene Selbst und dessen Resonanzverhältnis. Und erst in Verbindung mit der harmonischen Resonanz des Miteinanders ergibt sich auch die innige Sinnlichkeit der Verbindung des Einheitswesens des Miteinanders (Begehren -> Liebe). Daraus ergibt sich das regulierende Erfüllungs-/Gesinnungswesen, gemäß dem man es antrifft und sich miteinander eint, wie es auch die Andersartigkeiten voneinander abgrenzt. Das Erfüllungswesen ist vor allem eben hierin gleich dem Eigenen, sondern basiert auf der erfüllenden Ergänzung und ist somit in sich andersartig, jedoch gemäß des erfüllenden Einheitswesens Bestandteil dessen. Maßgeblich ist somit auch, was man bezüglich des Geschlechtswesen außen vor gestellt hat, daß es das Sein in dieser Gegebenheit 'als solches' nicht gibt, ohne die Erfüllung, die auch wenn sie hierin nicht personell erfüllend präsent ist, als solches in sich repräsentiert. Dem gegenüber fehlt es der Inbetrachtziehung des Geschlechtswesens jedoch noch der Abgrenzung zum Fortpflanzungswesen, um auch darin zur Klarheit zu gelangen über das Leitwesen, welches keineswegs nur aus Einem hervortritt, sondern über das Kombinat des Vereinenden und sich darüber auch das Kernwesen der menschlichen Individualität ergibt.

Gemäß meiner Ergründung all der Jahre, gestaltet sich auch die Darlegung dem entsprechend, indem die einzelnen Bestandteile, wie auch deren Abgrenzungen zueinander, systematisch ihre Ersichtung erfahren. Der Aufbau findet gemäß der Darlegung des Repräsentationswesens statt, denn darüber gestaltet sich das Sprachwesen, welches sich als völlig verwirrend stellt, da sie nicht gemäß der Grundlagen sprachtechnischer Funktionalität ihre Angemessenheit erfahren hat. Vor allem zeigt sich hierin ein Überwiegen der Repräsentanz der Ideologien gegenüber der Darlegung der natürlichen Ersichtlichkeiten. Hinzu kommt somit auch vor allem ein gravierendes außen vor stellen menschlicher Präsenzen, zumal es hierin um das Elementare sich dreht, welches im Anschluß daran seine Darlegung erfährt. Wie sich aufweist, so sind gerade aus diesem Mißverhältnis heraus, die Gegebenheiten durchweg kontrovers, sodaß es jedoch dessen spezifischen Erachtung bedingt, um gerade dieses Verhältnis daraus ersichtlich werden zu lassen. Diese Aufbereitung beschränkt sich indess auf das Aufbringen des Bezugsverhältnis zur mentalen Veranlagung der sexuellen Orientierung und dessen spezifischen Wirkungsverbund, gilt jedoch mustergültig generell für diese Art der mentalen Veranlagung (der Mentalität). Die umfangreiche Darlegung über das Substanzwesen und das Bewußtsein als solches, findet hingegen über das Hauptwerk statt, welches man ebenfalls, zur Aufbereitung eines Buches, auf einer dafür eingerichteten Seite veröffentlicht antrifft:

» PRINZIPIEN DES SEINS «

THE RELATIVITY OF (HUMAN) BEING

Die Funktionalität substanzieller Präsenzen

Die mentalen Organe

Divider

Einleitung

Divider

Bisexualität ist sowohl ein » Oberbegriff « und neben der Ambisexualität gleichzeitig auch ein unterscheidender » Unterbegriff « (zwecks » Klassifizierung « der Unterscheidungsmerkmale). Dies findet jedoch einzig derart spezifizierend und differenzierend in » Fachspezifikas « seine Anwendung und ist in der Allgemeinheit, vor allem die unterscheidende Deklaration der Ambisexualität unbekannt. Als Oberbegriff bezeichnet Bisexualität das beinhalten von zwei, bzw. beider Geschlechter und als Untergliederndes die Konstanz dessen, dem gegenüber die Ambisexualität die Ambivalenz (variierend/wechselnd) bezeichnet (Biologische Klassifizierung). Ursprünglich in der » Pflanzenkunde « aufgebracht, fand es später auch in der Tier- und Menschenkunde zur Bestimmung des körperlichen Geschlechts seine Anwendung.

In Verbindung mit den » Entwicklungen zur Homosexualität « wurde es jedoch auch fester Bestandteil der Deklaration und Bestimmung der veranlagten sexuellen Ausrichtung des Geschlechtsverbundes, welches sich als ein durch die Ausprägung bestimmter eigenständiger Sinnestrieb, abseits des Geschlechtstriebes aufweist. Sein beides Beinhaltendes trägt es auch in sich in seiner Bezeichnung, welches sich aus dem lateinischen » Sexus « (» Geschlecht « und griechischen bi (zwei) /» ambi « (zu zweien/beidem) zusammensetzt. Gegenüber der » Heterosexualität « und » Homosexualität « ist, aufgrund des » Monosexuellen « / Monosexistischen, der Umgang damit zwar dem gegenüber außergewöhnlich defizil, jedoch ist die erforderliche Differenzierung und Abgrenzung gegenüber dem Geschlechtswesen allumfassend zu einem unerläßlichen Inbetrachtziehungsgegenstand geworden.

Zur allgemeinen öffentlichen Thematik wurde die Bisexualität zuerst über die Publizität» Sigmund Freud's « Aufbringen, daß alle Menschen (körperlich) geschlechtlich bisexuell seien, dem eine völlige Ablehnung entgegen trat und aufgrund dessen auch regelrecht wieder in der Versenkung verschwand. Seine öffentliche Popularität hingegen, erlangte es in den 1950er Jahren über die » Kinsey-Reports «, welche die Relativität der sexuellen Geschlechtsvereinigungen über statistische Daten darlegten und darüber zur allgemeinen öffentlichen, primär jedoch wieder zu einem Kernpunkt der sexualwissenschaftlichen Auseinandersetzung gelangte. Kinsey stellte die Fragestellung in seinem Report zur Klärung in den Raum, was es damit auf sich hat, daß über ein Drittel offiziell bekundeten, daß sie nicht rein monosexuell orientiert seien. Hierbei blieb jedoch ein wesentliches Detail seines Aufbringens unberücksichtigt, welches sich auf das Differenzierungsverhältnis der Bisexualität gegenüber der Ambisexualität bezieht, dessen Erfordernis der Klärung dieser besonders hervor hob. Vor allem jedoch verschwand im Anschluß darain auch die eigentliche Inbetrachtziehung der Bisexualität und erwirkte das einzig noch anzutreffende Verhältnis von "Bisexualität (eigentlich Ambisexualität)", was bedeutet, daß es sich einzig um das Verhältnis der Ambisexualität handelt und nicht um Bisexualität.

In der Befassung mit der Bisexualität selbst, bedingt es somit auch der Filterung dessen, worin es sich überhaupt um ein solches Verhältniswesen dreht. Aufgrund des weitläufigen Mißverhältnisses des sprach- und sachtechnischen Umganges, führt dies vor allem dazu, daß Bisexuelle sich darüber selbst gar nicht wiederfinden/identifizieren können und dessen Verhältniswesen gänzlich verklärt. Die Selbstfindung wird darüber unmöglich gemacht und so können diese aufgrund dessen auch nicht regulär in Erscheinung treten. Hierbei ist bereits der Umstand, daß für den ausfüllenden Bestandteil der bisexuellen Dritten die sprachtechnische Grundlage sich bereits als Widerspruch stellt, ein elementar behindernder, da bei diesen der Bezug nicht auf dem zu zwei Geschlechtern beruht, sondern auf Zweien (Pondants) des gleichen Geschlechts (F↔M↔F/M↔F↔M). Es ist nicht nur das naturgemäße Erscheinungsbildnis, worüber es sich abbildet und daraus ersichtlich ist, sondern auch die Logik klärt darüber auf. Maßgeblich hierin ist, daß für Bisexuelle einzig in einem zu-Dritt Harmonieverhältnisse ent-/bestehen und somit auch die Bildung über ein zu-Zweit sich, unberücksichtigend dieser Erachtung, als disharmonische Diskrepanz stellt.

Während sich die Klarheit des Bisexuellen, als solches, aus dessen Konstruktionswesen heraus ergibt, gleichermaßen wie für die Hetero- und Homosexualität, stellt sich dem gegenüber die Unklarheit als eine scheinbare Unklärbarkeit, für jegliches Verhältniswesen darin. Diese Unklarheit basiert auf dem fehlenden Bezugswesen zur substanziellen Präsenz der Veranlagung, vor allem dem wo und als was es verortet ist. Das es das Körperliche nicht aufweist, sich von dem Geschlechtswesen differenziert, jedoch damit verbunden einher geht und sich gerade das Geistige als Verwirrungswesen stellt, darüber ist man sich in sachkundigen Kreisen allgemein einig. Dem gegenüber ist man jedoch zwischenzeitlich in den Entwicklungen über das körperliche Geschlechtswesen ebenfalls zu diesem Desorientierungsverhältnis zur Männlichkeit und Weiblichkeit und dessen Unklärbarkeit gelangt. Was jedoch darin Ermessungsgegenstand geworden ist und darin besteht die elementare Erfordernis, ist die Prägung. Hierüber klärt sich die bestehende Unermesslichkeit der Uneindeutigkeit auf und vor allem, daß in der Ermessung das Körperliche nur ein anteiliger Bestandteil menschlichem Seins repräsentiert.

Geschlechts-/Fortpflanzungswesen ↔ geistige Identität ↔ Sexualwesen

Über des jeweiligen Selbst einzig zeigt sich das Einheitswesen dieser Wirkungspräsenzen und dessen kollektives Wirken auf, dem gegenüber dies über reine Äußerlichkeiten in keiner Weise derart seine Sichtung erlangen kann. So ist es aber auch nicht der Geist, welcher dies aus sich heraus in Erscheinung bringt, denn dieser speist sich aus der Erinnerung, derer es zunächst der Ausbildung bedingt, jedoch die Empfindungen und Gefühle einzig eine Versinnbildlichung darin erfahren. Es ist primär das reflektierende Gefühlsleben und dessen Wirken, dessen Ersichtung es bedingt, um die Eigenarten dieser Veranlagung zur Ersichtung zu bringen. Das Ersehen des Seins im Selbst, ist eine Gegebenheit, welche einzig über das Ersehen des Selbst auf direkte Weise erlangt werden kann und verbindet sich mit dem instinktiven/intuitiven Handelswesen zu dem, wie wir es erfahren. Dem gegenüber verhält es sich jedoch auch derart, daß man dies einzig in dem Verhältnis wahrnimmt, entsprechend dem man dies bewußt in Betracht zieht. Elementar ist somit auch, was man überhaupt in Betracht zieht und dies gilt es vorab überhaupt erst einmal auf den Punkt gebracht darzulegen.

Divider

Kinsey-Reports

Divider


W. B. Saunders Company
» «
Professor of Zoology, India University

S. 641: Individuals who are rated 3's stand midway on the heterosexual-homosexual scale. They are about equally homosexual and heterosexual in their overt experience and/or their psychic reactions. In general, they accept and equally enjoy both types of contacts, and have no strong preferences for one or the other. Some persons are rated 3's, even though they may have a larger amount of experience of one sort, because they respond psychically to partners of both sexes, and it is only a matter of circumstance that brings them into more frequent contact with one of the sexes. Such a situation is not unusual among single males, for male contacts are often more available to them than female contacts. Married males, on the other hand, find it simpler to secure a sexual outlet through intercourse with their wives, even though some of them may be as interested in males as they are in females.

S. 656: Since only 50 per cent of the population is exclusively heterosexual throughout its adult life, and since only 4 per cent of the population is exclusively homosexual throughout its life, it appears that nearly half (46%) of the population engages in both heterosexual and homosexual activities, or reacts to persons of both sexes, in the course of their adult lives. The term bisexual has been applied to at least some portion of this group. Unfortunately, the term as it has been used has never been strictly delimited, and consequently it is impossible to know whether it refers to all individuals who rate anything from 1 to 5, or whether it is being limited to some smaller number of categories, perhaps centering around group 3. If the latter is intended, it should be emphasized that the 1's, 2's, 4's, and 5's have not yet been accounted for, and they constitute a considerable portion of the population.

In any event, such a scheme provides only a three-point scale (heterosexual, bisexual, and homosexual), and such a limited scale does not adequately describe the continuum which is the reality in nature. A sevenpoint scale comes nearer to showing the many gradations that actually exist.

As previously pointed out, it is rather unfortunate that the word bisexual should have been chosen to describe this intermediate group. The term is used as a substantive, designating individuals-persons; and the root mean typical female in the population. Where a single individual combines in its one person the primary sex characters of two sexes (namely, the ovaries and the testes), it is recognized as a hermaphrodite. Where the secondary sexual characters of an individual are in part the unmodified characters of one sex, and in part the characters of the other sex, the individual is known as a gynandromorph.

» Kinsey-Report Skala « https://commons.wikimedia.org/wiki/File:Kinsey-Report_Scale.svg
Kinsey's Beschreibung legt mit diesen Worten die Präsenz und das Differenzierungsverhältnis des Bisexuellen in seiner spezifischen Bezugnahme der 3er gegenüber der Separierung der 1,2,4,5er dar. Er führt dem gegenüber aus, der Begriff sei nie 'streng abgegrenzt' worden und daß es unmöglich sei, zu wissen, ob dies sich auf alle Personen von 1 bis 5 beziehe, oder nur auf Diejenigen, welche der mittleren, die 3er Gruppe Umgebenden angehören. Insofern dies beabsichtigt sei, sollte hervorgehoben werden, daß die 1,2,4,5er bisher darin nicht berücksichtigt seien und diese einen beträchlichen Anteil der Bevölkerung ausmachen. Darüber hinaus hebt dieser hervor, daß die 3er-Kategorisierung von heterosexuell, bisexuell und homosexuell nicht ausreichend sei, um den Umfang der realen Natur darüber wiederzugeben. Wie sich in Verbindung mit den nachfolgenden Absätzen aufweist, verfügt dieser über keinerlei Kenntnisse zur Spezifikation der Ambisexualität, obwohl dieser ausgebildeter Zoologe/Biologe ist und darin grundsätzlich die Bisexualität im Verbund mit der Ambisexualität die Grundlage bildet. In seinem Bericht ist diese Deklaration in keiner Weise anzutreffen. Sein Hinweis, daß die Deklarierung der Bisexualität unpassend sei und die Begründung, legt dar, daß diesem die Bedeutung von Bisexualität gleich gesetzt ist mit dem des Hermaphroditismus. Trotz dieses sprach- und sachtechnischen Fehlstandes, ersieht dieser jedoch die maßgebliche Erfordernis der Ausdifferenzierung des Bisexuellen gegenüber dem Ambisexuellen. Nebenan die im Umlauf befindliche Kinsey-Skala, spezifiziert gemäß seines Aufweisens der aspektierenden Differenzierungen.

Über nachfolgende Inhaltlichkeit Haeberle's Aufbringen, zeigt sich mustergültig die in der Sexualwissenschaft bestehende sprachtechnische Verfangenheit. Kinsey's Aufbringen zeigte seine Wirkung darin. Erachtungsgegenstand sind hierin jedoch, wie dies verdeutlicht, einzig die abweichenden Varianzen (Ambivalenzen) gegenüber den monosexuellen Konstanten der Hetero- und Homosexualität, sodaß sich generell die Inbetrachtziehung der Variante einer Konstanten (der Bisexualität) 'darin' als mißverhältlich stellt. Gemäß dem erachtet man es als Erfordernis, alles miteinander einzig als Ambisexuelles zu kennzeichnen, um zu einer Eindeutigkeit darin zu gelangen.

» Bisexualitäten (1994)«
Bisexualität aus biologischer Sicht
Ideologie und Praxis des Sexualkontaktes mit beiden Geschlechtern
Gustav Fischer Verlag / Archiv für Sexualwissenschaft
» E. J. Haeberle « und » R. Gindorf «

Verhaltensweisen zwischen 1 und 5 wurden von Kinsey und seinen Mitarbeitern als ambisexuell bezeichnet. Die meisten Befragten waren ausschließlich oder vorherrschend heterosexuell oder homosexuell aktiv über Jahre und Jahrzehnte; lebenslanges bisexuelles Verhalten wurde nur von einer Minderheit praktiziert. ... Noch zweideutiger ist der Status und die Etikettierung derjenigen, die sich ambisexuell verhalten. Menschen, die zu beiden Geschlechtern sexuelle Beziehungen oder entsprechende Phantasien haben, betrachten sich selbst oft als heterosexuell oder homosexuell, nicht als beides oder als bi. ... Als der Begriff bisexuell sich allgemein durchzusetzen begann und die Natur der Bisexualität stärker erforscht wurde, etablierten verschiedene Forscher ihre eigenen Definitionen. Während Kinsey et al. (1948, 1953) diejenigen als ambisexuell betrachteten, die zwischen K = 1 bis K = 5 rangierten, sahen Weinberg und Williams (1974, 1975) und Bell und Weinberg (1978) sowie Green (1987) die als ambisexuell an, deren Verhaltensweisen und Phantasien bei Durchschnittswerten zwischen K = 2 und K = 4 lagen. Haeberle (1978) stufte Heterosexuelle bei K = 0-2, Homosexuelle bei K = 4-6 und Ambisexuelle bei K = 2-5 ein. All diese Forscher schlugen sich mit der Realität herum, daß der Begriff oft ebensoviel, wenn nicht mehr, verschleiert wie enthüllt. Es ist äußerst selten, daß jemand ein erotisches Leben mit einer Person führt oder erträumt, die er nicht sexuell erregend findet, dennoch kann es zu gelegentlichen oder selbst längeren «Einbrüchen» kommen. Die Notwendigkeit könnte solche Verhaltensweisen erzwingen. Blumstein und Schwartz (1972) schreiben:

Bisexualität ... führt zu dem Mißverständnis einer Fixiertheit in der sexuellen Objektwahl ... der bessere Begriff (ist) Ambisexualität, mit dem Bedeutungsgehalt der Fähigkeit eines Menschen, unter bestimmten Umständen beide Geschlechter erotisieren zu können.»"

Klarheit erfährt dies noch einmal zusätzlich über Haeberle's Buch, dem gegenüber die Markantz in Betracht zu ziehen ist, daß dieser sich einzig auf 'seine' sexualwissenschaftlichen Kontaktverhältnisse bezieht. Tatsächlich ist nämlich selbst in der Sexualwissenschaft die Ambisexualität weitläufig unbekannt, was man den Ausführungen der Schriftwerke entnehmen kann. Und in der Allgemeinheit ist dieser Begriff gänzlich unbekannt. Jedoch bringt dieser eine sachkundige Erläuterung zu 'dieser' Unterscheidung auf und bildet darüber auch die Grundlage dessen, was man allgegenwärtig in lexikalischen und enzyklopädischen Werken antrifft, über die Ausführung von "Bisexualität (eigentlich Ambisexualität), was darüber auch allseits zur allgemeinen Übertragung und Nachahmung gelangte. Jedoch hat sich nicht übertragen, was es damit auf sich hat. Sämmtliche nachahmenden Anwendungen beziehen sich einzig darauf, daß es sich anders nennt, jedoch trifft man nirgends auf eine Beschreibung, worauf dies beruht, noch eine Erläuterung der Unterscheidung. So entstand zwangsläufig daraus auch die Gegebenheit des Wortes ohne Bedeutung, dem man jegliche Ambivalenz zuschreibt.


Handbuch und Atlas
Verlag: Walter de Gruyter
Deutsche Übersetzung der Originalausgabe:
The Sex Atlas, The Seabury Press, New York, 1978
Autor:

Wenn wir uns also von der allgemeinen Diskussion nicht ausschließen wollen, müssen wir uns für das vorliegende Buch zu einem Kompromiss entschließen. Denn diese Sprachgewohnheiten haben, so unpräzise sie auch sein mögen, doch einige Vorteile. Sie können dazu beitragen, bestimmte Auseinandersetzungen zu vereinfachen und dringende soziale Probleme zu artikulieren. Mit anderen Worten: solange ihr willkürlicher Charakter verstanden wird, kann die traditionelle Terminologie einige nützliche Zwecke erfüllen.

In diesem Sinn wird vorgeschlagen:

Es fällt auf, dass sich die dritte Definition mit den beiden anderen teilweise überschneidet. Das heißt, dass die Bezeichnung "ambisexuell" (von lat. ambo; beide) sich auf "Heterosexuelle" und auf "Homosexuelle" beziehen kann. Dieser Widerspruch ist unvermeidlich, es sei denn, man wollte nur solche Personen als ambisexuell bezeichnen, deren erotisches Interesse zu gleichen Teilen auf beide Geschlechter gerichtet ist (Kategorie 3). Dieser Wortgebrauch hat sich jedoch nirgends durchgesetzt. Einige Personen können also in dem einen Zusammenhang als "heterosexuell" (oder "homosexuell" und in einem anderen als "ambisexuell" bezeichnet werden.

Eine spezifizierende Darlegung des Anwendungswesens erfährt man über die Enzyklopädie Human Sexuality. Hierüber erhält man auch die Beschreibung über die anwendende Verdrehung der Gegebenheiten, die auf der unspezifizierten Anwendung der Differenzierung der Ambisexualität gegenüber der Bisexualität beruht. Hierin wird die Empfehlung ausgesprochen, das (ambivalente) 'Kontinuum' des Ambisexuellen als solches in Betracht zu ziehen und von dem des Bisexuellen, dem Verhältnis der Entsprechung des Ebenbürtigen zu zwei Geschlechtern, gemäß der Kinsey-3er, seine entsprechende Inbetrachziehung zu verschaffen.


Verlag: Garland Publishing, Inc.
Artikel: Ambisexuality (S. 26)
Autor:

The term "ambisexuality" was first published by Masters and Johnson in 1979 to describe men and women who had frequent sexual interaction with members of both sexes but who reported absolutely no preference for the gender of the partner. Sexual interaction was viewed as simply a matter of sexual release. They defined the term as "a man or woman who unreservedly enjoys, solicits, or responds to overt sexual opportunity with equal ease and interest regardless of the sex of the partners, and who, as a sexually mature individual, has never evidenced interest in a continuing relationship".

The terms ambisexual and bisexual are used to describe the relationship between heterosexuality and homosexuality. Alfred Kinsey produced a scale that classifies human psychosexual and behavioral response into seven categories ranging from exclusively heterosexual (the Kinsey 0) to exclusively homosexual (the Kinsey 6). The numbers 1 through 5 represent a ratio between homosexual and heterosexual behavior.

The criteria established by Masters and Johnson for the identification of an ambisexual are "(1) that the individual express no preference in terms of sexual partner selection either through personal history or by subjective description, (2) that he or she [is] currently living an uncommitted ambisexual lifestyle and [has] never as an adult evidenced any interest in a continuing relationship, and (3) that the man or woman could be rated close to Kinsey 3 in sexual preference" (this would be the midpoint on the scale). Fantasy patterns were not considered a part of the definition.

After a national search of about eight months in 1968, only six men and six women were found who fit the criteria. They said that their sexual preference was "that of the partner of the moment". These numbers are too small to allow generalizations about ambisexuality.

The term "ambisexuality" is often equated with the term "bisexuality," a designation that has been used in many ways that have very little precise meaning. The true bisexual is equally attracted to both sexes (i.e., a Kinsey 3). This definition incorporates the criteria for ambisexuality. However, in widely accepted use of the term, those classified as Kinsey 1 through 5 could also be identified (or identify themselves) as bisexual with a preference for homosexual behavior (Kinsey 4 and 5) or for heterosexual behavior (Kinsey l and 2).

The original Kinsey sale was established using sexual behavior as the sole criterion. Complicating factors (e.g., love, sexual attraction, fantasy, and self-identification) have only recently been used to enhance it. Using the old scale, it seems easy to determine the exclusive heterosexual (Kinsey 0) or the exclusive homosexual (Kinsey 6); however, when the fantasies of these persons are considered, their orientation may not be so exclusive. The categories between the two extremes represent a continuum, especially when the additional elements are considered, and they have received little research attention. It does seem, however, that when all of the factors are considered, an individual's rating may change over time. That is, the individual may be a Kinsey 2 at one time and a Kinsey 5 at another; the rating should not be viewed as being fixed, describing all behaviors, or predicting fixture behavior.

Given the ambiguities of the Kinsey 1 through 5 definitions, perhaps ambisexuality rather than bisexuality is the better term to use. Ambisexuality would recognize the continuum and be defined as "the ability for a person to eroticise both genders under some circumstances", since equal attraction to males and females is virtually nonexistent. The term "bisexuality" could then be used to describe the Kinsey 3s.

Wie sich hierüber mustergültig aufweist, so hat sich in der Sexualwissenschaft eine Variante der sprachtechnischen Anwendung etabliert, welche die Gegebenheiten gänzlich verklären. Hierauf basiert das, was man allgemeingültig als "Bisexualität (eigentlich Ambisexualität)" antrifft. Tatsächlich handelt es sich jedoch um weder noch, denn das Händling in der Sexualwissenschaft bezieht sich auf Ambivalenzen hetero- und homosexueller Verhältnisse und hat somit gar nichts mit dem deklarierenden Verhältnis der Eigenständigkeit einer davon sich unterscheidenden Veranlagung zu tun. Gravierend hierin ist, daß es sich bei der Ambisexualität tatsächlich um das Verhältnis der Ambivalenz handelt und beruht auf der graduellen Präsenz und Wirkungsintensität der Ausgeprägtheit. Die Ausgeprägtheit ist jedoch nirgends Bestandteil der Inbetrachtziehung. Vielmehr befindet man sich durchweg in der Infragestellung, worauf die antreffenden Ambivalenzen des Hetero- und Homosexuellen beruhen. Entscheidend ist hierin die Graduierung, sodaß sich ab einem gewissen Grad der Unausgeprägtheit, das Verhältnis einer sich eigenständig stellenden Ambisexualität ergibt, indess es sich ansonsten um eine Ambivalenz der jeweiligen anderen Veranlagungen handelt. Die Unterscheidung von ambivalent und ambisexuell ist somit auch maßgeblich. Nachfolgend das Sprachverhältnis, welches man in der Sexualwissenschaft anwendet und alles damit Verbundene durcheinander bringt, da man sich nicht auf die tatsächliche Inbetrachtziehung reiner Ambivalenzen bezieht und die Ambisexualität und Bisexualität davon abgrenzt.

Inbetrachtziehung Geschlechtspräsenz Anwendungsweise
Heterosexualität konstant Heterosexualität
Ambisexualität
(eigentlich Heterosexualität)
ambivalent Bisexualität
(eigentlich Ambisexualität)
Bisexualität
Ambisexualität
(eigentlich Homosexualität)
ambivalent
Homosexualität konstant Homosexualität

Wie die nachfolgenden Worte, veröffentlicht über das » glbtq Encyclopedia Project « beschreiben, so finden in den Ergründungen der Sexualität fast ausschießlich homosexuelle Inbetrachtziehungen statt, worin es sich um das Erkennen der eigenen gleichgeschlechtlichen sexuellen Anziehung dreht, das Finden anderer homosexueller Personen, die Selbstakzeptanz, Bestandteil dieser Gemeinschaft zu werden und letztendlich die Sexualität Bestandteil seiner eigenen sexuellen Identität werden zu lassen. Zwar mögen auch Bisexuelle manche dieser Erfahrungen machen, jedoch sind sie nur geringfügig beteiligt an der Entwicklung von Theorien sexueller Identität. Einige Modelle haben die Bisexualität zwar erwähnt, jedoch einzig im Kontext vorbeugender Regulierung positiver homosexueller Identität.

Einige Forscher haben speziell die Entwicklung der bisexuellen Identität berücksichtigt. Basierend auf den Studien von bisexuellen Frauen und Männern in San Francisco in den 1980er Jahren, entwarfen Martin Weinberg, Colin Williams, and Douglas Pryor ein vier-Stufen-Modell für den coming-out-Prozeß für Bisexuelle: initiierendes Durcheinander, Findung und Anwendung einer Bezeichnung, Festlegung einer Identität und fortsetzende Unsicherheit. Diese letzte Stufe, welche sie als einheitlich ersahen, bezüglich der Erlebnisse von vielen Bisexuellen, resultiert aus dem relativen Mangel bisexueller Gemeinschaft für eine soziale Bestätigung und der hartnäckige Druck, welchen Bisexuelle erfahren von Teilen der homosexuellen Gemeinschaft, sich als homosexuell zu identifizieren.

Andere Theoretiker haben die Ermessung eines linearen Stufenmodells abgelehnt. Paula Rodríguez Rust, eine der führenden Forscher/innen in Bisexualität argumentiert, daß der Prozeß des coming outs aus multiplen Dimensionen geformt sei, nicht nur die sexuelle Attraktion und das Verhalten beinhaltend, sondern auch politische Verpflichtungen, Emotionen und die Gemeinschaftsbeteiligung. Im Studieren selbstidentifizierender bisexueller Frauen und Lesben, hat Rust herausgefunden, daß die Mehrheit beider Gruppen beteiligt waren in andere Geschlechtsbeziehungen und angezogen waren zu beiden, Frauen und Männern, jedoch ihre Erfahrungen in unterschiedlichen Varianten interpretierten und bezeichneten, die oft auch widersprüchlich waren.

» Bisexuality (2004) «
glbtq archive
Brett Genny Beemyn

Like most research on sexuality, models of lesbian and gay identity development have often ignored or dismissed bisexuality. These models characterize the coming out process as a movement that typically involves recognizing one's same-sex attraction, finding other lesbians and gay men, accepting oneself, becoming immersed in the lesbian and gay community, and finally, integrating sexuality into one's selfidentity. While bisexuals may share some of these experiences, they are rarely included in theories of sexual identity development. A number of models do mention bisexuality, but only in the context of forestalling the formation of a positive lesbian or gay identity.

Few researchers have specifically considered bisexual identity development. Based on studies of bisexual women and men in San Francisco in the 1980s, Martin Weinberg, Colin Williams, and Douglas Pryor devised a four-stage model to describe the coming out process for bisexuals: initial confusion, finding and applying the label, settling into the identity, and continued uncertainty. This last stage, which they saw as unique to the experiences of many bisexuals, resulted from the relative lack of a bisexual community for social validation and the persistent pressure bisexuals receive from parts of the lesbian and gay community to identify as lesbian or gay instead.

Other theorists have rejected the appropriateness of linear stage models. Paula Rodríguez Rust, one of the foremost researchers on bisexuality, argues that the process of coming out is shaped by multiple dimensions, including not only sexual attraction and behavior, but also political commitments, emotionalities, and community involvement. In studying self-identified bisexual women and lesbians, Rust found that the majority of both groups had been involved in other-sex relationships and were attracted to both women and men, but interpreted and labeled their experiences in different and often conflicting ways.

Diese Darlegungen heben hervor, daß das Identitätswesen der Bisexuellen grundsätzlich gestört ist, aufgrund des allgemeinen unkenntlichen Präsenzwesens und sich Bisexuelles darin nur ansatzweise begründen, jedoch nicht entfalten kann. Es verdeutlicht die bedingende Erfordernis des Reflektionswesens, woraus das Miteinander sich fundiert. Insofern die Bisexualität nicht als vorausgehendes Abbildnis in Erscheinung tritt, ergibt sich daraus einzig Fragwürdigkeiten und verklärt von Grund auf die Gegebenheiten. Es zeigt auf, daß diese Gegebenheit des Menschen Selbst von Grund auf in Frage stellt, gegenüber den sich darbietenden Regularien des Seins. Das Geistwesen und das Sinneswesen treten hierin aufgrund dessen in Konkurrenz gegeneinander an, worin das jeweilige Ermessungswesen darüber bestimmt, welches das Geleitwerk bestimmt. Und selbst, wenn in den Inbetrachtziehungen einzig die Äußerlichkeiten ihre Aufmerksamkteit erfahren, gelangt darüber das Sinneswesen keineswegs ins Abseits, sondern im Gegenteil, wie es die Beschreibungen der kontrahierenden Gegebenheiten der Worte darlegen. Es verhindert nicht das Sein, jedoch die Erfüllung und gerade darüber entfaltet sich aus diesem Leid der Unerfülltheit die Leidenschaft, welche jedoch verkümmert, insofern es nicht als solches seine regulierende Inbetrachtziehung erfährt. Gerade darin besteht die Besonderheit dieser mentalen Veranlagung, daß es die Erfüllung in sich beinhaltet, es sich daraus selbst jedoch nicht ausfüllt, sondern der Ausfüllung durch das Miteinander bedingt. Und so kann sich auch die darauf fußende Leidenschaft nicht umsetzen, insofern die Kenntlichkeit nicht als solche in Erscheinung tritt. Um sich darin zu finden, bedingt es, einander darin erkenntlich zu zeigen. Und gerade darin besteht die sich aufweisende eigentliche Behinderung, die es zu überbewältigen gilt. Die Sprache bildet hierin den eigentlichen Mißstand und somit bedingt es auch der erforderlichen Aufklärung darüber.

Divider

Der Sexualitätsbegriff

Divider

Die Entstehung des Sexualbegriffes - passender ausgedrückt: des Wortes, denn die Definition erfährt des weiteren gar nicht diese Bezugnahme, findet über die aufkeimenden botanischen Wissenschaften statt und überträgt sich von dort aus auf die gesamte Biologie und das Allgemeinwesen. Aufgrund des Spezifischen seines Ursprunges und den verwickelten Entwicklungen des Bedeutungsinhaltes, bedingt es des Auseinanderhaltens von Wort (abseits seiner Definition als Begrifflichkeit) und Sache, denn sowohl als auch, basieren hierin auf ihrer ganz spezifischen Besonderheit, die es zu verdeutlichen gilt. Maßgeblich ist, daß man sich diesbezüglich in der Botanik noch in einem relativen Niemandsland befand. Man hatte bis zu dem Zeitpunkt zwar Kenntnisse über Samen und die stattfindende Vermehrung darüber, jedoch wurde es zu jener Zeit überhaupt erst zum Gegenstand der Inbetrachtziehung, wie es sich generell mit dieser Art der Vermehrung verhält. Dieser Wandel von der reinen Inbetrachtziehung der Vermehrung, hin zum Zusätzlichen der Fortpflanzung, ist des Wesens Kern, welcher sich hierin vollzieht. Ausschlaggebend wurde das aufbringende Erkennen, daß es zur Entwicklung von Pflanzensamen des hinzufügens von Pollen bedingt - der Befruchtung, ohne das sich Samen nicht entwickeln. Man erkannte hierüber, daß es sich hierin auch bei Pflanzen gemäß der Teilung von Männlichem und Weiblichem der Fortpflanzung der Tier- und Menschenwelt verhält. Ausschlaggebend wurden die spezifischen Ergründungen der Befruchtungsvorgänge, welches vor allem über Camerarius und dessen beschreibenden Erfahrungen seine erstliche populäre Aufmerksamkeit erlangte. Man hatte zwar zuvor Derartiges bezüglich des Bestäubens vereinzelt kennengelernt, jedoch vor allem nicht in einer derartigen allgemeingültigen Präsenz in Betracht gezogen. Was das Männliche und Weibliche überhaupt repräsentiert, erfolgte aufgrund der gänzlichen Unkenntlichkeit dessen somit hierin auch in umgekehrter Weise, was darauf basierte, daß der Sachverhalt von Fortpflanzungsorganen darin auch gar nicht nachvollziehbar war, sodaß zunächst die Fortpflanzung ihre Ergründung erfuhr und erst im späteren Verlauf, in Verbindung mit der Erfindung von Vergrößerungsgläsern, eine immer weiter detaillierende Beschäftigung der Fortpflanzungsorgane stattfand.

Nachfolgend die lateinische Schrift des Camerarius und dessen deutsche Übersetzung von Möbius, worüber sich die einstige Gegebenheit in seinen Details zeigt. Die Sexualität, in dessen Bezug es später von Sachs seine Beschreibung erfährt, ist hierin in keiner Weise Bestandteil der Inbetrachtziehung. Hierzu gilt es zu bedenken, daß bei den Pflanzen, gegenüber den Lebewesen, überhaupt keine 'geschlechtliche Vereinigung' stattfindet, sodaß man darin zunächst rein die Befruchtung der Samen in Betracht zog. Darüber alleine bildete sich auch zunächst das Bildnis über die bedingende Zusammenkunft zweier voneinander unterscheidender Präsenzen, gemäß des Männlichen und Weiblichen. Die Sichtung ist dem gemäß hierin auch rein auf das gerichtet, was sich darüber als Ersichtliches aufweist und so erfährt man mustergültig über Camerarius auch den zu der Zeit bestehenden Kenntnisstand 'in Annäherung' des Nachvollzuges. Gravierend ist somit, dem gegenüber, daß man in späteren Darstellungen, wie nachfolgend über Sachs dargestellt, sprach-, wie sachtechnische Bezugnahmen darlegt, die jedoch darin noch gar nicht bestanden, so auch weder der von diesem angewandte Begriffs- und Sachbezug zur Sexualität.

https://commons.wikimedia.org/wiki/File:Rudolf_Jacob_Camerarius._Line_engraving_by_J._C._Dehne._Wellcome_V0000975.jpg
Line engraving by J. C. Dehne


» «


Übersetzung und Anmerkungen von
De sexu plantarum epistola

Verlag: Wilhelm Engelmann
» «


vom 16. Jahrhundert bis 1860
Verlag: R. Oldenburg
» «

S. 418: Das Hauptwerk des Camerarius über die Sexualität der Pflanzen ist seine vielgenannte, aber wie es scheint, von sehr Wenigen gelesene De sexu plantarum expistola, die er am 25. August 1694 an Valentin Professer in Gießen richtete. Dieser Brief ist das Umfangreichste, was bis dahin und selbst bis in die Mitte des vorigen Jahrhunderts über die Sexualität der Pflanzen geschrieben wurde; er enthält aber auch das bei Weitem Gründlichste in dieser Richtung vor Koelreuter. Die Darstellungsweise weicht sehr zu ihrem Vortheil von der jener Zeit weit ab und ist durchaus im modernen naturwissenschaftlichen Sinn gehalten: eine vollständige Kenntniß der einschlägigen Literatur wird hier mit sorgfältiger Kritik gehandhabt; der Blüthenbau klarer als jemals vorher und lange nach ihm dargestellt und zwar ausdrücklich in der Absicht, den Sinn seiner Experimente über die Sexualität verständlich zu machen. Man sieht es der ganzen Haltung des Briefes an, daß Camerarius von der außerordentlichen Wichtigkeit der Frage durchdrungen war und daß es ihm darauf ankam, die Existenz der Sexualität auf jede mögliche Weise festzustellen.

S. 433: Demnach haben Linné' und seine Schüler in dem Zeitraum zwischen Camerarius' und Koelreuter's Arbeiten zur Begründung der Tatsache, daß es eine geschlechtliche Differenz bei den Pflanzen und eine Bastardirung verschiedener Arten gebe, keinen einzigen neuen oder stichhaltigen Beweis beigebracht und wenn dennoch zahlreiche spätere Botaniker Linné's große Verdienste um die Sexualtheorie gerühmt, ihn als den hervorragendsten Begründer derselben bezeichnet haben, so beruhte das zum Theil darauf, daß sie Linné's scholastische Deductionen von naturwissenschaftlichen Beweisen nicht zu unterscheiden vermochten, zum Theil auf der früher schon erwähnten Verwechslung der Begriffe Sexualität und der auf die Sexualorgane gegründeten Eintheilung der Pflanzen; auf eine solche laufen z.B. auch die Ansprüche hinaus, welche Renzi für Patrizi erhoben, Ernst Mayer jedoch bereits als auf diesem Irrthum beruhend zurückgewiesen hat (Mayer, Gesch. d. Bot. IV p. 420). Noch in unserem Jahrhundert wurde De Candolle von Johann Jacob Römer getadelt, daß er Linné nicht als den Begründer der Sexualtheorie habe gelten lassen.

Über Sachs erfährt man hingegen auf wundersame Weise und in aller Deutlichkeit, einen Überblick über die Verhältnisse zu jener Zeit, vor allem das des zueinander und gerade darin bestand die Problematik, daß viele etwas eigenes praktizierten, jedoch kein Einheitswesen darin bestand. Diese Blütezeit, als das man sie bezeichnet, erweist sich zunächst vielmehr als ein Sodom und Gomorra, welches auf dem bedingenden Streben der Losreißung vom Alten und der unerweichlichenden Bedingung von Neuem fußt und führt auch letztendlich zur völligen Zerrissenheit, indem es letztendlich einzig noch um das Ermessen der Popularität sich dreht, worüber sich auch die Abläufe der Zukunft darin bestimmt. Hierin steckt jedoch auch der Keim dessen, was das Auftreten des Linné bestimmt, in welchem dieser geschickt zu leiten weiß, die diversen Fragmente zu einer Einheit zusammenzuführen und über sein Werken zu einem vereinenden Leitwerk auszugestalten. Maßgeblich ist und dies erfährt man über die späteren Handhabungen nur noch indirekt, daß man über Linnè's Leitwerk auch eine Mauer errichtet, gegenüber dem Vormaligen, sodaß es auch einzig daraus selbst ersichtlich wird. Linné wird zum Reformator, worüber sich alles miteinander koordiniert, jedoch einzig als Leitsystem, nicht jedoch des Einzigen. Maßgeblich ist hierin, daß es sich bei Linné um ein künstliches System der Erfassung und Abbildung handelt. Und wie dieser selbst im Besonderen hervorhebt, so soll es auch einzig derart in Betracht gezogen werden und sich im Weiteren auch eine natürliche systemtische Erfassung entwickeln. Diesem geht es darum, daß die Gegebenheiten einen gemeinsamen Grundstock erhalten, um das Ganze zu vereinen.


vom 16. Jahrhundert bis 1860
Verlag: R. Oldenburg
» «

S. 85: Linnè wird gewöhnlich als der Reformator der beschreibenden Naturwissenschaften bezeichnet, mithin die Ansicht ausgesprochen, daß mit ihm eine neue Entwicklungsreihe in der Geschichte unserer Wissenschaft beginnt, etwa so, wie mit Copernicus eine neue Astronomie, mit Galiläi eine neue Physik begann. Diese Auffassung der geschichtlichen Stellung Linné's, wenigstens soweit es sich um sein Hauptfach, die Botanik, handelt, wird aber nur derjenige hegen können, dem die Werke von Caesalpin, Jungius, Ray, Rifin nicht bekannt sind oder der die in Linné's theoretischen Werken reichlich vorhandenen Citate nicht beachtet. Linné ist vielmehr vorwiegend das letzte Glied der Entwicklungsreihe, welche sich in den eben genannten Männern darstellt; der ganze Gesichtskreis Linné's, der ganze Inhalt seiner Gedanken sind dieselben, die Grundirrthümer jener Zeit theilt Linné ebenfalls, ja er hat ganz wesentlich dazu beigetragen, diese letzteren bis in das 19. Jahrhundert hinein fortzupflanzen. Mit der Behauptung, daß Linné nicht den Anfang einer neuen Entwicklungsperiode, sondern den Abschluß einer älteren darstellt, ist aber keineswegs gesagt, daß seine Wirksamkeit für die spätere Zeit verloren gewesen sei. Linné verhält sich zu den Systematikern der hier geschilderten Periode eben so, wie sich Caspar Bauhin zu den Botanikern des 16. Jahrhunderts verhält; wie dieser alles Brauchbare seiner Vorgänger außer Caesalpin zusammentrug und aus ihm wiederum die Botaniker der zweiten Periode schöpften, obwohl sie von ganz anderen Gesichtspuncten ausgingen; ebenso hat Linné Alles, was die Systematiker des 17. Jahrhunderts auf Grund Caesalpin'scher Ideen geleistet, in sich aufgenommen, es zu einem Ganzen verschmolzen, zu einem Lehrgebäude vereinigt, ohne im Grunde etwas wesentlich Neues hinzuzubringen; in ihm gipfelte Alles, was von Caesalpin bis auf Tournefort an systematischer Botanik sich entwickelt hatte und die Resultate, die er in sehr eigenthümlicher Form aber mit wahrer Meisterschaft zusammenfaßte, blieben für die spätere Entwicklung der Botanik eben so wenig unfruchtbar, wie der Inhalt von Caspar Bauhin's Werken für die Nachfolger des Caesalpin.

Wer die Werke von Caesalpin, Jungius, Morison, Ray, Rivinus, Tournefort mit Linné's Fundamenten der Botanik (1736), seinen Classes plantarum (1738), und seiner Philosophia botanica (1751) sorgfältig vergleicht, muß sich auf das Bestimmteste überzeugen, daß der ideelle Inhalt der Linné'schen Theorien bereits in jenen Werken zerstreut enthalten ist; wer ferner die Geschichte der Sexualtheorie seit Rudoph Jacob Camerarius (1694) verfolgt hat, muß zugeben, daß er jedoch zu ihrer Anerkennung wesentlich beigetragen hat, obgleich nicht geleugnet werden kann, daß er selbst nach den Kölreuter'schen Arbeiten noch höchst unklare, ja mystische Vorstellungen von der Sexualität der Pflanzen hegte.

Was aber Linné dennoch eine so überwältigende Bedeutung für seine Zeit gab, das ist die geschickte Zusammenfassung Alles dessen, was vor ihm geleistet worden war; gerade diese Verschmelzung des bisher Bekannten und Zerstreuten ist nicht nur das Charakteristische bei Linné, sondern auch zugleich ein großes Verdienst.

Caesalpin trug zuerst die aristotelische Denkweise in die Botanik hinein; sein System sollte der Absicht nach ein natürliches sein, blieb aber ein äußerst unnatürliches; Linné, dem man überall den tiefen Eindruck ansieht, welchen Caesalpin auf ihn gemacht hat, behält das Bedeutendste, erkennt aber, was keiner vor ihm erkannte, daß die Art von Systematik, wie sie Caesalpin, Morison, Ray, Tournefort, Rivin getrieben hatten, dem ihm vorschwebenden Zweck, nämlich der Auffindung der Verwandschaften, unmöglich genügen könne, daß vielmehr auf diesem Wege nur eine künstliche und nützliche Anordnung gewonnen wird, während die Darstellung der natürlichen Verwandtschaften auf ganz anderem Wege zu suchen ist.

Was die Nomenclatur der Pflanzentheile betrifft, in welcher sich die damalige Morphologie erschöpfte, so nimmt Linné den ganzen Inhalt der Isagoge des Jungius in sich auf, gibt ihm aber eine übersichtlichere Form und bereichert die Blüthentheorie, indem er ohne zu zögern die damals noch wenig beachtete sexuelle Bedeutung der Staubgefäße verwerthet und so eine bessere Gesammtauffassung der Blüthe gewinnt, die ihrerseits wieder ihre Früchte in einer eben so anschaulichen als bequemen Nomenclatur beiträgt: die noch jezt in der Wissenschaft gebräuchlichen Namen wie diöcisch, momöcisch, triandrisch, monogynisch u.s.w., mittelbar auch die später erfundenen Ausdrücke; dichogamisch, portandrisch, protogynisch u. dgl. verdanken ihre Entstehung dieser richtigen Auffassung der Geschlechtsverhältnisse der Pflanzen.

Aber auch ein großer Irrthum lief mitunter, der nicht wenig dazu beigetragen hat, Linné's Ruhm zu vermehren. Linné nannte sein künstliches auf die Zahl, Verwachsung und Gruppierung der Staubgefäße und Carpelle gegründetes System das Sexual-System der Pflanzen, indem er die vermeintliche Vorzüglichkeit desselben darin fand, daß es auf Organe gegründet sei, deren Function die allergrößte Bedeutung beansprucht. Es liegt aber auf der Hand, daß das Linné'sche Sexualsystem genau denselben classificatorischen Werth haben würde, wenn die Staubgefäße mit der Fortpflanzung gar nichts zu thun hätten oder wenn die sexuelle Bedeutung derselben ganz unbekannt wäre. Denn gerade diejenigen Merkmale der Staubgefäße, welche Linné classificatorisch verwerthet, ihre Zahl und Verwachsungsweise sind für die Sexualfunction selbst völlig gleichgültig.

Wenn daher die Bedeutung dieses künstlichen Systems für die Lehre von der Sexualität der Pflanzen auf einer Verschiebung und Verwirrung von Begriffen beruht, so ist zugleich hervorzuheben, daß überhaupt der Verfolg der Wissenschaft gezeigt hat, wie Linné's Sexualsystem gerade deshalb, weil die von ihm benutzten Eigenschaften der Staubgefäße von ihrer Function ganz unabhängig sind, vielfach zur Aufstellung natürlicher Gruppen führen mußte, denn wir dürfen es als ein wichtiges Ergebnis betrachten, daß den größten classificatorischen Werth diejenigen Eigenschaften der Organismen darbieten, welche von den Functionen der Organe ganz oder zum größten Theile unabhängig sind. Derselbe Irrthum, welcher Caesalpin dazu veranlaßte, die functionelle Wichtigkeit der Fructificationstheile zum Princip der Eintheilung zu machen, kehrt also bei Linné in anderer Form wieder: um ein Eintheilungsprincip zu finden, wendet er sich an diejenigen Organe, deren Function ihm die wichtigste scheint, er nimmt aber die Merkmale nicht etwas von den Verschiedenheiten der Function, sondern von der Zahl und Verwachsungsweise, welche für die Sexualfunction ganz gleichgültig ist. Ganz demselben Irrthum begegnen wir übrigens auch bei Leibniz und Burkhard, die ich hier deshalb erwähne, um Linné gegen den ihm von seinen Zeitgenossen wiederholt gemachten Vorwurf in Schutz zu nehmen, als ob er die Idee seines Sexual-Systems diesen beiden verdanke. Allerdings hatten sie, sowie später Linné, in der großen physiologischen Bedeutung der Sexualorgane irrthümlich den Grund gefunden, aus ihren Verschiedenheiten die Eintheilungsgründe für ein System abzuleiten; aber das war eben der Irrthum in der Sache; das richtige, was nun Linné wirklich that, sich nämlich für den Zweck der Systematik an rein morphologischen Eigenschaften zu halten und diese zweckmäßig zu verwerthen, daß thaten jene nicht.

Das bisher über ihn Gesagte trifft übrigens vorwiegend nur die Art und Weise, wie sich Linné im Einzelnen bethätigte; seinem innersten Wesen nach war er aber Scholastiker, in viel höherem Grade selbst als Caesalpin, welcher nicht sowohl Scholastiker als vielmehr Aristoteliker im strengsten Sinne des Wortes genannt werden darf. Indem ich aber Linné's Denkweise als durchaus scholastisch bezeichne, so ist damit im Grunde schon gesagt, daß er ein Naturforscher im modernen Sinne des Wortes nicht war; ich könnte darauf hinweisen, daß Linné nicht eine einzige irgend bedeutende Entdeckung, welche auf das Wesen der Pflanzenwelt ein neues Licht wirft, gemacht hat; das würde jedoch noch nicht beweisen, daß er ein Scholastiker war.

Das Wesen echter Naturforschung liegt darin, aus der genauen und vergleichenden Beobachtung der Naturerscheinungen nicht nur überhaupt Regeln abzuleiten, sondern diejenigen Momente aufzufinden, aus denen der causale Zusammenhang, Ursache und Wirkung sich ableiten läßt. Indem die Forschung nach dieser Methode verfährt, ist sie genöthigt, die vorhandenen Begriffe und Theorien beständig zu corrigieren, neue Begriffe und neue Theorien aufzustellen und so unser Denken dem Wesen der Dinge mehr und mehr anzupassen; der Verstand hat nicht den Objecten, sondern die Objecte dem Verstande Vorschriften zu geben. Genau in entgegengesetzter Weise verfährt die aristotelische Philosophie und ihre mittelalterliche Form, die Scholastik; bei ihr handelt es sich eigentlich gar nicht darum, durch die Forschung neue Begriffe und neue Theorien zu gewinnen, denn diese stehen ein für allemal fest; die Erfahrung muß sich dem fertigen Gedankensystem fügen; was sich nicht fügt, wird dialectisch so lange gedreht und gedeutet, bis es scheinbar in das Ganze hineinpaßt. Die geistige Arbeit auf diesem Standpunkte besteht ganz wesentlich in diesem Drehen und Wenden der Tathsachen, denn die ganze Weltanschauung selbst ist fertig und braucht nicht geändert zu werden. Erfahrung in dem höheren Sinne der Naturforschung wird dadurch unmöglich gemacht, daß man die letzten Gründe der Dinge sämmtlich zu kennen glaubt; diese letzten Gründe und Principien der Scholastik aber sind im Grunde nur Worte mit äußerst unbestimmter Bedeutung, ihr Sinn besteht in Abstactionen, die aus der alltäglichen, nicht wissenschaftlich geläuterten, daher schlechten Erfahrungen sprungweise abgeleitet sind; und je weiter die Abstraction getrieben ist, je weiter sie sich von der Hand der Erfahrung entfernt, desto ehrwürdiger und wichtiger erscheinen diese Abstracta, über welche man sich schließlich, jedoch wieder nur durch Bilder und Metaphern gegenseitig verständigen kann. Die Wissenschaft nach scholastischer Methode, ist ein Spiel mit abstracten Begriffen, der beste Spieler der, welcher dieselben untereinander so zu verbinden weiß, daß die vorhandenen Widersprüche geschickt verdeckt werden. Wogegen die echte Forschung, sei es philosophische oder naturwissenschaftliche, gerade darauf ausgeht, etwas vorhandene Widersprüche schonungslos aufzudecken und die Thatsachen so lange zu befragen, bis unsere Begriffe sich berichtigen und wenn es nöthig ist, die ganze Theorie, die ganze Weltanschauung durch eine bessere ersetzt wird. In der aristotelischen Philosophie und Scholastik sind die Thatsachen blos Beispiele zur Erläuterung feststehender abstracter Begriffe; für die Naturforschung dagegen der fruchtbare Boden, aus welchem beständig neue Vorstellungen, Gedankenbildung, Theorien und Weltanschauungen hervorwachsen. Zu den schlimmsten Seiten der Scholastik und aristotelischer Philosophie gehört die Verwechslung bloßer Begriffe und Worte mit dem objectiven Wesen der durch sie bezeichnenden Dinge; besonders gern leitete man das Wesen der Dinge aus der ursprünglichen Bedeutung der Worte ab und sogar die Frage nach der Existenz oder Nichtexistenz eines Dinges wurde aus dem Begriffe desselben beantwortet. Diese Art des Denkens finden wir nun bei Linné überall da, wo er nicht blos als Systematiker und Beschreiber thätig ist, sondern über das Wesen der Pflanzen und ihrer Lebenserscheinungen Auskunft geben will, so in seinen Fundamenten, der Philosophia botanica und ganz besonders in dem Amoenitates academicae. Unter zahlreichen Beispielen sei nur die Art hervorgehoben, wie er die Sexualität der Pflanzen zu erweisen sucht. Linné kannte und rühmte die Verdienste des Rudolph Jacob Camerarius, der als echter Naturforscher die Sexualität der Pflanzen auf dem einzig möglichen Wege, dem des Experimentes, erwiesen hatte; dieser experimentelle Nachweis indessen läßt ihn kalt, er erwähnt ihn nur ganz nebenbei, dagegen verwendet er seine ganze Kunst auf eine ächt scholastische Beweisführung an den durch unvollständige Induction gewonnenen Satz Harveys: omne vivum ex ovo, den er offenbar für ein a priori selbststehendes Princip hält und folgert nun daraus, daß auch die Pflanzen aus einem Ei entstehen müssen, indem er übersieht, daß in dem Satze omne vivum ex ovo die Pflanzen ohnehin schon die Hälfte des omne vivum ausmachen; ...

Geschichte der Sexualtheorie (S. 406)

  1. Von Aristoteles bis auf R. J. Camerarius
  2. Begründung der Lehre von der Sexualität der Pflanzen durch R. J. Camerarius 1691-1694
  3. Verbreitung der neuen Lehre, ihre Anhänger und Gegner 1700-1760
  4. Evolutionstheorie und Epigenesis
  5. Weiterer Ausbau der Sexualtheorie durch J. G. Kölreuter und Conrad Sprengel 1761-1793
  6. Neue Gegner der Sexualität und ihre Widerlegung durch Experimente 1785-1849
  7. Mikroskopische Untersuchung der Befruchtungsvorgänge der Phanerogamen; Pollenschlauch und Keimkörper 1830-1850
  8. Entdeckung der Sexualität der Kryptogamen 1837-1860

Was den weiteren Ablauf betrifft, so trifft man auch bei Kölreuter, dem Meilenstein zwischen Camerarius und Linné, auf keine Sexualität, sondern einzig auf ein Verhältniswesen gemäß des Camerarius, jedoch betreibt dieser akribisch Kreuzungsversuche und befördert hierüber das maßgebliche Verständnis über die Fortpflanzung zutage, nicht nur im Bezug auf Pflanzen, sondern über das Generelle dieser Wesensart der geschlechtlichen Vereinigung. Zwar vermischt sich hierin noch der Vergleich des Geschlechts mit dem des Wesens des Organismus, gemäß seiner Anwendung, die sich rein auf die Kreuzungen zweier unterschiedlichen Arten beziehen, jedoch bildet dieser über den chemischen Vergleich, der Vereinigung von Säure und Lauge zum Salz, einen wesentlichen Bestandteil des Wesens Kern ab. Darauf basiert auch die Grundlage der später entstehenden Genwissenschaft, dem gegenüber sich jedoch sowohl Kölreuter, als auch die Genwissenschaft, in der Quantität verlieren, was sie darüber zwar zu reproduzieren wissen, aber doch gelangen sie darüber nicht zu des Wesens Kern, nämlich dem des Sexual- und Geschlechtswesens. Dieser verdeutlicht sich nämlich gerade über Kölreuters Vergleich, dem gegenüber sich jedoch das Wesen fortpflanzt und nicht das Geschlecht, hingegen pflanzt es sich einzig über die Vereinigung der differenzierenden Geschlechtlichkeit fort. Gerade darin besteht des Wesens Kern des Einheitsverbundes dieser beiden Wesensarten von Sexualität und Geschlecht, denn im Gegensatz zum Geschlecht, bildet hierin nicht das Fortpflanzungsverhältnis und somit die Vereinigung des Männlichen mit dem Weiblichen die substanzielle Grundlage, sondern primär die Einheit des Organismuses und das Geschlechtliche ist hierin ein anteiliger Bestandteil. Es handelt sich somit auch nicht, gemäß seines Vergleichs, um das Verhältnis eines Salzes, sondern um das des Synonyms, was sich darüber aufweist. Darauf basiert des Wesens Kern des untrennbaren Verbundes des Sexualitätswesens mit dem Geschlechtswesen. So zeigt sich jedoch auch hierüber, daß nur das Eine seine Inbetrachtziehung darin erfährt und keine davon sich unterscheidendes Sexualwesen. Und so kann man Kölreuter's Fortentwicklung auch bereits erkennen, als ein sich als solches bezeichnendes Erkennen der geschlechtlichen Fortpflanzung.

https://commons.wikimedia.org/wiki/File:Josef_Gottlieb_Koelreuter_(original_upload).jpg

Das Geschlecht der Pflanzen
betreffenden Versuchen und Beobachtungen
()

» Band 2-4 «
Verlag: Gleditschischen Handlung
» «

Band II, § 1: Zu der Erzeugung einer jeden natürlichen Pflanze werden zwey gleichförmige flüßige Materien von verschiedener Art erfordert, die von dem Schöpfer aller Dinge zur Vereinigung für einander bestimmt sind. Die eine davon ist der männliche, die andere der weibliche Saame. Da diese Materien von verschiedener Art, oder ihrem Wesen nach von einander unterschieden sind : so ist leicht zu begreifen, daß auch der Kraft der einen von der anderen verschieden seyn muß. Aus der Vereinigung und Vermischung dieser beyden Materien, die auf das allerinnigste und ordentlicher weise nach einem bestimmten Verhältnisse geschieht, entsteht eine andere, die von mittlerer Art ist, und folglich auch eine mittlere, aus jenen beyden einfachen Kräften entstandene, zusammengesetzte Kraft besitzt : ebenso wie aus der Vereinigung eines sauren und laugenhaften ein drittes, nämlich ein Mittelsalz entsteht. Diese dritte Materie ist alsdenn entweder so gleich nach geschehener Vermischung schon bereits der Anfang oder die feste Grundlage einer belebten Maschine, oder sie bringt sie erst einige Zeit hernach aus sich selbst hervor. Niemals würde dergleichen etwas aus einem von jenen beyden Saamenstoffen allein haben entstehen können : so wenig, als entweder aus einem reinen sauren oder einem reinen laugenhaften Salze allein ein Mittelsalz werden, und sich ein Kristall bilden würde. Auf dieser Grundlage und ihrer wirkenden Kraft, die, nach der verschiedenen Art ihres beyderseitigen Saamenstoffs, bey einer jeden besonderen Gattung einer belebten Maschine, nothwendiger weise verschieden seyn muß, beruhet die ganze allmälig vor sich gehende Bildung der künftigen Pflanze, ihr besonderer organischer Bau oder ihre specifique Natur, wodurch sie sich von allen andern unterscheidet, und die Zubereitung der zu einer neuen ähnlichen Zeugung erforderlichen Saamenstoffe, und, mit einem Worte, alle diejenigen Vollkommenheiten, die zu dem Endzwecke, zu welchem sie bestimmt ist, erfordert werden. Unter diesen Vollkommenheiten ist die Fruchtbarkeit oder die Eigenschaft ihres gleichen hervorzubringen wohl unstreitig eine der vornehmsten, und die jenen Endzweck größtentheils zu erfüllen scheint. Alle Bewegungen und Veränderungen, die von dem Keimen an bis zur Blütezeit in einem jeden solchen Meisterstück der Natur vorgehen, scheinen bloß auf das große Zeugungswerk gerichtet zu seyn, und daran, so zu sagen, mit vereinten Kräften zu arbeiten. Sie zielen alle dahin ab, diejenigen zusammengesetzte Materie, worauf sie gegründet sind, nach und nach aufzulösen, und sie wieder in die zwey ursprünglichen Grundmaterien zu theilen, oder eigentlicher zu reden, diese letztern in einem vollen und, besonders von der einen Seite, in einem ungleich größern Maase, als zu der vorhergegangenen Zeugung erfordert worden, selbst hervorzubringen. Daß es so weit mit diesem großen Werke gekommen sey, verkündiget uns gleichsam der feyerliche Tag, an deme sich die Blumen unserem Auge in ihrer vollen Pracht zeigen. Und eben dieser den Pflanzen heilige Tag ist es auch, da die Natur die letzte Hand an dieses Werk legt, indem sie jene beyde Grundmaterien in einem gegen den ganzen Vorrath oft sehr kleinen, aber bestimmten Maaße an dem gehörigen Orte auf das allerinnigste mit einander vermischt, und dadurch den Grund zu einer neuen Zeugung und einer ähnlichen Pflanze legt.

Band III, § 20, S. 38: Wenn ich meine Leser aus neuern, unzähligemal wiederholten, Beobachtungen versichere, daß die Insekten fast bey allen mir bekannten Gattungen Wollkraut, und vorzüglich bey dem Verbase. Lychnit. nigr. und Blattar. zur Bestäubung das allermeiste beytragen; wenn ich ihnen ferner melde, daß bald diese, bald jene Gattung unserer einheimischen von einer anderen oft kaum einen oder etliche Schuh weit entfernt ist, und durch diese geschäftigen Creaturen täglich solche Vermischungen und Verwechslungen des Samenstaubes bey ihnen bewirkt werden, woraus unter gewißen, aber in der Wildniß nicht Statt findenden Umständen, nothwendigerweise Bastarde entstehen müßten, und doch dem allen ungeachtet weder von mir, noch von so vielen ander Kräuterkennern jemals dergleichen in einem ganz freyen Felde angetroffen worden : so wird man mit mir die weise Einrichtung des großen Schöpfers nicht genug bewundern können, der durch ein gewisses in die Natur gelegtes Gesetz, das bey so mancherley Befruchtungen auf das strengste befolgt wird, allen denen daher zu besorgenden Unordnungen und Verwirrungen vollkommen vorgebeugt hat. Es besteht darinn, daß bey einer zur Befruchtung hinreichenden Quantität von eigenem und fremdem Saamenstaube, wenn beede ungefehr zu gleicher Zeit auf das Stigma kommen, der eigene männliche Saame bey diesem wichtigen Geschäfte nur allein angenommen, der fremde hingegen gänzlich verdrungen, und von der Befruchtung ausgeschlossen wird; eine Wirkung, die ich durch die zuverläßigsten Erfahrungen außer allen Zweifel gesetzt habe. Es ist dieses Gesetz der näheren Verwandtschaft allem Ansehen nach von einem sehr großen Umfange in der Natur, und es gründen sich, wie es scheint, auf eben dasselbe eine Menge schon längst bekannter Erscheinungen, die so wohl in der Chemie, als Physik, täglich vorkommen.

Bei Linné dann folglich angelangt, gilt es sich zunächst zu verbildlichen, was dieser tatsächlich aufbringt, nämlich das 'clavis systematis sexualis'. Maßgeblich hierin ist, daß dieser den lateinischen Begriff 'sexualis' aufbringt und nicht den deutschen Begriff der Sexualität, denn seine Schriften sind in Latein verfaßt. Des weiteren hebt seine Ausführung in Verbindung mit 'systematis' das Wesentliche hervor, daß es sich auf das Sexualsystem bezieht (Ordnungssystem der Sexualität - Bezug: sexus). Dem gemäß bezieht es sich auch nicht, wie man es rückbeziehend ausführt, auf die Geschlechtsorgane, sondern auf Ehemänner (mariti), Ehefrauen (uxores), sowie Männlichem und Weiblichem. Maßgeblich hierin ist, daß weder das lateinische Genus, noch Sexus, sich auf die Genitalien bezog, gemäß dem es sich auch sprachlich voneinander differenziert. Vielmehr hat jedoch in Verbindung mit den botanischen Entwicklungen hierin ein Wandel stattgefunden, worin man dazu überging, die Genitalien als Geschlechtsorgane zu benennen. Wie sich über Linné's Ausführungen verdeutlicht, so ist diesem wohl dieser Sachstand gänzlich nicht nachvollziehbar und hebt indess hervor, wie es sich gemäß seines Bezugswesens des Althergebrachten damit verhält. Des Menschen Bezugsverhältnis war nämlich, gemäß seiner Ausführung, nicht auf die Inbetrachtziehung der Geschlechtsorgane begründet, sondern gemäß des lateinischen Sexus und Genus bezog es sich auf die Gleichen einer Art/Gattung, in Unterscheidung zu den anderen dessen Art/Gattung. Gleichermaßen verhielt es sich mit dem deutschen Geschlecht. Gerade dies tritt über seine Ausführung hervor, was seine Erläuterungen in aller Ausführlichkeit auch beschreiben. Elementar ist somit auch, daß sein Aufbringen des Sexualitätbegriffs nicht dem entspricht, was sich daraus entwickelt, sondern spezifisch darüber die Sexualität deklariert, worin die Geschlechtsorgane einzig anteilig beteiligt sind, jedoch nicht der maßgebliche ermessende Inbetrachtziehungsgegenstand.

Linnae Clavis Systematis Sexualis 1735
» Clavis Systematis Sexualis (1758) «
» Carl von Linné «

Linnaei methodus sexualis 1737
» Methodus sexualis (1737) «

» Carl von Linné «

» Systema Naturae (Erstausgabe 1735) «
Caroli Linnaei


Verlag: G. Reimer
» «


ein Lebensbild
Verlag: J. D. Sauerländer
» «


Verlag: Benjamin Gottlieb Hoffmann

» Linnaeus Link «
Online union catalogue of Linnaean publications

Divider


Übersetzung der lateinischen Ausgabe
der 14. Ausgabe von » Johan Andreas Murray «
von

- Botanische Kunstworte -

Anandrum (Männerloß), Androgynum (halbgetrennt), Decandria (zehenmännige), Defloratio (Entjungferung), Diandria (zweymännige), Diandrum (zweimännig), Digynia (zweiweibige), Disseminatio (Besaamung), Dodecandria (12männiche), Erectum (Aufrecht), Femina planta (weibliche Pflanze), Femineum (weiblich), Fertile (fruchtbar), Folia vaginantia (Scheidenblätter), Folliculus (Fruchtbälglein), Fructescentia (die Fruchtmachung), Fructification (die Befruchtung), Gamnopolyspermae (nakt vielsaamige), Gyandri (eifersüchtige), Gymnodisperae (nakt 2saamige), Gymnospermae (naktsaamige), Gymnotetraspermae (nakt viersaamige), Heptandria (7 männiche), Hermaphroditum (Zwitter), Hexandria (sechsmänniche), Hybrida planta (Bastardpflanze), Hybridum (Bastard), Hysterophorum (gebährmutterähnlich), Icosandria (20männich), Mas (der Mann), Mascula planta (Männliche Pflanzen), Masculae (männlich), Monandria (einmänniche), Monogymnia (einweibige), Monogynum (Einweibig), Octandria (Achtmänniche), Ovarium (Eyerstock), Pentandrum (Fünfmännich), Petiolus vaginans (Scheidenstiel), Planta foeminea (Weibliche Pflanze), Planta hermaphrodita (Zwitterpflanze), Pollen (Saamenstaub/Blumenstaub), Polyandria (Vielmänniche), Polydelphia (Vielbrüdriche), Polygamia (vermengte Pflanze), Polygamum (Vielweibig vermengte), Polygynia (Vielweibliche), Polyspermae (vielsaamige), Propago (Brut), Semen (Samen), Spermaphorus (saamenbringend), Sterilis (unfruchtbar), Stimulans (reizend), Stipulae (Scheidenansätze), Synegenesia (Mitbuhler), Testiculus (Hoden), Tetrandria (4männiche), Triandria (3männiche), Trigynia (3weibige), Trispermum (3saamig), Vagina (Scheide), Vaginales (scheidige)

- Kennzeichen der Klassen -
(anklicken zum vergrößern)

Kennzeichen der Klassen 01 Kennzeichen der Klassen 02 Kennzeichen der Klassen 03

- Schlüssel und Ordnungen -
(anklicken zum vergrößern)

Lippert Schlüssel Lippert Ordnungen

Elementar ist hierin, daß es sich primär um die Fortpflanzung dreht und diesbezüglich fanden diverse ideologische Veränderungen statt bezüglich dessen, was und wie sich das Jeweilige fortpflanzt. Leittragend bezüglich der Sache und somit auch der Ideologie ist hierin jedoch nicht das sachliche, sondern das kulturelle Erbwesen. Und diesbezüglich entstand gegenüber dem Ursprünglichen im Verlauf ein Widerspruch, welcher sich vor allem sprachtechnisch als Hindernis stellte. Die Grundlage der Vererbung bildete sich nämlich auf dem lateinische Gen, dem gegenüber vor allem der aufkommende Erbadel und darüber sich umsetzenden Allgemeinwesens, gemäß dem dies über den erstgeborenen männlichen Erben eingerichtet wurde, sich dies als widersprüchlich stellte, denn dem gegenüber erweist sich das Gen als unpassend, da es auf beiderlei Geschlechtlichem und auch Allumfassenden hin ausgebildet ist (genitalia, genus, generatione, ...). Über die Bezugnahme von Geschlechtsorganen, worüber sich das Geschlecht vererbt, erfährt dies indess seine entsprechende Anpassung daran. Maßgeblich hierin ist, daß es sachtechnisch einzig als Neues hinzutritt, jedoch nicht das Althergebrachte gänzlich ersetzte, sondern es sich als eine Verdrängung stellte, dem gegenüber das Alte jedoch als solches sich bewahrte, gemäß man heutzutage auch die Genitalien, Geschlechtsorgane und Sexualorgane im Nebeneinander antrifft. Bereits im Lateinischen trifft man entsprechendes an, indem darin der Sexus sich zusätzlich zu dem Genus hinzugesellt, sich jedoch substanziell von dem des Genus trennt und man keinerlei darüber hinausgehende Wortbildungen antrifft. So existierte bis dato auch nicht das lateinische sexualis, welches Linné aufbringt und stellt eine neue Wortschöpfung dar, welche auf diesem sexus aufbaut und nicht, wie es allseits in Verbund darstellend und darüber verfälschen dargelegt wird, auf dem des Geschlechts. Im Gegenteil, denn darüber differenziert es sich spezifisch dem gegenüber und verdeutlicht darüber die elementare Unterscheidung. Indess ist es der Samen (lat. semen), welcher sich als abseitiges von all dem stellt und in Einbezug dessen erfährt es auch sein Gesamtwesen in seinem präsenten Nebeneinander. Dies ist es auch, was über die Botanik ihr ganz spezifisches Inbetrachtziehungswesen erfährt.

Sexualwesen ↔ Geschlechtswesen ↔ Fortpflanzungswesen

Linné war Derjenige, welcher dem Sexualsystem seine in Betracht ziehende populäre Bewandtnis verschaffte und darüber wurde auch eingeleitet, was bis heute die grundlegende Auseinandersetzung damit bildet. Nämlich vor allem die Auseinandersetzung des in Betracht ziehenden künstlichen Systems, gegenüber dem des Natürlichen, welches fortwährend den Streitpunkt der Auseinandersetzung begründet. Maßgeblich ist hierin, daß Linné gar besonders hervorhob, daß es sich nur um ein Künstliches handelt und dafür ausgebildet ist, um die diversen für sich stehenen Einzelfragmente zusammenzuführen. Hier ist die Gegegenheit noch eine viel frapierendere, als man bei Kinsey antrifft, worüber man sich jedoch einmal mustergültig vor Augen führen kann, wie es sich damit verhält und worauf es beruht, daß sich die eigentlichen Entwicklungen 'als solche' letztendlich in einer Verklärung verlieren, indem nämlich das eigentlich Wesentliche - das Fundierende - außen vor gerät. Nachfolgend die Darlegung von Rádl, welcher dies einmal aus seiner dazwischenstehenden Zeitepoche heraus beschreibt. Gegenüber seiner, wie auch des Linné's Hoffnung, verändert sich hingegen die Lage durch die neueren Entwicklungen nicht, sondern das beständige Verhältnis von Neuerung und Zerfall setzt sich kontinuierlich fort. Gerade für die Gene und Chromosomen ergibt sich in der Folgezeit somit auch das Gleiche, da sie nicht das alleinige Bestimmende des Seins darin sind, sondern auch anderes daran beteiligt ist, sodaß sich das immer wiederkehrende Schicksal darüber fortsetzt. Von der isolierenden Inbetrachtziehung des Seienden als solches, bewegt man sich kein Stück breit weg, zeigt sich vor allem darüber. Gerade darauf beruhten die Auseinandersetzungen der einstigen beiden Warten der Repräsentanten des natürlichens Systems gegenüber dem des Künstlichen. Nur die Bildnisse haben sich zwischenzeitlich verändert, nicht hingegen der Urkeim der Sache selbst, nämlich das Verhältnis zu dem, daß Bildnisse nicht das Sein selbst sind. Während es die Einen als solches wahrnehmen, ist es hingegen Anderen gar nicht das Leitbild. In diesem Kernwesen trennt sich hierin auch die Spreu vom Weizen.


seit dem Ende des siebzehnten Jahrhunderts
Verlag: Wilhelm Engelmann

Es lag in der philosophischen Richtung jener Zeit, daß man sich bemühte, das Pflanzensystem rationalistisch aufzubauen, d. h. man suchte durch Abstraktion aus dem eben vorhandenen Tatsachenmaterial die wesentlichen Merkmale der Pflanzenwelt zu gewinnen und nach diesen für alle Pflanzen ein für allemal aufgestellten Regeln das System durchzuführen. CAESALPIN glaubte, daß er das natürlichste Pflanzensystem bekommen würde, wenn er die Pflanzen nach den Ernährungs- und Fortpflanzungsorganen (d. i. Samen) einteilte, da er diese Organe für die wesentlichsten hielt.

Durch das Studium der Arbeiten des Camerarius über die Sexualität der Pflanzen gelangte LINNÉ zu der Überzeugung, daß die Sexualorgane für die Pflanzen am wichtigsten sind; er behauptet, daß es keine Funktion der Pflanzen gibt, für welche die Natur so konstante Apparate ausgebildet hätte, wie die Fortpflanzung, und das ist die Ursache, warum er die Antheren und das Pistill als Einteilungsgrund des Pflanzensystems annimmt. Das Prinzip dieses Systems ist also im wesentlichen dasselbe wie bei CAESALPIN, MORISON, TOURNE-FORT und andern seiner Vorgänger. Besonders nahe steht es dem CAESALPINschen Einteilungsprinzip; Caesalpin, der mit ARISTOTELES die Sexualität der Pflanzen bestreitet, hat sein System auf die Früchte aufgebaut, LINNÉ hat nur die neue Entdeckung der Sexualorgane dazu benutzt, den CAESALPINschen Gedanken mehr zu vertiefen. Zwar hat CAESALPIN die systematische Bedeutung der Früchte aus dem Wesen der Pflanze abgeleitet und dabei auf die Funktion (Fortpflanzung), nicht auf die Form der Pflanze den höchsten Nachdruck gelegt, während das von LlNNÉ gewählte Merkmal, die Sexualorgane, bis zu gewissem Grade auch morphologisch wirklich konstant ist. Trotzdem aber ist LINNÉs System wesentlich physiologisch; denn die Funktion, die Sexualität, nicht die Struktur, d. h. das Verhältnis der Teile, gibt ihm die Hauptmerkmale. Der beste Beweis dafür, daß LINNÉ die Sexualorgane aus physiologischen, nicht aus morphologischen Rücksichten als klassifikatorische Merkmale angenommen hat, ist der, daß er auch das System der Tiere auf ihr Sexualsystem aufbauen wollte; er wurde jedoch durch die Rücksicht auf den Anstand - es war ja das 18. Jahrhundert, und die Zoologie mußte salonfähig bleiben - davon zurückgehalten.

LINNÉ wußte, daß sein Pflanzensystem künstlich ist, und hoffte, daß es einmal durch ein natürliches ersetzt werden würde. Charakteristisch ist jedoch, daß er diesen Fortschritt nicht vom Studium der Organisation der Pflanzen erwartete, sondern von der Entdeckung neuer Gattungen; so steht er in dieser Hinsicht in naher Beziehung zu den Darwinisten: von der Erfahrung erwartet er eine tiefere Erkenntnis der Eigenschaften der Art, Gattung usw. nicht, sondern von der Auffindung bisher unbekannter Arten, durch die dann die noch vorhandenen Lücken im natürlichen System ausgefüllt werden sollen.

An LINNÉs System der Pflanzen, welches auf der Beschaffenheit ihrer Sexualorgane aufgebaut ist, können wir eine kurze Übersicht der bis in das 18. Jahrhundert herrschenden Ansichten über die Sexualität anknüpfen. Die sexuellen Unterschiede, die bei dem Menschen eine ausschließlich vitale Erscheinung darstellen - in der anorganischen Natur kommt nichts Ähnliches vor -, an welche sich anatomisch, physiologisch, psychologisch, soziologisch und wer weiß, in welcher Hinsicht noch, eine Reihe der wichtigsten Probleme anknüpfen lassen, reizten die Theoretiker immer wieder, sie durch irgendeine konkrete Auffassung in das Gebiet der Biologie einzuführen. Doch bekenne ich, daß mir auf keinem andern biologischen Gebiete die Theorien, die Versuche zur Lösung des Problems so kläglich, so wenig ersprießlich vorkommen wie in diesem Falle, die modernen Theorien keineswegs ausgenommen. In den Zeiten der deutschen Naturphilosophie hat man in dem Geschlechtsunterschied eines der tiefsten Probleme gesehen; heute ist man dagegen der Ansicht, daß die Chromosomen, Centrosomen und ähnliche Elemente alle Schwierigkeiten beseitigen.

Über nachfolgendem Auszug gilt es, den weiteren sprachtechnisch Vorlauf hervorzuheben, aus dem heraus man sich später mit der Sexualität des Menschen befaßt. Wie sich hierüber verdeutlicht, so gehen in der Botanik die Hetero- und Bisexualität im Nebeneinander einher, dessen differenzierende Deklaration sich auf die Unterschiede der Geschlechtsverhältnisse der jeweiligen Arten bezieht. Beim Menschen erfährt hingegen nur das jeweilige singuläre Geschlecht für sich, im Verhältnis seines vereinigenden Singulären, seine Inbetrachtziehung. Zumindest ist dies der Ausgangspunkt der sachlichen Erwägung. Sprachtechnisch zeigt sich indess hierüber auf, was des weiteren zum zentralen Auseinandersetzungsgegenstand wird, daß sich nämlich fortwährend beides miteinander vermischt, ohne die anstrebenden Erfordernisse der Trennung zu erlangen. Das Gegenteil tritt sogar ein, sodaß umso mehr man sich darin bemüht, die Trennung herbei zu führen, es dies umso mehr miteinander vereint. Das die Bisexualität hingegen, wie es bereits die Botanik beschreibt, vor allem jedoch die Evolution aufweist, auf anderweitigem beruht, grundlegend auch die geschlechtliche Vereinigung (Sprache ↔ Sache), als man es über die Heterosexualität zu erzwingen ersucht, dem gegenüber weigert man sich hingegen anzuerkennen, dies überhaupt in Betracht zu ziehen. Vor allem die Bezugnahme, daß die Sexualität auf dem Geschlecht beruhe, führt dies sogar wortwörtlich vor Augen. Wesentlich ist damit verbunden aber auch, daß die theoretisierenden Anwendungen und Bezeichnungen nicht die Natürlichkeit des Seins repräsentieren, sondern eine chematische Darstellung dessen sind. Was somit überhaupt seine tatsächliche Inbetrachtziehung erfährt, ist sowohl in der Botanik, wie auch beim Menschen, das eigentlich Wesentliche, worüber sich die diversen Aufklärungen ergeben.


oder, Die Kunstausdrücke welche zum Verstehen
der phytographischen Schriften nothwendig sind

E. Schweitzerbart'sche Verlagsbuchhandlung
» «

bisexualis, zweigeschlechtlich, mit männlichen und weiblichen Befruchtungsorganen versehen.

hermaphroditus, zwittrig, wenn Staubgefäße und Pistille in der männlichen Blüthe enthalten sind; daher flos hermaphroditus, eine Zwitterblüthe.

heterogamus, verschiedenehig, wenn in dem nämlichen Blüthenstande Blüthen verschiedenen Geschlechts (weibliche und Zwitter, weibliche und männliche oder geschlechtslose) vorkommen, z.B. bei Inula, Aster, Celendula, Centauren. (Ist gleichbedeutend theils mit polygamus, theils mit androgynus.)

Quelle von Bischof's Ausführungen

Lehrbuch der Botanik - Anhang ()
, » hermaphroditus, heterogamus «
E. Schweizerbart's Verlagsbuchhandlung

Divider


Verlag: Johann Leonhard Schrag

Das Linneische System (S. 87)

Dieses ist das in Deutschland und mehreren anderen Ländern allgmeiner befolgte, und da es zugleich eines der einfachsten, und leicht zu fassenden Systeme ist, so soll dasselbe vorzugweise hier erläutert werden.

Bei diesem Systeme sind die Geschlechtstheile der Pflanzen (nach ihrer Zahl, nach ihren Verhältnissen der Länge, nach ihrer Verwachsung, nach ihrer Trennung in verschiedenen Blumen) das leitende Princip der Anordnung. Es heißt deswegen auch Sexual- oder Geschlechtssystem (Systema sexuale), und ist ein künstliches.

Was die Ergründung des geschichtlichen Verlaufes betrifft, so sind hierin unabdingbar die Originale in Betracht zu ziehen, wie an sich generell einzig darüber die wahre Gegebenheit seine Ersichtung erfährt, sich dies jedoch hierin besonders gravierend stellt, wie Schultes mit nachfolgenden Worten ausdrückt. Maßgeblich ist, und das gilt es im nachfolgenden Abschnitt darzulegen, daß hierin zunächst noch gar keine Kenntnisse, wie auch Sprachschatz für die Gegebenheiten, vorhanden waren und sich aus diesem Verhältnis heraus die Prinzipien, gemäß ihres Entwicklungsstandes entwickelten und teils bis heute Ermessungsgegenstand sind. Über die Sexualität zeigt sich jedoch auf prägnante Weise, daß man speziell in der Geschichtsschreibung nicht in Anbetracht seines Ursprungs, sondern aus der jeweiligen Gegenwartsperspektive die Gegebenheiten ersichtet und daraus die Beschreibungen aufbringt, zumal die meisten auch einzig von anderen abschreiben. Maßgeblich ist dem gegenüber, daß das Kernwesen der jeweiligen Gegebenheit aus seinen Ursprüngen heraus gebildet ist und kein davon unabhängiges Neues, da es sich nämlich über das Sprachliche als solches fixiert, dem gegenüber das Kernwesen dessen jedoch speziell daraus ersichtlich ist, insofern man dessen Ursprung und Entwicklung in Betracht zieht.

So ist auch Schultes Ermahnung nicht ganz ohne des eigenen Mißverhältnisses darin, was man jedoch regulär derart antrifft. Man hat gar nicht im Blick, daß Bücher ursprünglich gar nicht den Lehrgrund bildeten, sondern Schriften entweder die Funktion von Notizen oder Repräsentalien hatten. Aus Büchern lernen ist etwas, was überhaupt erst in Verbindung mit dem Druckerwesen seine allgemeine Umsetzung erfährt, denn das Lehren wurde über die Kundigen vermittelt, dem gegenüber es bereits zuvor als mißverhältlich stellte, wenn die Kundigkeit einzig aus Büchern stammte. Gerade hierin, in der Botanik, gleichermaßen wie auch im Verhältnis der Ärzteschaft, ging es somit auch darum, daß die Kenntnisse mit dem Wesen selbst den Grundstock bilden und vor allem einzig darüber das Kernwesen selbst darüber ersichtlich wird, dem gegenüber die Bildnisse selbst es nicht hervorbringen. Gerade dies war ja auch das Mißverhältnis, was sich bereits über die mittelalterlichen Verhältnisse verbreitete. So war es ursprünglich auch üblich, daß man die Pflanzen trocknete, um sich darüber ein direktes Abbild des Originales zu bewahren. Das gänzliche Übertragen in sprachliche und bildliche Verhältnisse, was man sich nicht nur hierin anmaßt zu bewerkstelligen, ist vor allem das Geleitwerk des daraus Erfolgenden.


» Register «
Verlag: C. Schaumburg und Compagnie
» «

Wir besitzen der Lehrbücher der Botanik so viele, und unter diesen so gute, dass es beynahe eine Vermessenheit zu seyn scheint, wenn man mit einem neuen Lehrbuche dieser Wissenschaft vor der Welt auftritt. Da indessen die meisten dieser Lehrbücher von Professoren geschrieben wurden, und da (wie man bey Vergleichung dieser Werke, insofern sie nicht blosse Compendien sind, deutlicht sieht) die meisten derselben nach mehr oder minder eigenen Ansichten von Seite des Lehrers geschrieben wurden; so ist es vielleicht auch mir, der ich nun 20 Jahre lang Botanik lehre, erlaubt, mein eigenes Lehrbuch herauszugeben.

Ich glaube nähmlich bemerkt zu haben, dass bey den meisten Lerhbüchern der Botanik die Literatur dieser Wissenschaft zu sehr vernachlässigt wurde ; und doch ist bey keiner Wissenschaft Kenntnis der Geschichte und der Literatur derselben so wichtig und wesentlich, als gerade bey der Botanik. Die Vernachlässigung dieses wichtigen Theiles in den meisten Lehrbüchern der Pflanzenkunde scheint mir sowohl in dem Umfane der Literatur derselben, als auch darin zu liegen, dass sie noch in keinem botanischen oder rein literaturhistorischen Werke vollständig und bis auf die neuesten Zeiten durchgefürht worden ist; dass es (man versuche es nur, wenn man daran zweifeln sollte) vielleicht in keiner Wissenschaft schwerer hält, Notizen über die dahin gehörigen Schriftsteller zu sammeln, als gerade in der Botanik, weil die Literatoren, wie es scheint, die Botaniker für keine Gelehrten halten und sich meistens um die genaue Angabe der Titel ihrer Werke ebeb so wenig kümmern, als um ihr Geburtsjahr, ihr Vaterland etc. Man vergleiche hierüber die vortrefflichen Werke unserer grossen Literatoren, Ersch, Meusel und Reuss, denen die Literargeschichte so unendlich viel zu danken hat, und man wird sich von der Richtigkeit meiner Bemerkung überzeugen.

Divider


Verlag: F. A. Brockhaus
» «

» () «

Pline l'Ancien
» Enzyklothek «

Plinus Naturgeschichte

» Caij Plinij Secundi von Veron (1543) «
Natürlicher History Fünff Bücher
Heinrich von Eppendorf

Plinius Naturgeschichte
Übersetzung der Historia Naturalis

» Band 2 (Rostock und Greifswald 1765) «
» Enzyklothek «
» «


» «

Plinius Secundus der Ältere: Naturkunde / Naturalis historia libri XXXVII
» Sammlung Tusculum «
37 Bücher (und Register) in 32 Bänden (lateinisch-deutsch)
Roderich König, Joachim Hopp, Gerhard Winkler, Wolfgang Glöckler


als Vorläufer einer pragmatischen Geschichte der Zootomie
Verlag: Friedrich Viehweg und Sohn

Geschichte der Botanik

» Zweiter Theil (1818) «
Verlag: F. H. Brockhaus
» «

Geschichte der Botanik

» Zweiter Band (1855) «
» Dritter Band (1856) «
» Vierter Band (1857) «
Verlag: Gebrüder Bornträger
» «


nach ihrer Entwiklungsfolge von Aristoteles bis auf die gegenwärtige Zeit
» «


bis auf Joh. Müller und Charl. Darwin
Verlag: R. Oldenburg
» «

» Bibliografie zur Philosophie und Geschichte der Biologie (2016) «
» Georg Toepfer «

Online-Archive

» Biblioteca Digital Real Jardín Botánico «
» Kurt Stüber's Online Library «
» Bibliotheca Antiqua «
2.500 books of human knowledge on the healing use of plants

Divider

Der Geschlechtsbegriff

Divider

Über Toepfer's nachfolgende Beschreibung erfährt die begriffliche Gegebenheiten ihr antreffendes Sachwesen in seinen verdrehten und widersprüchlichen Beschreibungen und veranschaulicht mustergültig, mit welchen Mißverhältnissen man hierin konfrontiert ist. Hintergrund des Ganzen ist, daß es sich um mehrere Bestandteile handelt, welche gemäß Toepfer's Ausführung, weitläufig ihre dem entsprechende Vermischungen erfuhren, aufgrund dessen es hierin unablässig ist, diese Bestandteile in ihrem jeweiligen tatsächlichen Ursprung in Betracht zu ziehen. Darüber wird dann auch erst deutlich, daß man hierin nicht die Begrifflichkeit selbst verdreht, sondern hingegen eine komplette Neuorientierung stattgefunden hat, auf der Grundlage der wissenschaftlich-biologischen Bildnisse, gemäß dem es sich darin auch als ein absonderndes biologisches Geschlecht stellt, was darin seine Inbetrachtziehung erfährt. Hierbei handelt es sich nämlich keineswegs, wie man allgemeingültig mittlerweile vermittelt bekommt, um die einzige Variante der Bedeutung von Geschlecht. Über die jeweiligen ursprünglichen Begrifflicheiten erfährt dies seine entsprechene Aufklärung und vor allem erfährt dies darüber auch seine Vervollständigung der Präsenz, welche keineswegs verschwunden ist, sondern einzig in den allgemeinen Regularien nicht ihr Erscheinungswesen erfährt. Maßgeblich ist, daß der deutsche Begriff Geschlecht aus dem Althochdeutschen stammt, aus dessen Ursprung sich, in Gegenüberstellung des Lateinischen und Griechischen, die Differenzierungen und Spezifizierungen darlegen. So ergibt sich jedoch auch für den Begriff Sexualität überhaupt erst hierüber die eigentliche Aufklärung über das Verbunds- und Differenzierungswesen, welches zwischen den beiden Sachständen, wie auch Begrifflichkeiten besteht. Elementare Bestandteile hierin sind das Was hierin jeweils der in Betracht ziehende und vereinende Ermessungsgegenstand ist und die Unterscheidung von Gemeinsamkeiten und Ergänzungen, gemäß den regulären Verhältnissen von Synonymen, worauf auch das Gesamtwesen hierin basiert.

» Bibliografie zur Philosophie und Geschichte der Biologie (2016) «
Leibniz-Zentrum für Literatur- und Kulturforschung (Berlin)
Georg Toepfer


Verlag J.B. Metzler

Geschlecht

Das deutsche Wort "Geschlecht" (ahd. "gislahti") gehört dem gleichen Stamm wie "schlagen" an und bedeutet ursprünglich »das, was in dieselbe Richtung schlägt, (übereinstimmende) Art«. Später nimmt es die Bedeutung von »Abstammung, Herkunft« und besonders »(adlige) Familie« an. Es bezeichnet seit dem Mittelalter unter dem Einfluss von lat. "genus" und als geläufige Übersetzung für "sexus" auch das natürliche und grammatische Geschlecht eines Lebewesens bzw. Wortes. Spätestens seit Ende des 15. Jahrhunderts wird das Wort in doppeltem Sinn verwendet: einerseits für eine Gruppe von Organismen eines Typs (z.B. Steinhöwel ca. 1477: »menschlichs geschlecht«; »geschlächt der tieren«), andererseits für einen der beiden Typen von Organismen bei bisexuell sich fortpflanzenden Lebewesen (Brant 1494: »vermyschung beider geschlecht«; 16. Jh.: »weibliches Geschlecht« und »männliches Geschlecht«; »Erbfolge beyderley Geschlechts«. Die zweite Bedeutung verbreitet sich in der Biologie seit Mitte des 18. Jahrhunderts - J.G. Koelreuter handelt in seinem umfangreichen Werk über »das Geschlecht der Pflanzen« (1761-66) von der sexuellen Fortpflanzung bei Pflanzen - und wird bis ins 20. Jahrhundert die dominierende.

Streit um die Geschlechtlichkeit der Pflanzen (I): Mittelalter und Frühe Neuzeit.

Die Kenntnis von der Geschlechtlichkeit der Dattelpalme ist im Mittelalter bei arabischen Gelehrten weiterhin vorhanden. In der Frühen Neuzeit wird wiederholt auf die Zweigeschlechtlichkeit vieler Kräuter hingewiesen. So bemerkt L. Lemnius 1567 (in der Übersetzung von J. Horst von 1575), »das die Kreuter zweyerley sind im geschlecht/ als nemlich menlein und weiblein« (in Original: »sexum inesse stirpibus«). 1592 unterscheidet der böhmische Botaniker A. Zaluziansky à Zaluzian klar zwischen der vegetativen Vermehrung und der sexuellen Reproduktion der Pflanzen (»De sexu plantarum«). Verdeckt wird die Geschlechtlichkeit der Pflanzen durch die weite Verbreitung des Hermaphroditismus bei Pflanzen (s.u.), also das Vorkommen von Blütenorganen mit männlichen und weiblichen Funktion an einem Organismus. In der Zeit nach Zaluziansky beschreibt T. Millington die Geschlechtlichkeit der Pflanzen und sieht die Staubblätter als das männliche Organ, das den Samen erzeugt. Millington veröffentlicht seine Anschauungen offenbar nicht selbst; sie werden erst durch den Botaniker N. Grew bekannt, der die Staubgefäße als »männliche« und den Stempel als »weibliche« Sexualorgane bezeichnet. Im Herbst 1671 liefern sowohl Grew als auch M. Malpighi anatomische Beschreibungen der Sexualorgane von Pflanzen gegenüber der "Royal Society" in London, die wenig später in Buchform veröffentlicht werden. Auf das klassische Beispiel der Dattelpalme gehen beide dabei nicht ein - vielleicht weil diese als Symbol des türkischen Kulturkreises galt und die Türken am Ende des 17. Jahrhunderts eine Bedrohung für das christliche Europa darstellten. Malpighi weist in seinen zoologischen Untersuchungen auch den Hermaphroditismus der Landschnecken nach - in seiner Pflanzenanatomie kommt er auf diese Parallele zu vielen Pflanzen allerdings nicht zu sprechen. Grew nimmt dagegen 1682 die hermaphroditische Geschlechtlichkeit der Pflanzen theoretisch an und vergleicht die Pflanzen in dieser Hinsicht (zu Recht) mit Schnecken. Wohl beeinflusst durch Grew, vergleicht J. Ray den Pollen der Pflanzen 1686 mit dem Sperma der männlichen Tiere.

Wenig später stellt der Tübinger Mediziner R.J. Camerarius (ebenso wie schon zuvor J. Bobart in Oxford) Experimente zu dieser Frage an und veröffentlicht sie 1694 in seinem »Brief über das Geschlecht der Pflanzen«. Diese Experimente bestehen in der künstlichen Isolierung der weiblichen von den männlichen Exemplaren zweihäusiger Pflanzen (z.B. des Bingelkrauts, Mercurialis), so dass jene keine reifen Samenkörner entwickeln. Zuvor hatte Camerarius auch schon bei frei in der Natur stehenden isolierten weiblichen Pflanzen (des Maulbeerbaums, Morus) das Ausbleiben der Bildung reifer Früchte beobachtet. Auch mit einhäusigen Pflanzen führt Camerarius Vesuche durch; er beschreibt den Pollen als das männliche und den Fruchtknoten als das weibliche Organ zur Fortpflanzung der Pflanzen.

Monogamie, Polygamie, Polygynie, Polyandrie

Für den Menschen besteht eine Terminologie zur Beschreibung der quantitativen Verhältnisse bei der Bindung der Partner unterschiedlichen Geschlechts bereits seit der Spätantike: Als Normalfall für den Menschen gilt meist die Monogamie (Tertullian um 200: »monogamia«; Taylor 1612: »monogamy«). Davon unterschieden wird seit dem Hochmittelalter die Polygamie (Sigebert von Gembloux 11 Jh.: »gaudens poligamia secundi tertii et etiam quarti mariti non refutat copulam ex multis maritis«; Petrus Cantor 12. Jh.: »bigamia vel poligamia«; Sarcerius 1538: »Poligamie, that is, the hauing of many wyues to gyther is forbydden«; Madan 1780: »polygamy«: »the having more wives than one«. Daneben steht die Polyandrie, die seit der Spätantike für den Menschen beschrieben wird (Arnobius 4. Jh.: »polyandria« [im Kontext von angeblicher ägyptischer Tempelprostitution]; Grotius 1680: »polyandria«; Lawrence 1680: »polyandry«; Madan 1780: »polyandry«). Von der "Polygamie", die in der legalen oder institutionalisierten Beziehung von einem Mann mit mehreren Frauen besteht, wird die bloß sexuelle Verbindung von einem Mann mit mehreren Frauen als Polygynie abgegrenzt (Madan 1780: »polygyny«: »the having more women than one, without marriage or other obligation towards them«).

Meist stehen diese Ausdrücke im Zeichen der moralischen Abwertung und des Verbots. Erst seit Mitte des 18. Jahrhunderts entwickeln sie sich zu neutralen deskriptiven Termini. C. Wolff gibt 1747 eine definitorische Übersicht über diese Konzepte: »Polygamia dicitur matrimonium personæ unius cum pluribus contractum. In specie Polygynia vocatur matrimonium unius maris cum pluribus fominis contractum; Polyandria vero matrimonium unius fominæ cum pluribus maribus initum. [.] Monogamia, quæ polygamiae opponitur, appellatur matrimonium unius maris cum una fomina contractum«.

Sexualität

Etymologisch geht 'Sexualität' auf lat. 'sexus' 'männliches oder weibliches Geschlecht' zurück, das wiederum von 'secare' ('sectum') 'schneiden' abstammt. Der Wortstamm verweist also nicht auf den Prozess der Verschmelzung, sondern auf die (morphologische) Unterscheidung von Organismen einer Art.

Die Einführung des Ausdrucks erfolgt Mitte des 18. Jahrhunderts. Der frühe Wortgebrauch steht besonders unter dem Einfluss von Linnés Beschreibungen des Phänomens der Sexualität bei Pflanzen und des darauf aufbauenden linnéschen 'Sexualsystems' zur Klassifikation der Pflanzen. Für diese Klassifikation spricht Linné bereits 1735 von einem systematisch-sexuellen Schlüssel ('Clavis Systematis Sexualis').

Das dazu gehörige Substantiv erscheint zuerst auf Latein im Titel einer Dissertation von C.C, Krøyer (1761: 'De sexualitate plantarum ante Linnaeum cognita'). Gut zehn Jahre später verwendet N.J. de Neckar den Ausdruck in einer ebenfall lateinischen Abhandlung über die Physiologie der Moose (1774: 'De sexualitate atque siminalitate muscorum'). In der Übersetzung dieser Arbeit taucht der Ausdruck ein Jahr später im Französischen auf (1775: 'la sexualité & la séminalité des mousses & des plantes pérennelles, I'existence des sexes & des oufs dans les polypes & les reptiles'; 'contre le systéme d'une sexualité universelle'). Bis zum Ende der 1780er Jahre sind es aber nur wenige Autoren, die das Wort verwenden (Lefebvre des Haies 1787: 'la sexualité [von Käferschnecken, Chitonen aus Santo Domingo]'). Auf für das Englische finden sich keine Nachweise vor dem Ende der 1780er Jahre, der erste stammt aus der Rezension eines Gedichts von E. Darwin über die 'Lieben der Pflanzen' (P.P. 1789: 'it is on their [flowers'] sexuality that he has built his poem'; vgl. auch Walker 1797: 'The Linnaean system [...] is founded on the sexuality of plants'. Seit den 1790er Jahren finden sich Nachweise aus dem Deutschen, die die umstrittene Geschlechtlichkeit der Pflanzen betreffen (Anonymus 1790: 'Zweifel [...] gegen die Sexualität der Pflanzen'; Anonymus 1792: 'die Sexualität der Moose'). In den späten 1790er Jahren wird das Thema von vielen Autoren aufgegriffen und der Ausdruck verbreitet sich allgemein (Schelling 1799: 'die allgemein Sexualität in der organischen Natur'; Anonymus 1799: Es werde von J. Gärtner 'den meisten der Gewächse, die unter Linne's Cryptogamie einregistriert sind, theils die Sexualität, theils die Bisexualität abgesprochen'; Anonymus 1799: 'Sexualismus der Pflanzen'). Die Übertragung des Ausdrucks 'Sexualität' auf den Menschen erfolgt erst im 19. Jahrhundert.

Zwitter

Der bereits im Althochdeutschen erscheinende Ausdruck "Zwitter" (ahd., mhd. "zwitarn") bezieht sich anfangs auf genealogische Verhältnisse und bezeichnet ein Wesen von gemischter Rasse, einen Abkömmling von Eltern verschiedener Sorte (»Bastard«). Vereinzelt bereits im 13., verbreitet aber erst seit dem 16. Jahrhundert tritt die genealogische Bedeutung in den Hintergrund und das Wort bezeichnet ein zweigeschlechtliches Wesen, d.h. einen Menschen, ein Tier oder eine Pflanze, die sowohl weibliche als auch männliche Geschlechtsmerkmale aufweist. Als biologischer Terminus, der auch auf Pflanzen und Tiere bezogen wird, erscheint der Ausdruck in der zweiten Hälfte des 18. Jahrhunderts. Bei B. Erhart heißt es 1759: »Diejenigen Pflanzen also, deren Blumen diese beyderley Geburts-Glieder haben, nennet man Hermaphroditen oder Zwitter. Sie machen den größten Theil aus«.

Der ältere Ausdruck zur Bezeichnung zwittriger Wesen lautet Hermaphrodit. In Bezug auf Abnormitäten beim Menschen findet er sich bereits bei Plinius im ersten nachchristlichen Jahrhundert (»Gignuntur et utriusque sexus quos Hermaphroditos vocamus, olim androgynos vocatos et in prodigiis habitos«). Der Ausdruck geht auf die griechische Sagengestalt Hermaphroditos zurück, einen Sohn des Hermes und der Aphrodite, der mit der Quellnymphe Salmakis verschmolz und ein androgynes Wesen bildete. Die Verwendung im biologischen Zusammenhang etabliert sich seit dem Hochmittelalter. Bis zur Neuzeit bildet "Hermaphrodit" aber eine Kategorie zur Bezeichnung von Abnormitäten und Monstrositäten. Als neutraler biologischer Terminus verbreitet sich der Ausdruck erst seit Beginn des 18. Jahrhunderts. S. Vaillant spricht 1718 von hermaphroditischen Blüten (»Flores hermaphroditi«); 1745 bezeichnet dann Bonnet die Blattläuse, bei denen er ihre parthenogenetische Fortpflanzung nachweist, als "Herma phroditen". Im Deutschen erscheint der Ausdruck "Hermaphrodit" in einem neutralen biologischen Sinn Mitte des 18. Jahrhunderts (vgl. das Zitat von Erhart oben).

Linné bezeichnet eine Pflanze, die über männliche und weibliche Blüten verfügt, als androgyne Pflanze (»planta androgyna«) - er nimmt dabei ebenfalls eine Bezeichnung auf, die sich schon bei Plinius fin det (s.o.). Daneben ist außerdem der Terminus Gynandromorphismus verbreitet, um das Phänomen des Vorhandenseins von sowohl männlichen als auch weiblichen Geschlechtsorganen an einem Organismus zu bezeichnen (Wesmael 1836: »gynandromorphisme«; dt. Übers. 1837: »Gynandromorphismus«; engl. 1840: »gynandromorphism«).

Den Hermaphroditismus der Weinbergschnecke beschreibt 1694 der englische Arzt M. Lister. Seit Beginn des 18. Jahrhunderts werden Organismen der verschiedensten Arten als Hermaphroditen erkannt. E. Chalmers führt in seiner Enzyklopädie Insekten, Reptilien, Würmer, Schnecken und auch Pflanzen an. Bei den Pflanzen werden allgemein diejenigen als "Hermaphroditen" bezeichnet, in deren Blüten sowohl Staubblätter (Stamina) als auch Stempel (Pistill) vorhanden sind.

Das Phänomen des Hermaphroditismus zeigt, dass die Trennung der Geschlechter nicht immer mit der Trennung von Individuen zusammenfällt. J. Müller formuliert 1840: »Der Dualismus der Geschlechter ist also nicht nothwendig Dualismus der Individuen. Vielmehr kann die geschlechtliche Zeugung so gut, wie die Knospenbildung und Theilung, von einem einzigen Individuum geschehen«.

  • Hermaphrodit (Plinius um 79) S. 83
  • Monogamie (Tertullian um 200) S. 75
  • Polyandrie (Arnobius 4. Jh.) S. 75
  • Kopulation (Augustinus 418) S. 73
  • Polygamie (Sigebert von Gembloux 11. Jh.) S. 75
  • Zwitter (Anonymus 13. Jh.) S. 83
  • Geschlecht (15. Jh.) S. 72
  • Begattung (Horst 1592) S. 73
  • Polygynie (LaMettrie 1748) S. 75
  • Sexualität (Krøyer (1761) S. 80
  • Konjugation (Treviranus 1804) S. 82
  • Geschlechtsbestimmung (Reil & Autenrieth 1815) S. 84
  • Geschlechtsverhältnis (Memminger 1824) S. 84
  • Gynandromorphismus (Wesmael 1836) S. 84
  • sekundäre Geschlechtsmerkmale (Bennett 1836; Yarrell 1836) S. 75
  • Parasexualität (Pontecorvo 1954) S. 82

Im Nebeneinander der beiden nachfolgenden Inhalte verdeutlicht sich, daß gerade Linnè einst genau auf diese Gegebenheit eingegangen ist, indem dieser eben nicht die aufbringende Anwendung des Geschlechts des Kölreuter übernimmt und somit sich auch nicht auf sexus bezieht, sondern gar demonstrativ das Ermessungswesen des Ganzheitlichen hervorhebt und darüber vermittelt, wie sich diese Andersartigkeit dem gegenüber stellt. So verdeutlicht sich vor allem hierüber auch, daß dieser gar hervorhob, daß sexus sich nicht auf die Geschlechtsorgane bezog, gemäß dem seine Anwendung von sexualis, ohne Bezugnahme zu sexus dies spezifisch ausdrückt. Wie man diversen Schriften entnehmen kann, so ersieht und händelt man seine Ausführung als metaphorisch, ist es jedoch in keiner Weise, sondern im Gegenteil dessen, repräsentiert es das damalige sarkastische Verhältniswesen dieser Gegenüberstellung, das sich als unvereinbar miteinander stellt. Gemäß dem repräsentiert auch Jode über die inhaltliche Darstellung seines Kurpferstichs den vorherrschen makabren Sarkasmus bezüglich der sich überschneidenden Gegebenheiten. Dieses neue Geschlecht basiert nämlich auf der völligen Umkehr der Ermessung, dem gegenüber die Ursprungsbedeutung aus dem Ganzen sich auf das Gemeinsame des Jeweiligen bezieht, hingegen im Neuen aus dem Einzelnen das Gesamte seine Beschreibung erfährt. Das in weder noch die Sinnlichkeit überhaupt Inbetrachtziehungsgegenstand sind, zeigt sich hingegen nicht nur darüber, daß das Wort Liebe nirgends seine Erwähnung findet, sondern vielmehr erweist sich gerade darüber die Beschränkung auf reine Sachlichkeiten. So zeigt sich jedoch hierüber, worauf der weitere Wandel beruhte, daß nämlich beides weder im Nebeneinander, noch Miteinander, seinen Bestand bewahren konnte, da es die darüber auftretenden Widersprüchlichkeiten unübersehbar verdeutlichte, sodaß sich mit den Neuerungen zwangsläufig das Neue als solches bedingendes Einziges umsetzte und das Alte verdrängte, um dies überhaupt etablieren zu können. Gerade hierüber zeigt sich wiederum die klare Ausdifferenzierung von Geschlecht und Sexualität, gemäß dem es bei Linné seine demonstrative Darlegung erfährt und das Geschlechtsorgan als ein Anteiliges, jedoch nicht als Fundierendes darlegt. Man bedenke hierzu die Bemühungen der Gegenwart, das englische Gender in den deutschen Sprachgebrauch zu etablieren, worüber genau dies auch zum Ausdruck gebracht wird, was dem Deutschen heute in der reinen Bezugnahme des biologischen Geschlechts substanziell fehlt. Im Verhältnis der althergebrachten Anwendung ergibt sich hingegen genau das, was man darüber zu integrieren sucht. Über den Geschlechtsbegriff ist dies nach wie vor präsent. Diese ergibt sich jedoch nicht über den Geschlechtsbegriff, sondern über dessen abgrenzende Differenzierung gegenüber dem Sexualbegriff. Darin besteht die eigentliche Veränderung, welche sich unmerklich in dem Wandel vollzieht, indem nämlich im Verlaufe die Vermischungsverhältnisse darin klärten, jedoch sich dies einzig sachlich über das Wirken der Gegebenheiten als solches zeigt, jedoch die Sprache noch im Werden ist, gemäß dem seine anpassende deregulierende Ausbildung zu erfahren.

Linnae Clavis Systematis Sexualis 1735
» Clavis Systematis Sexualis (1758) «
» Carl von Linné «
Nobilium in Belgio Utriusque Sexus Ornatus
» Nobilium in Belgio Utriusque Sexus Ornatus«
» Variarum Gentium Ornatus (1605 - 1610) «
(Costumes of Different Nations)

» Pieter de Jode (der Ältere) «

So ergibt sich primär auch eine spezifische Klärung über den Begriff Sex, welcher ursprünglich in keiner Weise Bestandteil der bezugnehmenden Anwendung war und das Geschlecht sich auch nicht auf die Geschlechtsorgane bezog. Auch dies wiederum verdeutlicht sich über Linnè's Darbietung, wie überhaupt über die Darlegung aus dem Botanischen, worin dies gar nicht Bestandteil des Daseins ist. Betrachtet man sich dem gegenüber die heutige Anwendung, so bildet sich der anwendende Geschlechtsbegriff aus dem des Geschlechtsorgans heraus und wird weitläufig dem gar gleich gesetzt. Maßgeblich ist, daß sich der Sexualitätsbegriff aus dem von Linné aufgebrachten lateinischen sexualis heraus bildete und auf dem sexus beruht, dem gegenüber dieser sich jedoch nicht auf den Sex(ualakt) bezieht, sondern beim sexus gar das Gegenteilige dessen die Grundlage bildet. Tatsächlich handelt es sich beim Sex um einen Slang, welcher sich gegenüber dem Ursprung des Dialekts aus der Hochsprache heraus bildet und somit Sex(ualität) terminologisch gar nicht existiert, sodaß spezifisch hierüber alles durcheinander gerät, gleichzeitig sich darüber aber auch die Aufklärung ergibt. Sprachtechnisch bezeichnet sich dies nämlich, angemessen auch der sachlichen Regularien, terminologisch als Geschlechtsverkehr. So erweist sich jedoch spezifisch die Vermischung des Lateinischen mit dem Deutschen als wesentliches Übel, indem es darin des Trennungswesens entbehrt. So ist 'sexualis' ein neu entstandener Begriff des Lateinischen, welches jedoch das lateinische 'sexus' gar nicht beinhaltet, sowie auch die Sexualität nicht den Sex beinhaltet. Maßgeblich ist dem gegenüber, daß die Darstellungswesen, wie nachfolgend aufweisend, nicht nur nicht auf die Sache, sondern auch gar nicht auf die sprachlichen Regulatoren achten, sodaß sich darüber auch diese Willkürlichkeiten darbieten, wie man sie nachfolgend mustergültig antrifft und darüber ein völliges Unverständnis fördern. Man erklärt ein Wort durch ein anderes und verweist einzig auf 'linguistische' Wortbezüge, sodaß man sich darin einzig im Kreise bewegt und dabei auflöst, was zu trennen ist, sodaß es keine eigentliche Erklärung liefert, sondern einzig verklärt. Dies wird vor allem jedoch potenziert über die Inbtrachtziehung der Vergangenheit aus der Gegenwartsperspektive heraus und der Undifferenziertheit gegenüber der Kulturbezüge, sodaß gerade hierüber die ursprüngliche Bedeutung gar seine gänzliche Umdeutung erfährt.


Band 2 (S. 1328)
» «

sexus_klotz.jpg


Verlag: B.G. Teubner (S. 169)
» «

sexus_vanicek.jpg


Carl Winter's Universitätsbuchhandlung (S. 707)
» «

sexus_walde.jpg

Hierzu einmal die Gegewärtigkeit, wie man sie lexikalisch antrifft:

» Sexualität « (sinngemäß "Geschlechtlichkeit", von spätlat. sexualis; aus lateinisch sexus "Geschlecht"; vgl. Sex) bezeichnet im engeren biologischen Sinne die Gegebenheit von (mindestens) zwei verschiedenen Fortpflanzungstypen (Geschlechtern) von Lebewesen derselben Art, die nur jeweils zusammen mit einem Angehörigen des (bzw. eines) anderen Typus (Geschlechts) zu einer zygotischen Fortpflanzung fähig sind.

Unter » Sex « (englisch für den lateinischen Begriff sexus, deutsch: "Geschlecht") versteht man die praktische Ausübung von Sexualität (Kurzform: Sex) als Gesamtheit der Lebensäußerungen, Verhaltensweisen, Empfindungen und Interaktionen von Lebewesen in Bezug auf ihr Geschlecht.

Im Bezug auf » Geschlecht « trifft man hingegen einzig eine Bezugnahme zu dem grammatikalischen Genus an. Nachfolgend hierzu eine Ausführung bezüglich des lateinischen Genus von Vaniček. Dieser Begriff basiert auf dem Grundstock des altlateinischen gen und in dessen Bezugsverhältnis zeigt sich auch das Gesamtspektrum dessen überhaupt erst auf. Hierzu gilt zu bedenken, daß die lateinische Sprache eine künstliche Sprache ist, worin gerade das grammatikalische Konstrukt die Grundlage der Sprachbildung begründet, wohingegen in den regulären Dialekten die Laute das sind, worüber sich Verbundspräsenzen bilden. Über das Latein und damit verbunden auch dessen wesentlicher Ursprung, dem Griechischen, woraus der weiträumig Grundstock des Lateinischen stammt, zeigt sich somit aber auch unser damit verbundenes Anwendungswesen, welches heute nicht mehr nach den Lauten, sondern nach diesen grammatikalischen Regeln das Maß des Händlings wäre. Das es dem gemäß jedoch nicht gehandhabt wird, zeigt nicht nur die Anwendung von Sex, sondern generell in der grammatikalischen Gegenüberstellung, welche eine ganz andere Norm aufweist, worin vor allem jedoch die neu entstandene biologische Ideologie zur Grundlage der Anwendung des Wortschatzes geworden ist und darüber sämtliche anderen Regularien außen vor stellt, gar die der Grammatik. Hierin hat man neben den neuen Bezeichnungen, die Übernommenen dessen Bedeutungsgehalt angepaßt. Das sich hierin diese gegenüber dem Ursprünglichen gänzlich umkehren, ist das eigentlich Markante darin. Gerade aufgrund dieser Unangemessenheit ist es hierin auch unumgänglich, Sprache und Sache gänzlich voneinander getrennt in Betracht zu ziehen und daraufhin erst beides im Gegeneinander, worüber sich die Gegebenheiten klären, ansonsten hingegen unerklärlich bleiben.


Verlag: B.G. Teubner (S. 48)
» «

genus_vanicek.jpg

ambi 10, uterus 24, gen 48, homo 56, penis 96, vulva 155, sec/sac/sexus 168, sex 206, vagina 149/212, Register 223

Zu beachten ist, was Vaniček's Aufbringen darbietet, nämlich die etymologische Erfassung der Kernstämme der Begriffe und dessen Verbundenheit der darauf aufbauenden Anwendungen. Regulär trifft man hierin, gar im Etymologischen, einzig auf ein rein lexikalisch, nach Buchstaben Orienteres, sodaß darüber auch die Zusammenhänge nicht ersichtlich sind, da der Stamm nicht grundsätzlich die Anfangsbuchstaben begründet, sodaß gerade darüber auch die weiträumig Verlustigung der Worte und deren Verständnis einher geht. Maßgeblich setzte sich jedoch hierüber überhaupt die stattgefundene Veränderung der Umkehr der Bedeutungen um, da es der Bezüge entbehrt, worüber ein solches dies regulär auch verhindert. Auch hierin ist es jedoch wiederum beschränkt, sodaß über den gen-o-Typus nicht das Verbundswesen zum sexus in Erscheinung tritt. Wesentlich ist dem gegenüber jedoch, daß Genus und Sexus sich dem entsprechend grundlegend voneinander unterscheiden. Sie sind keine Einheit. Und so erwirkte sich gerade in dem Bezug auf doppelte Weise die Isolierung des sexus aus, den man zwar noch zum genus die Verbindung aufzeigt, jedoch nicht das dahinterstehende Kompendium zur Inbetrachtziehung gelangt. Wie man daraus ersehen kann, greift hier eines ins andere, dem gegenüber es jedoch dem gegenüber der lateinischen Sprache Ungebildeten jeglichen Nachvollzug überhaupt verhindert, sodaß gerade diesem gegenüber Jegliches in die Begriffe hinein interpretiert werden kann, ohne das diesem auch nur im Ansatz darüber etwas über das Mißverhältnis in Erscheinung treten könnte. Und wenn diese Begriffe dann auch noch von denen ausgebildet werden, welche dafür präsent sind, um die Korrektnes zu gewährleisten, dann wird dies auch regulär gar nicht in Frage gestellt, da man davon ausgeht, daß die Voraussetzungen zur Richtigkeit über das Reglement begründet sind. So haben sich gerade im Bezug auf das Sexualwesen zwar fortwährend die Auseinandersetzungen darauf begründet, zu klären, wie es sich darin verhält, jedoch ist darin einzig die Inbetrachtziehung, daß die Sprache nicht zum Ausdruck bringt, was das Wirk- und Handlungswesen vermittelt. Das man jedoch von Grund auf mit Verfälschungen hantiert, tritt dabei jedoch nicht in Erscheinung. Und somit auch nicht, daß es an des jeweiligen Sprachverständnis hapert - das ersieht man nicht. Vielmehr ist man dabei, noch weitere Worte zu begründen, zur Klärung der Verklärtheit, sodaß sich das Ganze einzig weiter potenziert.

Begibt man sich in den Bezug unserer ursprünglichen Sprache, so erfährt man darüber die Abstammung des Geschlechtsbegriffs, dem gegenüber die Bezeichnung für die Genitalien, das » Gemäscht « nicht übernommen wurde in die hochdeutsche Sprache, hingegen jedoch das damit verbundene » Vermächtnis «. Markanterweise ist jedoch das Gemäscht ebenfalls nach wie vor noch in seiner Anwendung präsent, wie das » Wortschatz-Portal « der Uni Leipzig aufweist. Maßgeblich ist hierin der Fortbestand der Dialekte, worüber auch unsere Ursprachen in ihrem Bestand weitläufig über die verbale Anwendung erhalten blieben. Den Verlauf des allgemeinen Verlustes dessen in der hochdeutschen Sprache, erfährt man hingegen mustergültig über die » Heraldik «. In diesen Verhältnissen verdeutlicht sich dann auch das stattgefundene Ineinanderwirken der Sprachen, wie auch der Bedeutungen. In den Entwicklungen gab es diverse Veränderungen, dem gegenüber man jedoch in der Medizin, gleichermaßen des Rechtswesens, welche maßgeblich unser Wortschatz des Geschlechts- und Sexualwesen prägt, im Verlaufe sich gänzlich im Deklarationswesen lateinisierte, gemäß dem man darin auch eine ganz eigene Sprache anwendet, worin von Grund auf auch die deutsche Sprache nicht beinhaltet ist, sodaß gerade aufgrund dessen es der zweifachen Inbetrachtziehung bedingt, nämlich welcher Sprachgebrauch darin das Jeweilige abbildet und aussagt, was es besagt, wie auch dem des Sprachunkundigen darin, dessen Sprachgebrauch sich aus der Umgangsprache ergibt. Auch dies wiederum führt zu einer weiteren Vermischung, worüber sich jedoch ein ganz Spezielles darüber darlegt, daß man nämlich bewußt das sprachtechnische Einheitswesen darin von Grund auf übergeht. Maßgeblich hierin ist darüber hinaus, daß innerhalb der Wissenschaften noch nicht einmal eine Interdisziplinarität gegeben ist und zwar nicht nur sprachtechnisch, sondern vor allem auch sachtechnisch. So trifft man gar im Sexualbezug auf eine Sexualwissenschaft, welche instituionell gar nicht existiert. So findet jedoch gerade darüber eine Sprachanwendung statt, welche noch einmal dem biologischen Sprachegebrauch entspricht, wie im Einstieg dieser Ausführung dargelegt.

» Mittelhochdeutsche Sprache «

Als mittelhochdeutsche Sprache (Abk. Mhd.) bezeichnet man sprachhistorisch jene Sprachstufe des Deutschen, die in verschiedenen Varietäten zwischen 1050 und 1350 im ober- und mitteldeutschen Raum gesprochen wurde. Damit entspricht diese Zeitspanne in etwa dem Hochmittelalter.

» Mittelhochdeutsches Wörterbuch «
Mainzer Akademie der Wissenschaften und der Literatur
Akademie der Wissenschaften zu Göttingen

» 1gemächt « das; -s/-e auch -Ø, auch die; -(e)s/-e, auch -Ø; zu mhd. gemaht 'testiculi, genitalia'. 'Zeugungskraft; (männliches) Zeugungsglied, Geschlechtsteil, Penis; Unterleib'. do quam ein ander ind stach in in sin gemecht bis hei doit was; geleyt vff den buch zwischen den nabel vnd dem gemechte benympt groß lenden wee; wer geletzt were an dem gemecht / der neme diß puluers; das achte die scorpio, kalt unde nass, wirket an das gemechte; die [mvniche] volgeten des heiligen ewangelien lere mit vnbescheidenlicher vernunft vnd sniten in selben ir gemecht uz vmbe das himelriche; daz pflaster ist gut, wolcher zuprochen ist zu dem gemecht; der Smalnstain stach den Sekendorfer unter dem gemecht ein, das er herab viel und starb; welicher der jüngst unter seinen brüdern seinem vatter das gemächt mit einer sichel außschnitt.; den stach er peim hals in die pruest, darnach ins gmecht und in die stirn;ie adern seiner gemechte die seint verworren; der ließ im ain keil in gemächt schlachen; so war doch die sichtbarlich straff Gottes da, das er ain giftigs geschwer an gemechten bekam; dasselbig [kneblein] auch bey seiner gemecht gestochen, das ime die derm sind drungen; von wunden, von gleichwunden, von geederwunden, von hauptwunden, von gemechtwunden; Halsstich, gemechtstich, zerstich est una cura und habet aliam curam ab aliis; legg das krut denne v́ber die gemaͤht; wjlt du das das har an den gemaͤchten [...] abgange [...] so nim kalch; der meister synne ouch wol geualt das man yme truke gar senfteclich Sin gemächte das es sich Beharnen möge; die Gemaͤcht an einem menschen / die scham; der alt Moyses nam ein messer [...] und offnet da zum ersten dem chindt sein gemacht; also gesoten vnd zerbrochen mit weyn vnd gerüret, würt eyn gut pflaster für die apostem vnd geswulst des gemächts; der priester lag tod, dem warn sein gemácht hoden gar verprant; da geschach an sein gemáchten ain solich zaichen, das ich vor scham nit nennen wil.

» geslaht Adj. « 1 'geartet, geformt, beschaffen', oft in Verbindung mit wol: dâ mite der satel was bedaht, / daz was ein phelle wol geslaht; noch wîzer danne ein snê / ir lîp vil wol geslaht; umb dînen dienest wol geslaht. – vil ~ (häufig bei Konrad von Würzburg): ein spîse cleine [...] nam diu frouwe vil geslaht / und az ir friundes herze gar; diu selbe decke vil geslaht / was über sînen schilt gezogen; ouch hete er [ der künic ] einen turn gemaht / ûz marmelsteine vil geslaht. – subst.: man sach den vil geslahten / ûzerweltiu cleider tragen 2 'jmdm. eigen, gemäß' (mit Dat.): er sprah ze den obezpovmen / selbe habet samen / daz si obez pâren / also in geslaht ware; nû ist mir der touf niht geslaht; diz cleit enwær im [dem Hirten] niht geslaht; mit iuwerm urloub spriche ich daz: / ir tuot als iu wol ist geslaht! – mit Präp. von ‘von jmdm./ etw. angestammt, angeboren' wan daz was im niht geslaht / von vater noch von muoter; im wære ez von dem vater geslaht, / daz er mich solte minnen; sitz ebene und swende sô den walt, / als dir von arte sî geslaht 3 'edel, fein' der getriuwe Tinas, / von arte edel und geslacht. – subst.: ich weiz ir zucht so vil, / der geslachten, wandelvrîen

geslahte stN.geslehte

» 1geslehte « stN. auch geslahte 1 'Abstammung, Herkunft, Art' 1.1 speziell auf den Menschen bezogen 1.1.1 'Familie, Geschlecht' si was von Aarones geslahte; nâch dem geslähte der muoter sîn; wand ime ist von geslehte / nieman sô nâhe sippe als ich; daz er noch enhein daz mensche, daz von sime gislehte iemer giborn wirt, niemer enhêin ansprach sol giwinnen wider daz closter ze Gv́nterstal; ich und du [Symeu und Lancelot], wir sint beide eins geslechtes, ich bekenne dich baß und din macht dann du selber tuͦst; von fast hohem geschlecht; van gueder art gesleichte; von kunichlichem geslâht. – Verwandte einer des byschofis knehte, / der ym an horte von geslete, / an dem doch Petrum vngefug / det vnd daz ore ym abe geslug; miner muoter, / minen swestren, minen bruoderen / unde anderme mime geslehthe; Conrat vnd Matze Eppelins kint vnd alle die geslechte, die dar nach ze rechte gehorent. - 'Volk, Stamm' da waren diu edeln geslæcht [Stämme] diu von Juda geborn waren; diͤ in al den jüdschen geslechten / engein kint zuͦr werld enbrechten; die / geslecht der Israhelen– in dimme [Abrahams] geslæhte wirt gesegenot allez irdiscez geslahte; mænnschleich gesleht [Menschheit] zergænchleich ist 1.1.2 'Generation' von erbe und von aigen, wi iz erbe von vater und von mueter auf daz ander geslecht 1.1.3 Gesamtheit von Personen mit einer bestimmten Eigenschaft, 'Typ, Menschenschlag' ûz der tjoste geslehte / wârn si bêde samt erborn; es ist ainerlai pillde der pösen und von dem geschlächt der übeln [de genere malorum]; vir geslechte [genera] sint der muneche; wer in dem schütz sich birt, [...] hat zu jegerie phlicht, / von sim geslecht er sere ficht 1.2 allg. auf Tiere, Pflanzen u.a. bezogen 1.2.1 'Sorte, Typ' schaw, wie iesleich gesläht der visch sein besunder lant hât; daz ist ain mervisch und ist der sneken geslähtes; der wurm ist âmaizen geslähtes, er ist aber vil grœzer denn ain âmaiz; wurze unde sâmen nâch iegelicheme geslahte; in dem [Garten] sind mißlich geschlächtt fruchpär paum. – 'Beschaffenheit' von Steinen: des steines geslehte, / sîne lîhte und sîne swâre; ez [das Bett von Anfortas] was tiwer unde wæhe / von der edeln steine geslehte; granât ist von des jâchants art und ist seines geslähts 1.2.2 lexikogr. Sachverhalt: auf die Herkunft eines Wortes bzw. auf dessen Wortfamilie bezogen: scandalum ist ein fromedez wort. nehat eigines gediutes niht. also gniugiu wort endriu dei anegenges unde geslahtes nihne habent 2 'Sexus, Geschlecht' uon wiplicheme geslahte / so geshiht dir uil rehte; der part an dem menschen bedäut mannes gesläht

» 2geslehte « stN. zu slahte 'das Geschlachtete' dem probst von Gysenvelt git man [...] zwo schultrig vnd zwo hammen von dem geslaehte [de duplici mactatura] (13. Jh.); daz hovpt vnd daz inner gslæhte (13. Jh.); würste und hammen, guot geslechte / ouch in rechte herbest birt

» geslehtebuoch « stN. 'Ahnentafel, Stammtafel' von der maget Marîen swestern und von ir sünen. / von dien zwelven, sô ich nû / genant hân, der wârn Jêsû / fünve sippe, als üns saget / daz geslähtebuoch der maget

» geslehtede « Subst. 'Verband, Geschlecht, Stamm' tribus: geslehtede

» sleht « (Belegarchiv - Liste textualer Vorkommnisse)

Wie man dem Mittelhochdeutschen entnehmen kann, so besteht bezüglich des Geschlechtsbegriffs eine nahe Verwandschaft zum Anwendungswesen des lateinische Genus. Und über die nachfolgende Frühneuhochdeutsche Ausführung erfährt man auch das spezifizierende jeweilige Bezugswesen. Wie stellt sich dies jedoch gegenüber der heutigen Anwendungspräsenz? Hierüber verdeutlich sich nämlich, daß es bei dieser Anwendung gar nicht um eine fixierende substanzbezogene Bedeutung handelt, sondern um ein Prinzip. Die Substanz selbst erfährt darüber gar nicht sein Abbild, was sich über die Vielfalt der diversen Anwendungen verdeutlicht, worin die Bezugnahme jeweils gar nichts mit dem eines anderen überhaupt etwas gemein hat. Was sich hierüber aufzeigt ist, daß es sich bei der ursprünglichen Anwendung um ein Adjektiv handelt, dem gegenüber es sich jedoch bei der neuerlichen Anwendung des biologischen Geschlechts um ein fixierte Substanbezogenheit und somit um ein Substantiv handelt. So wird darüber dann auch ersichtlich, worin die sprachtechnische substanzielle Veränderung beruht und man in dem Neuerlichen den bedingenden Bezug zu den Geschlechtsorganen pflegt, was die Substantivierung nämlich bewirkt. Gleichzeitig verdeutlicht sich aber auch hier wiederum, warum das Alte mit dem Neuen im Nebeneinander gar nicht funktionieren konnte, denn hierbei handelt es sich nicht um eine reguläre Synonymität eines Gleichen oder Ähnlichen, sondern um ein gänzlich anders, einander widersprechendes, welches jedoch in der rein sprachtechnischen Unterscheidung als solches gar nicht ersichtlich ist und sich einzig in und über die Anwendungsform unterscheidet. Vielmehr führt dies jedoch im Nebeneinander dazu, daß in der Inbetrachtziehung des Einen zwangsläufig auch das Andere darüber in Erscheinung tritt, dessen bedingende Trennung jedoch sich als voraussetzende Grundlage der Anwendung erweist.

» Frühneuhochdeutsche Sprache «

Als frühneuhochdeutsche Sprache, kurz Frühneuhochdeutsch (Abk. Fnhd. oder auch Frnhd.), bezeichnet man die älteste Stufe des Neuhochdeutschen, die zwischen dem mittelalterlichen und neuzeitlichen Deutsch angesiedelt ist. Die Periode der frühneuhochdeutschen Sprache wird ungefähr von 1350 bis 1650 angesetzt. Beispiele für Textzeugnisse dieser Sprachstufe sind die Schriften von Paracelsus ab 1529 und Luthers Bibelübersetzung von 1545.

» Frühneuhochdeutsches Wörterbuch «
» Mitte des 14. Jahrhunderts bis zum beginnenden 17. Jahrhundert «
» Akademie der Wissenschaften zu Göttingen «
» Alphabetischer Einstieg «

» geschlecht «

das;-(e)s/-e, -er, auch -Ø. - 1 generisch auf Untergliederungsverhältnisse bezogen, 3-9 auf Gruppen von Menschen, davon 7-9 auf Abstammungs-, Verwandtschaftsverhältnisse, 10 daran metonymisch anschließbar, 11 und 12 für Pflanzen- bzw. Tiergruppen.

1. >diejenige Gruppe, Art, Spielart, Untereinheit von Gegenstandsklassen (Konkreta, Menschen, Handlungen u.ä.), die durch Gliederung, Einteilung gewonnen wurden und dementsprechend durch ein Differenzkriterium von einer anderen Untereinheit derselben Gegenstandsklassen unterscheidbar sind<.

2. >Art, Wesen, Substanz<; in beiden Belegen auf Gott bezogen.

3. >menschliches Geschlecht, Gesamtheit aller Menschen, wie sie von Gott geschaffen, durch Eva in Sünde gefallen und von Christus erlöst worden sind<, überwiegend negative Sicht.

4. steht mit vorangehendem Adjektivattribut oder einer funktional ähnlichen, oft quantifizierenden Bestimmung für den Inhalt des Attributes oder der attributähnlichen Bestimmung, z.B. das auserwälte geschlecht >die Auserwählten<, alle geschlechte >alle Menschen, alle Völker<; in Beispielen dieser letztgenannten Art auch an 7 anschließbar.

5. >Geschlecht, Sexus des Menschen<.

6. >Großgruppe von Menschen, die geschichtlich, kulturell, religiös, sprachlich wie in ihrem jeweiligen zeitgenössischen Handeln als relative Einheit auftreten oder wahrgenommen werden, die man wohl auch an bestimmte geographische Räume bindet, insofern Nähe zu heutigem Volk im nicht terminologischen Sinne<; offen zu 7.

7. >Geschlecht, Familie in der Regel adligen, vereinzelt bürgerlichen Standes mit hoher administrativer / politischer Funktion in einem Gemeinwesen oder Herrschaftsgebilde; zum Patriziat einer Stadt gehörende Adelsfamilie<; offen zu 8; 9; 10.

8. >Geschlecht, Familie, Sippe, Stamm als Gesamtheit aller von einem Stammvater hergeleiteten Angehörigen / Blutsverwandten<; vielfach auf die 12 Stämme des alten Israel bezogen; im Unterschied zu 7 eher die Familienzugehörigkeit als die administrative / politische Funktion meinend.

9. >(meist) hohe Abstammung, Herkunft, Geburt e.P. oder seiner Familie<; eng an 7 und 8 anschließbar, im Unterschied zu diesen mit Betonung des Herkunftsgedankens; zu dessen Rolle im Prozeß der Bildung und Sicherung von Erinnerung s. Müller, Gedechtnus.

10. >Generationenfolge eines Geschlechtes; Generation; Nachkommenschaft<; ütr. bzw. generalisiert: >Trieb (eines Gewächses)<.

11. >Gruppe, Familie einer übergeordneten Klasse von Pflanzen<.

12. >Gruppe, Untereinheit, Familie einer übergeordneten Klasse von Tieren<.

Was weitläufig in etymologischen Ausführungen keinerlei Beachtung findet ist, daß es sich bei den aufzeigenden Anwendungen, so auch bei 'geslehte', um diverse Flexionen/Deklinationen/Schreibweisen handelt. Maßgeblich hierin ist, daß es zuvor gar keine Einheit gab, es sich um unterschiedliche Kulturkreise, wie auch diverse Lebenskreise handelte und auch die Schreibweisen, wie eben auch im Lateinischen anzutreffen ist, nicht einheitlich ist, da der Grundstock die Verbalsprache ist und nicht die Schrift, sodaß beim Herauslesen von Bedeutung und Schreibweise die zu differenzierenden Verhältnisse und Vermischungen zu berücksichtigen sind. Umso weiter zurückliegend, umso vielfältiger ist auch das Antreffen. Über das » Bayerische Wörterbuch « von Schmeller erhält man einen spezifischeren Ausblick darauf, worüber die unterschiedlichen kulturellen Herkünfte auch deutlicher hervortreten. Des weiteren zeigt sich gerade hierin, daß man sich einzig auf Rückläufiges bezieht, ohne die Entstehung des Geschlechtsbegriffs als solchen spezifisch in Betracht zu ziehen. Jeder einzelne Begriff hat eine eigene Geschichte und gerade dies wird in den Etymologien rein maschinell übergangen. Wie die Ausführungen darbieten, so betrachtet man die Gegebenheiten aus dem Verhältnis neuerlicher Händlings, vor allem weitläufig auch im Prinzip reiner Grammatik, wobei gerade diese doch erst über das entstandene Hochdeutsch seine regulierende Präsenz erfuhr.

In Anbetracht der Gegenüberstellung des lateinischen Wortstammverhältnisses von genus zeigt sich indess, daß sich für geslehte eine Besonderheit ergibt, welche sowohl bei diesem, wie auch beim Geschlecht, die Grundlage bildet und sich darin verbindet, nämlich der gebildete Wortstamm auf dem Gegensatz von sleht/schlecht. Die Etymologien besagen, daß der Ursprung 'slahte' sei, was sich jedoch als eine Vermischung aufweist, vor allem jedoch als eine vergleichende Bezugnahme zum lateinischen 'genus'. Gravierend hierin ist, daß 'sleht' und 'geslehte' sich in ihrem Bedeutungsgehalt substanziell derart gravierend unterscheiden, gegenüber dem Verbund von 'slaht' und 'geslaht', sodaß es sich in seiner Bedeutung gar nicht in Verbindung bringen läßt (sleht ↔ slaht). Vielmehr legt sich darüber dar, daß sowohl 'geslehte', wie auch 'Geschlecht' selbst ein Wortstamm sind und 'geslehte' sich als Vorstufe des Geschlechts erweist. Im Gegensatz dazu sind es nämlich anderweitig im alt(hoch)deutschen Wortstämme, worauf dies jeweils aufbaut, gemäß 'slaht(e/a)' präsent (slahte, slahta, gislaht/ungislaht, gaslati, geslaht, ...).

Als leittragendes Kriterium erweist sich darüber hinaus indess das untrennbare Verbundswesen mit Gesinde, gemäß dem es das Eine nicht ohne das Andere gibt. Dies geht im Alt(hoch)deutschen u.a. als gisindi neben gislahti einher. Und über diesen Verbund legt sich dar, daß hierin eine andere substanzielle Grundlage die Wesensart bildete, wie es beim lateinischen genus der Fall ist. Gerade der Verbund mit dem Gesinde ist, was beim lateinischen genus nicht existiert, sich hingegen darin gemäß des nobilitas als solches separiert. So ist es hierin auch das Verhältnis von Gesinde zu Gesindel, worüber sich die diversen Vermischungen und Wandel entsprechend darlegen.

» Mittelhochdeutsches Wörterbuch «
Mainzer Akademie der Wissenschaften und der Literatur
Akademie der Wissenschaften zu Göttingen

» gesinde «
stN. auch gesint, aus ahd. gasindi.

1 'Gefolgsleute, Begleiter, Gefährten' (s.a. ingesinde stN.): wer leitet nu die lieben schar? / wer wîset diz gesinde?; Irmschart und Heimrîch / dâ kômen mit grôzem gesinde: / vier vürsten, ir zweir kinde, / siben tûsent ritter oder mêr; darnach solt ir myn [der Königin] ritter sin und von mym gesinde; der tiuvel unde die gîtigen unde die ketzer unde die wider den heiligen geist dâ sündent, daz ist allez éin kumpanîe und éin gesinde; ‘ich urteile, als ich vinde’, / sprach er zu sim gesinde [Jünger Jesu] , / mit sant Johannes ich ez wol beziugen. – in Verbindung mit himelisch: [Maria] is ruom allis himiliscis gisindis; in den alten zîten / vor aller slahte liuten / do erwelete im daz gotes kint / in sîn himelischen gesint / ein juncfrowe guote, / sante Margarête. – im Kampf oder Streit (s.a. vuoʒgesinde , reitgesinde ): dô was ouch daz gesinde ze strîte hêrlîchen gar; die von ir gesinde dâ / ze velde lâgen erslagen, / die hiezen si ze grabe tragen; weliche stat die andern also manti umbe ein gesinde, die sol dem gesinde halben kosten und schaden geben, die wil ez in irme dienste ist. – übertr.: der tôt der suochte sêre, dâ sîn gesinde was. / der von Bechelâren dô langer einer niht genas; der jeger [...] gesach zehant dar inne / daz gesinde der minne: / niwan ein wîp und einen man; galander unde nahtegal / die begunden organieren, / ir gesinde salûieren; füeret in eht gegen dem galgen unde gegen des galgen gesinde [ die erhangenen unde die erslagenen ]. – Paarformel: dû erlâst dîns nîdes niht / daz gesinde noch die geste; von gesinde noch von gesten / wart geherberget / sô wunneclîchen alse hie

2.1 Familie: in der arche obene was mit sinem gesinde Noe / er und sine gemahele, sine snur und ir winige; die dritten die dir bî den füezen sint bezeichent, daz ist dîn gesinde, daz under dir ist: kint und hûsfrouwen

2.2 Dienerschaft, Gesinde: der butil der in sal abir nicht gebietin deme gesinde in irs herrin hus; vil grôze klage man dâ vant / under dem gesinde; leigen unde alle der gesinde [ familia ] , dî dâheime wonent; von dem erbe sol man alrêrste gelten dem gesinde ir verdientez lôn; man sol daz gesinde behalten biz zem drizegesten, daz si sich die wile besteten; des vicetuͦms gesinde, die zu irme brode gen und die in irme huse slafen, uber die sulen si richten

» gesinde, gesint «
stswM. aus ahd. gasindo und gasint.
'Angehöriger eines Gefolges, Diener, Begleiter' (s.a. ingesinde swM.)

der tiufel durch ubermuot wesen wolte same got, / unt er in verwiez daz er in ab deme himele stiez, / jouch sîne gesinden alle sant in die helle; pharao daz zeichen gesach, ez doͮhte in ungemach, / er hiez im gewinnen di zwene gotes gesinde; sît daz ich [ Eckewart ] alêrste iuwer gesinde wart, / sô hân ich iu mit triuwen gedienet; der wirt, der danne des badhovses phleger ist, sol chainen christen baden ze chainer stunde, der niht ir [der Juden] gesinde ist, burger noch gast noch ledigen man. – er hiez in geben wagene mit guote geladane, / dâ man ûffe fuorte wîb unte chint jouch anderen gesint. – übertr.: der tievel [...] fuoret di [Verdammten] mit grimme zuo anderen sinen gesinden / in den ewigen tot; fröiden schîn treit ûzzerthalb der welte vor mîn lîb [...] [während innerlich Trauer herrscht] sô bin ich der welt gesinde

Divider

» Frühneuhochdeutsches Wörterbuch «
» Mitte des 14. Jahrhunderts bis zum beginnenden 17. Jahrhundert «
» Akademie der Wissenschaften zu Göttingen «
» Alphabetischer Einstieg «

» gesinde «

Bedeutungsverwandte: geschlecht (das) 8; sipschaft, stam 3

1. >Familie, Stamm, Geschlecht (als Familienverband gedacht)<; die historische Tiefe des Geschlechtes und die Zugehörigkeit der Ehefrau werden in den Belegen nicht angesprochen.

2. >zu einem bäuerlichen, handwerklichen Haushalt bzw. einer als Haushalt gesehenen kleineren Wirtschaftseinheit gehörende Personen; Gesamtheit der Familienangehörigen, Dientboten, Knechte, Mägde, näheren Verwandte< ; vereinzelt ütr.: Christi gesinde ; teils bildlich gebraucht.

3. >Gruppe von Menschen, die einen Wirtschaftsbetrieb (z. B. einen landwirtschaftlichen Hof, ein Bergwerk, eine Bank) oder einen einem Wirtschaftsbetrieb ähnlich gedachten Hofstaat in dienender, helfender, allseitig unterstützender Funktion aufrechterhält<; je nach Art der Einheit im einzelnen: >Dienerschaft; Belegschaft; Arbeiterschaft<; >Hofstaat<; mit dem Blick auf Himmel und Hölle: >Gott umgebende Schar der Engel oder herausgehobener Himmelsbewohner< bzw. >Dienerschaft, Handlanger des Teufels<; vereinzelt ütr. im Sinne von: >helfende Seelenkräfte< eng an 2 anschließbar, im Unterschied dazu aber mit schwächerer Ausprägung des Familien- und Haushaltsgedankens.

4. >Gruppe von Menschen, (vereinzelt: von Tieren), die sich mit jm. auf einer Reise, auf Wanderschaft o.ä. befinden, (auch:) die js. Lebensgang teilen, Begleitschar, Begleitung (kollektiv)<; speziell: >Jüngerschaft Jesu<; auch: >einzelner Begleiter<

5. >militärische Gefolgschaft, Truppe, Truppenteil; Häscherschar; als militärisch organisiert gedachte Gruppe von Helfern<; auch bildlich gebraucht.

6. >Gesindel, Pack, diejenigen Schichten und Gruppen von Menschen, die man am Rande bis außerhalb der Gesellschaft situiert sieht, denen man (berechtigterweise oder zur Herausstellung der eigenen Ordnungskonformität) alle möglichen Vergehen (z.B. Diebstahl, Betrug, sittenloses Verhalten) zuschreibt und die man der Agitation gegen herrschende Überzeugungen, der Unterminierung des gesellschaftlichen Zusammenlebens verdächtigt<; teilweise Bezug auf Herrschaftsfunktionäre (cardinäle, juristen, richter, des babstes gesinde, pfaffen), sofern sie ihre Position zur Bereicherung nutzen; in gesinde (das ) 6 überlagern sich soziale, sozialkritische, armuts- und fremdheitsbezügliche mit religiös-konfessionellen Einstellungen; mehrfach: >fahrendes Volk<; auch >Teufelspack<

So erweist sich sowohl 'geslehte', wie auch 'Geschlecht', als eine vereinheitlichende Eindeutschung, dem gegenüber sich über die diversen Anwendungen zeigt, daß hierüber einzig die Wortwahl weitläufig und auch nicht generell, eine einheitliche wurde, indess die diversen Herkunftsunterschiede der Bedeutungen sich neben dem und auch darin erhielten, sodaß gerade darüber auch jegliches damit Verbundene ineinander und somit durcheinander geriet. Gerade dies verdeutlicht sich speziell an dem Muster von Gesinde und Gesindel, was sich nämlich auch auf die gleichen Personen bezog, aus unterschiedlichen Warten heraus in Betracht ziehend. Hierüber wandelte sich vor allem die Spezifizierung der Gegegebenheit zu der der gänzlichen Relativität dessen, indem nicht mehr die geschlossene Einheit des Subjekts als solche ihre entsprechende Inbetrachtziehung erfuhr, sondern die von Außenstehendem als Objekt dem gleichzeitig gegenüber steht. Maßgeblich ist somit auch, daß sich sowohl geslehte, wie auch Geschlecht als ein neuer Wortstamm aufweist, worin gar nicht dessen Bezug des Stammes (sleht/schlecht) seine Anwendung und Inbetrachtziehung erfährt. Und darüber zeigt sich auch, daß es sich dabei nicht um einen Begriff handelt, sondern um eine Benamung. Der Bezug des Ursprunges ist hierin überhaupt nicht gegeben und so führt gerade dieses Gegenüberstehen zur allgemeinen Verwirrung, mustergültig u.a. bei Linné, da hierin ein völlig anderes Bezeichnendes dem Verbundswesen der Begrifflichkeit gegenüber steht - ein Bezeichnendes, welches der des Begreifens entbehrt. Es repräsentiert etwas völlig anderes und ist fundiert auf einer Inhaltslehre, welche sich erst erfüllt durch das, was es befüllt.

Und so bestand auch die eigentliche Misere darin, daß sich beides miteinander vermischte und darüber bewirkte, daß beides miteinander in dem Gemeinsamen des Maßnehmens sich vereinigte, dem gegenüber sich darüber zunächst klärte, daß auch das Gemeinsame des gleichen Geschlechts gar nicht als Substanz eine Gegenheit ist, sondern sich überhaupt erst durch die substanzielle Befüllung ergibt. Dem gegenüber hat man jedoch dem eigenen Geschlecht eine Substanz zugesprochen, worüber sich erst in der Gegenwart bewahrheitet, daß auch dieser diese Substanz gar nicht als solche gegeben ist, sondern erst über die Erfüllung zu einer solchen wird. Gemäß dem stellt es sich indess gleichermaßen auch mit der Begrifflichkeit, daß sie sich einzig durch dessen Definition befüllt und einzig gemäß dem repräsentiert, was es ist. Sprache und Sache gehen hierin Hand in Hand, dem gegenüber es die einen Menschen gibt, welche dies achten, hingegen andere Substanzen bilden, die gar nicht sind. Über den Begriff des Geschlechts zeigt sich dies in seiner allseitigen Umfänglichkeit, wie es sich damit verhält. So bildet man in der Biologie auch zunächst den Grundsatz, daß sich das Geschlecht über die Geschlechtsorgane definiert, dem gegenüber man in dem Ursprünglichen des Begriffs an den Grundsätzen des Seinsverhältnissen der substanziellen Begrifflichkeit festhielt und darüber das Gemeinschaftswesen sich auch nach wie vor gestaltet, nur das man dies anders und differenzierender benennt. Über die Fortpflanzung erfährt dies jedoch kontinuierlich sein Dereglement, gemäß dem sich auch die kulturellen und sprachlichen Wandel ergeben.

Dem gegenüber besteht jedoch bis heute nicht nur ein gänzliches Unverständnis diesem Sachstand gegenüber, sondern man trifft auch auf eine systematische Ausgrenzung des Realwesens, was sich mustergültig über Pfeifer's Etymologisches Wörterbuch darlegt, worüber sich die konkretisierende Aufklärung der Geschicht' in seiner Umfänglichkeit beschreibt. "Geschlecht (eigentlich Geschlechtsteil)" lautet dort die indirekte Aussage, welche sich über das Lemma » Geschlechtsteil « darbietet, dem gegenüber der Artikel über das » Geschlecht « markanterweise den identischen Text beinhaltet und auch die Ursprüngsbezüge mit beinhaltet. Der Sachstand ist der, daß man ursprünglich in der Biologie sich von dem Ursprung abwandte und dem gegenüber das Geschlecht über die Geschlechtsteile bestimmte, hingegen dies zwischenzeitlich eine Veränderung erfuhr und man dies mittlerweile über die Gene bestimmt. Jedoch ist dies wiederum nicht identisch mit dem, was die Geschlechtsteile besagen. Es handelt sich hierbei um eine völlig andere Bezugnahme. Dies verdeutlicht sich im Umgang mit Hermaphroditen, welche man dem gemäß auch umbenennt in Intersexuelle und man diesen die 'Geschlechtsteile' entfernt, welche nicht der genetischen Aussage über das Geschlecht entsprechen. Hierüber konkretisiert sich auch der Sarkasmus, welcher bereits seit seinen Ursprüngen die Auseinandersetzung zwischen der Abbildung der künstlichen und natürlichen Systeme begründet, daß nämlich die künstlichen Systeme nicht die Natürlichkeiten abbilden. Daraus entsteht augenscheinlicherweise die Gegebenheit, daß sich der Mensch anmaßt, die Natürlichkeit der Dinge bestimmen zu können, jedoch irrigerweise aus Gegebenheiten, woraus es sich einzig anteilig bestimmt. Die Entfernung der Bestandteile führt indess nicht zur Abbildung des Ganzen, sondern im Gegenteil, führt dies überhaupt erst zur Erwirkung und darüber auch der Darlegung seiner Unvollständigkeit. Dies bezeugt vor allem auch über das Äußerliche, über das sich äußerende Wirken dessen, über das Verhältnis beiderlei Wirken, da es sich nämlich nicht nur in des Jeweiligen Selbst als solches äußert, sondern auch anderen gegenüber ersichtlich ist. Darüber ist es auch zur allgemeinen Auseinandersetzung damit gelangt und begründet die neuzeitlichen Genderdebatten. Die auseinandersetzende Grundlage hierin ist, daß sich über die Gene eben nicht bestimmt, wie es sich mit dem Geschlecht verhält und auch nicht alleine über die Geschlechtsteile, sondern daß darin mehr als das das Sein bestimmt und dies entsprechend zu achten ist. Die Sachlage bestätigt hierin auch die Sprachlage, die es gleichermaßen besagt über den Umfang seiner Präsenz und gerade darüber läßt es sich auch daraus herauslesen, wie es sich damit verhält. Und markanterweise verfügen wir über keinen deutschen Begriff für Gene und auch der Geschlechtsbegriff ist nicht darauf bezogen und darüber ergibt sich auch der Hinweis darauf, wie sich dies abseits dessen fundiert.

» Etymologisches Wörterbuch des Deutschen (DWDS - 1993) «
Wolfgang Pfeifer

» Geschlechtsteil «
(identisch mit » Geschlecht «)

Geschlecht n. 'Gesamtheit der Merkmale, die ein Lebewesen als männlich oder weiblich bestimmen, Familie, Generation, Art, Genus', ahd. gislahti n. (um 1000), mhd. gesleht(e) n. 'Geschlecht, Stamm, Abkunft, Familie, Gattung', mnd. geslechte, mnl. gheslachte, gheslechte, nl. geslacht steht als Kollektivum neben gleichbed. ahd. slaht n., slahta f., slehti n., mhd. slaht(e) f., slehte n. Beide Abstraktbildungen gehören zu dem unter schlagen (s. d.) behandelten Verb (mit grammatischem Wechsel von g und h) in seiner Bedeutung 'sich in einer bestimmten Richtung entwickeln, nach jmdm. geraten, jmds. Art haben, nacharten'; vgl. nach jmdm. schlagen 'geraten' (bereits ahd.), aus dem Geschlecht, aus der Art schlagen (16. Jh.). Geschlecht bezeichnet die blutsverwandte (vornehme) Familie, Nachkommenschaft, die (vornehme) Abstammung, das Volk, die Menschheit (entsprechend lat. genus); dann (im Spätmhd.) auch das natürliche (männliche oder weibliche) Geschlecht (entsprechend lat. sexus) und (seit etwa 1400) das grammatische Geschlecht (lat. genus). geschlechtlich Adj. 'das Geschlecht betreffend, sexuell' (Anfang 19. Jh.). geschlechtslos Adj. 'zu keinem Geschlecht gehörend' (18. Jh.). Geschlechtsteil n. (18. Jh.), Übersetzung von lat. pars genitalis. Geschlechtstrieb m. 'Fortpflanzungstrieb' (18. Jh.). Geschlechtswort n. 'Artikel' (17. Jh.), Verdeutschung von lat. articulus.

» Gesinde «
(Vielfalt an Kulturbezug gegenüber Geschlecht)

Gesinde n. 'Gefolgs-, Kriegsleute, Hausdienstleute, Knechte und Mägde eines Bauern-, Gutshofes', ahd. gisindi (9. Jh.), asächs. gisīði, mhd. mnd. gesinde, (mit Assimilation) gesinne 'Begleitung, (Kriegs)gefolge, Dienerschaft' (germ. *ga-sinþja-) sind Kollektivbildungen zu stark flektiertem ahd. gisind (9. Jh.), mhd. gesint, asächs. gisīð, aengl. gesīþ (germ. *ga-sinþa-) und schwach flektiertem ahd. gisindo (9. Jh.), mhd. gesinde, aengl. gesīþa, got. gasinþa, anord. sinni 'Gefährte, Weggenosse, Gefolgs-, Dienstmann, Hausgenosse' (germ. *ga-sinþan-). Die Personenbezeichnung ist ein Präfixkompositum zu ahd. sind 'Weg, Richtung, Seite', mhd. sint, auch 'Reise, Fahrt', asächs. sīð, aengl. sīþ 'Weg, Gang, Reise', anord. sinn 'Gang, Fahrt', got. sinþs 'Gang' (germ. *sinþa-) und meint ursprünglich den, 'der den Weg, die Reise gemeinsam mit (einem) anderen macht', das Kollektivum Gesinde dagegen die 'Gesamtheit der Begleiter, Gefährten auf dem gemeinsamen Weg, auf der Reise'. Zur Bildungsweise s. Bauer3, Genosse, Geselle, Gefährte; zur Etymologie des Grundworts s. senden. Dazu die Deminutivbildung Gesindel n. 'kleines Gefolge', mhd. gesindelin, dann 'Hausleute, kleine Dienerschaft', vor allem jedoch pejorativ 'heruntergekommenes, sich herumtreibendes Volk, Pack' (16. Jh.).

Elementar in dem Wandel, hin zur neu bildenden, alles miteinander verbindenden Hochsprache, sind zwei sprachtechnische Bestandteile, wie nachfolgend beschrieben, nämlich zum Einen der Wandel in eine Sprache, welche aus der Grammtik heraus gebildet wird, während zuvor diese nur indirekt überhaupt Bestandteil war. Zum Anderen, damit verbunden jedoch, findet darin eine Atomisierung des Jeweiligen statt, gemäß der erforderlichen Erfüllung der Funktionsweise der Grammatik, die sich aus ihren isolierten und darüber individualisierten Fragmenten zusammensetzt, dem gegenüber zuvor eine solche Isolierung von Einzelnem ebenfalls nicht existiert. Dies geschieht über eine mathematisch systematische Ordnung des Konstrukts. Maßgeblich ist darüber hinaus vor allem, daß dies darauf basiert, das Subjekt aus den Bestandteile heraus zu eliminieren und dies separierend als grammatikalisches Subjekt dem wiederum zuzufügen, sodaß jedoch das Jeweilige dem gegenüber als Neutrum darin präsent ist. Dies verdeutlicht sich vor allem über den noch heute präsenten Dialekt, in welchem in der Artikulierung grundsätzlich die Wiederspiegelung des Selbst, die Grundlage der Bezeichnungen und Aussagen bildet. So existiert darin z.B. auch nicht das Neutrum 'Hund', sondern dieser erfährt nicht nur davon sich unterscheidende Bezeichnungen, sondern die Jeweiligen Gleichen sind jeweils wiederum subjektiviert, entsprechend des Aussagenden und seiner Bezüge. Im sich neu bildenden Slang hingegen praktiziert man dem gegenüber eine Um-, bzw. Rückbildung aus dem hochdeutschen Sprachschatz heraus, worüber dies gleichermaßen in Erscheinung tritt. Wie Viti hervorhebt, erfährt das Einheitswesen, so auch der Kontext, gar nicht seine Inbetrachtziehung in der Sprachforschung. Darüber hinaus trifft man jedoch generell einzig auf ein lexikalisch Begründetes, gar in der Etymologie, worüber das alte Konstrukt somit auch gar nicht gemäß dem in Erscheinung tritt, da darin einzig die isolierten Fragmente des grammatikalischen hochdeutschen Verhältnisses abgebildet sind. Und selbst im Falle des Geschlechts, wo dies absolut nicht übersehbar ist, gelangt dies nicht zu seiner erforderlichen Sichtung. Hierzu gilt es anzumerken, daß Diejenigen, welche über einen Dialekt verfügen, auch andere Dialekte, ohne sie speziell zu erlernen, nachvollziehend in Sprache und Inhalt verstehen können, hingegen Diejenigen, welche ohne Dialekt aufgewachsen sind, in keiner Weise auch nur im Ansatz Dialekte nachvollziehen können, da das Kernwesen ein völlig anderes ist.

Elementar bezüglich der Entwicklung und Anwendung dieser künstlichen Sprache, gegenüber der Natürlichen, ist darüber hinaus vor allem, was über De Saussures Aussage zum Prinzip dieser Arbitrarität, wie es sich bezeichnet, dargelegt wird, daß es sich hierbei nämlich primär um das erforderliche Prinzip der Sprachübertragbarkeit handelt. Hierzu gilt es zu bedenken, daß dies auf dem lateinischen Anwendungsprinzip basiert, welches sich darin gegenüber dem griechischen abgehoben hat, indem zwar die Begriffe, aber nicht die Funktionalität der Sprache übernommen wurden. Maßgeblich hierin ist, wer die Lateiner überhaupt waren, was den Umstand erklärt, denn sie waren fast gänzlich keine entstammenden Römer, sondern in anderen Kulturen Befindliche und aus anderen Kulturen Stammende, wie auch die Sprache in seinem Grundsatz zu einem generellen Kommunikator zwischen den Sprachkulturen fungierte (relativ dem des heutigen Englisch). Aus dem Grund bedingte es auch dieser speziellen Sprachbildung, die nämlich nicht als reguläre Sprache fungiert, sondern eine auf einem 'Sprachkode' basierende Formalsprache, gemäß dem sie sich grundsätzlich von der Umgangssprache unterscheidet. Hierzu gilt es ebenfalls auf die Gegenwart des Dialektes und Slangs hinzuweisen, dem gegenüber das Hochdeutsche den Anwendenden rein als Formalsprache fungiert und somit auch grundsätzlich die Sprachverhältnisse im Nebeneinander einher gehen. Dies übertrug sich einst vor allem auch auf das Neulatein, welches man dem entsprechend auch als Vulgärlatein bezeichnet, da es sich mit der Vulgärsprache vermischte. Hingegen ist die Vulgärsprache eine Vermischung des Dialektes mit der Hochsprache, gemäß dem diese auch entsprechend überhaupt erst als solche in dessen Verbund in Erscheinung tritt. Dem gegenüber stellt die heutige Umgangssprache, abseits dessen, eine Verwillkürlichung des Bezugsverhältnisses dar, was darauf beruht, daß man die elementaren Unterschiede der Herkünfte der Anwendung gar nicht kennt, was jedoch erst ersichtlich wird, indem man dieser eine der spezifizierten Anwendungsformen gegenüber stellt, sodaß sich darüber die Vermischung auch entsprechend überhaupt erst zeigt.


Narr Francke Attempto Verlag

Die Ikonizität tritt in den frühen Phasen einer Struktur oder eines Sprachwandels klarer hervor als in den späteren. De Saussure (1916) bemerkte, dass die Wörter mit der Zeit immer arbiträrer werden, sodass ein fast onomatopoetisches Nomen wie Lat. pipio-onis "Piepvogel, Täubchen" im Französischen zu pigeon wird, wo die ursprüngliche Motivation weniger ersichtlich ist. Die diachrone Tendenz von ikonischen zu arbiträren Formen kann konsequent mit dem Prinzip der "Grammatikalisierung" (grammaticalisation) von Meillet (1912) in Verbindung gebracht werden, wonach autonome, lexikalische Wörter, die ursprünglich eine konkrete Bedeutung haben, später eine abstraktere Funktion entwickeln und zu grammatischen Wörtern werden (vgl. auch Kurylowicz 1965; zu früheren Hinweisen auf den Wandel von konkreten zu abstrakten Wörtern vgl. Hagège 1993: 170; Heine 2003a: 575-576). Ursprünglich wurde das Konzept der Grammatikalisierung entwickelt, um die Entstehung neuer Formen zu beschreiben, und deshalb betraf sie am Anfang mehr die Morphologie bzw. Wortbildung als die Syntax: nach Meillet werden neue Wörter entweder durch Analogie oder durch Grammatikalisierung gebildet. Aber er zeigte auch Fälle von Grammatikalisierung, bei denen ganze Konstruktionen einbezogen werden, z.B. Verben, die ursprünglich "fangen" oder "fassen" bedeuteten, dann Besitz ausdrückten und schließlich als Auxiliarverben in analytischen Präteritalformen benutzt wurden. Denn de facto betrifft die Grammatikalisierung eher Wörter in einem bestimmten Kontext als einzelne Lexeme (Traugott 2003).

Es gibt eine Klasse von Wörtern, welche zwischen Substantiven und Akjektiven in der Mitte stehen. Man mag sie 'attributive Substantiva' nennen. Den Grundstock derselben bilden Wörter, welche als Attributa zu Personalbegriffen angefügt werden können. Sie bezeichnen Menschen nach dem Alter, dem Stande, der Beschäftigung, irgendeiner hervorragenden Eigenschaft. Bald sind sie als Substantiva empfunden, und kommen nur ausnahmsweise als Adjektiva vor, bald sind sie mehr adjektivistisch, so dass sie von den Grammatikern als Adjektive einer Endung bezeichnet werden pflegen. Dem entsprechend ist auch ihre Motionsfähigkeit verschieden (Delbrück 1893: 420 ff).

Also darf der Vergleich zwischen den alten idg. Sprachen und dem 'Standard Average European' im Bereich der Koordination nicht so hoch eingeschätzt werden, weil Koordinatinatoren in den beiden Bereichen eine sehr unterschiedliche Verteilung haben. In den alten idg. Sprachen erlaubte die Verbindung von Wörtern oder Sätzen viel mehr Variation in Asyndeton, lexikalischer Wiederholung und Gebrauch grammatischer Konnektoren. Einerseits hatte das Asyndeton einen viel breiteren Umfang in den frühesten Sprachstufen des Indogermanischen (Viti 2010 a), andererseits waren Koordinatoren den Adverbien viel ähnlicher, und wie von Dunkel (1979; 1982) gezeigt konnte die Iteration der Präverbien dieselbe Funktion wie eine koordinierte Konjunktion haben. Wegen der oft noch transparenten adverbialen Funktion hatten die Konjunktionen der alten Sprachen auch eine ziemlich freie Stellung, und sie konnten auch selektive Beschränkungen in Bezug auf die verknüpfenden Elemente haben, während in den modernen idg. Sprachen Adverbien und Koordinatoren meistens morphologisch und syntaktisch voneinander unterschieden werden.

Syntaktische Funktionen wie 'Subjekt' (subiectum) und 'Prädikat' (praedicatum) wurden von den klassischen Grammatikern eigentlich noch nicht anerkannt: Aristoteles, der eine erste Anschauung davon hatte, verstand darunter eher logische als linguistische Einheiten, und Sytaktiker wie Dionysios Thrax und Apollonios Dyskolos ignorieren sie völlig; in der westlichen Tradition geht die Anerkennung der syntaktischen Funktionen auf die Scholastik und Modistik zurück (13.-14. Jh., vgl. Vineis & Maieru 1994: 134; 151). Denn trotz der typischen Beziehungen zwischen Subjekt und Nomen bzw. zwischen Prädikat und Verb müssen syntaktische Funktionen von syntaktischen Kategorien unterschieden werden mittels des Begriffs der Relationalität bzw. Nicht-Relationalität, und das wurde erst in moderner Zeit, besonders von Chromsky herausgearbeitet. Syntaktische Kategorien sind nicht relational, weil sie ohne Rücksicht auf den Satz oder Kontext anerkannt werden können; so ist der Ausdruch 'das Pferd' immer eine NP. Dagegen sind syntaktische Funktionen relational, weil sie nur anhand eines bestimmten Satzes identifiziert werden: 'das Pferd' ist kein Subjekt per se, sondern kann nur das Subjekt eines Satzes wie 'das Pferd läuft' sein.

» Das Menschenbild bei den Indogermanen (2017) «
Studien zur historisch-vergleichenden Sprachwissenschaft
Carlotta Viti

De Saussures (1916) Prinzip der Arbitrarität des sprachlichen Zeichens, nach dem keine natürliche Beziehung zwischen dem Bezeichneten (signifié) und dem Bezeichnenden (signifiant) in den Sprachen besteht, stimmt mit dem Gebrauch einer einzelnen Benennung für einen außersprachlichen Referenten überein. Denn indem die Benennung arbiträr ist, gibt es keinen Grund dafür, dass die Sprache über mehrere Benennungen für denselben Referenten verfügt, vielmehr wird erwartet, dass synonyme Ausdrücke wegen der Ökonomie des sprachlichen Systems synchron eine geringe Rolle spielen und diachron verloren gehen. Auch das gelegentliche Auftauchen onomatopoetischer und phonosymbolischer Formen unterminiert die grundsätzliche Arbitrarität des Zeichens nicht, so dass Ikonizität im Kommunikationssystem nur ganz marginal im Vergleich zu Arbitrarität auftritt. Ein solches Prinzip war aber in der Antike so nicht bekannt, als eine hitzige Debatte zwischen der Hypothese einer Benennung nach arbiträrer Unterscheidung des Sprechers und der nach der Natur des bezeichneten Referenten stattfand. Das können wir in Platons Kratylos nachlesen, einem Dialog, der genau diesem Problem der Richtigkeit der Namen gewidmet ist.

Als weiteres zeigt sich mustergültig, über das neue biologische Geschlecht, der zunächst stattfindende Wandel vom Adjektiv zu dem eines Nomens, als was es sich erweist und nicht, wie man angibt, als ein Substantiv. Hierzu gilt es den Ablauf dazu in Betracht zu ziehen, daß zunächst gar nicht klar war, was 'das Geschlecht' überhaupt als solches bestimmend repräsentiert und zwar nicht nur in der Botanik, sondern generell, es sich jedoch um eine substanzielle Bezugnahme handelte, worin man der Substanz die Ermessung dessen zusprach und sich im Verlaufe dies nicht nur immer weiter spezifizierte, im Verhältnis des Ganzen, auf Einzelnes sich verlagernd, sondern sich darüber gleichzeitig in seinem Bezug immer weiter eingrenzte, sodaß man letzendlich bei den Genen angelangte, worüber diesen die Bestimmung zugeprochen wurde, was jedoch wiederum sich verflüchtigte, aufgrund dessen man erkannte, daß auch darüber die Bestimmung der Ausbildung des Geschlechts nicht erfolgt, sodaß man es darin an sich gar mit einem Namen zu tun hat, für etwas, dessen Inhalt man gar nicht fassen kann. Hierüber zeigt sich jedoch, womit man es darin zu tun hat, nämlich daß sich die Eigenschaft nicht aus der sich darbietenden Substanz heraus ergibt, sondern es sich umgekehrt darin verhält. Es handelt sich somit, um ein als solches 'statuiertes' Substantiv, was es jedoch aufweisenderweise gar nicht ist, sondern es sich auch darin, gemäß seines begrifflichen Ursprungs verhält, aufgrund dessen dieser sich auch von Grund auf davon differenzierte. Als maßgeblich erweist sich hierin, daß man in der Grammatik, gegenüber dem Latein, worin das Nomen den Überbau bildet und sich darin in 'nomen substantivum' (Person) und 'nomen adjectivum' (Mensch) unterschied, sowohl im Deutschen, Englischen und Französischen hingegen stattdessen einzig das Substantiv in Anwendung ist, in welchen man zwar in den Fachterminas noch 'chematische' Untergliederungen antrifft, jedoch in keiner Weise in der regulären Anwendung.

Diese Entwicklung fundiert sich jedoch aus der ideologischen Entwicklung heraus, in Verbindung mit dem Aufkommen derer Repräsentatoren der Wissenschaften, welche man spezifisch in dem Wandel von Leib (nomen substantivum) und Seele (nomen adjectivum), gegenüber dem des Körpers (substantivum) antrifft. Gemäß dem, daß die Seele nicht als Substanz, sondern als das, was das Leben ausmacht, in Betracht gezogen wurde, verhielt es sich generell gegenüber dem Relativum des Seins und fand in der Sprache sein entsprechendes Abbild. Die aufkommenden Wissenschaften sind indess völlig neu in ihren aufbringenden Bildnissen, nicht nur gegenüber den alten griechischen Verhältnissen, sondern auch gegenüber den bestanden Lokalen, was sich über dessen systemtischen Substantivierung der Adjektive darlegt. Dieses Bildnis hat sich systematisch im Verbund des Aufkommens der diese bildenden hochdeutschen Sprache,über das gesamte Sprachwesen ausgebreitet und darüber sämtlichen alten Bezüge, gemäß dem es auch dem alten Geschlecht erging, verdrängt. Die Grammatik ist hierin das fundierende Maßregelwerk dazu. Damit verbunden ergeht es auch der ursprünglich zunächst noch im Verbund der deutschen Sprache aufblühenden, jedoch nicht weit gelangenden Philosophie, da gerade die Sprache ihr Werkzeug ist und sie sich darin verfängt. Ihr Enden in der Phänomenologie des Geistes, was im Verbund mit dem Leib-Seele-Problem einher geht und seit Jahrhunderten nicht heraus gelangens, basiert auf dieser sprachsubstanztechnischen Verschiebung, dem gegenüber jedoch der Geist gleichermaßen auch die Substanz repräsentiert, aufgrund dessen das Verhältnis zur Seele sich darüber noch relativ bewahrte. Zunächst vor allem noch über das Parallelverhältnis zur Theosophie, wie überhaupt dem Christenverhältnis. Heute hingegen jedoch einzig noch als ein schwacher Gegenpol zu der wissenschaftlichen Monopolpräsenz, als ein Bestandteil dessen seiend deklariert.

Hierzu gehört auch die Verlustigung des Verhältnisses zu den Begriffen, denn in diesem wissenschaftlichen Verhältnis ist alles einzig noch ein Bezeichner für die Substanz, welche gemäß deren Ideologie die Eigenschaften enthält und somit dies eine Einheit bildet. Gemäß dem bildet man heute auch Verben einzig noch aus Substantiven heraus. Dem gegenüber ist im Ursprung des Vorstellungswesens, die Präsenz des Jeweiligen in seinem Bestand einzig, aufgrund des darauf Einwirkungen und dies Bewirkenden, sodaß man spezifisch über die Begriffe auch das Verbundswesen des Seinsverhältnisses darüber abbildet. Zumal man in diversen Verhältnissen alter griechischer Philosophie die Begriffe über das Wahrnehmungsverhältnis stellte und gar als das Einzige, worüber sich das wahre Sein abbildet. Auch diesbezüglich ist die Gegebenheit zum Geschlecht ein mustergültiges Beispiel, wie es sich generell darin verhält, zumal man doch in der Physik eingestehen mußte, daß es das materielle Atom gar nicht gibt, welches das Sinnbild dieser Grundlage darstellte. Trotz dessen setzt sich nach wie vor diese Ideologie fort, da sie in ihrer Art, vor allem auch aufgrund des entstandenen Kompendiums, gar nicht wandelbar ist.

Was die Vorlagen des Lateinischen betrifft, so gilt es, nachfolgende Ausführung von Döderlein zu berücksichtigen. Wie dieser verdeutlicht, so hat man es im Latein mit zwei zentral zu achtenden Gegebenheiten zu tun: zum Einen wurde die lateinische Sprache weiträumig vom Griechischen übernommen, sodaß sich auch darüber wiederum Kollidierungen ergeben, wie man sie gegenüber dem Deutschen antrifft. Des weiteren bestehen nicht nur örtliche Unterschiede, wie dieser hervorhebt, sondern vor allem auch zwischen dem ursprünglich gebildeten Altlatein und dem Neulatein, welches im Verfall des Alten und darüber hinaus, weiträumige Neuerungen und Änderungen erfahren hat. Bezüglich des Jeweiligen sind somit diverse Rücksichtnahmen unerläßlich. Das Latein war nicht nur als Staatssprache in Anwendung, sondern war vor allem auch Handels- und Kolonialsprache, sowie sich auch die gebildeten Stände fremder Kulturen damit ausstatteten. Dem gegenüber erklärt man die lateinische Sprache sogar als tote Sprache, was sich auf die Zeit nach dem römischen Reich bezieht, was in keiner Weise der Fall ist, vielmehr diese nach wie vor noch sehr lebendig ist und nicht nur über dessen Anwendung in diversen Fachbereichen, sondern aufgrund lateinischer Übernahmen in die Landessprache, worüber sich gerade aufgrund dessen, daß sie nicht mehr über die ursprünglichen Regularien der kulturellen Präsenz des Römertums noch gravierendere Rückkoppplungen ergeben. Wie es sich damit verhält, erfährt man auf außergewöhnliche Weise über den Begriff des Genus, worüber sich demonstativ darlegt, wie es sich damit verhält. Man hat es somit generell mit Mischwesen zu tun, worin es somit auch, gemäß Döderlein's Hervorhebung, der spezifischen Trennung bedingt, um darüber zu Klarheiten zu gelangen. Gerade dies findet, wie sich über den Begriff Geschlecht darlegt, nur ansatzweise und vereinzelt überhaupt seine erforderliche Berücksichtigung.


Die lateinische Wortbildung
Verlag: F. C. W. Vogel
6 Teile u. Beil. in 6 Bänden. 1826-1839
Nachdruck: Scientia-Verlag
» «

Das Latein eine Mischsprache

33. Ich halte gegenwärtig das Latein für eine recht eigentliche Mischsprache, und habe sie nach dieser Voraussetzung behandelt. Um irgend eine Sprache als Mischsprache ansehn zu dürfen, müsschen sich etwa folgend Merkmale vereinigen.

a) Historische Spuren, dass die Bevölkerung das Land aus verschieden redenden Nationen entstanden und zusammengewachsen ist.

b) Inconseuquenz des Lautsystems bei seinem Zusammenhalt mit andern Sprachen, und in deren Folge die Coexistenz einer ansehnlichen Zahl von Wörtern, welche den Charakter von blos dialektischen Verschiedenheiten tragen.

34. An historischen Spuren fehlt es bekanntlich nicht; weder durch die Darstellung des Livius, noch die Untersuchungen Biehuhrs und O. Müllers lassen einer andern Vorstellung Raum, als dass in Rom verschiedene italische Völkerschaften und Sprachen zu einer neuen Nation zusammengewachsen sind. Nur habe ich keine absolute Nöthigung gefunden, einen griechischen und einen ungriechischen Bestandteil in der lat. Sprache zu unterscheiden. Denn den glänzenden, von Biebuhr angeregten, von O. Müller weiter ausgeführten Gedanken, dass die meisten Landwirthschaftlichen Wörter der lat. Sprache griechisch, die politischen, militärischen, juridischen dagegen ungriechisch seien, habe ich jüngst einer besonderen Prüfung unterworfen, und dadurch, dass ich auch die als ungriechisch angesehenen politischen und militärischen Ausdrücke auf griechische Formen oder Wurzeln reduzierte, wie ich hoffe, etwas wankend gemacht.

35. Als Beispiel, wie einfach sich nach gehöriger Forstellung der Lautveränderungsgesetze das Latein in allen seinen Erscheinungen theils mit dem Griechischen parallelisieren, theils aus dem Griechischen ableiten lässt, folgt hier ein Uebersicht der handgreiflischsten Concordansen: Jupiter , Janus, Juno, Diana, Minerva, Laverna, Caras, Venus, Frutis, Neptunus, Apollo, Aperia, Vesta, Orcus uragus, Libitina, Feronia, Manes, Vulcanus, Mulciber, Mars, Marmar, Mavors, Liber, Loebasius, Mercurius, Tellumo, Pilumnus, Picumnus, nebst einigen Andeutungen und Vergleichungen aus dem Gebiet der römischen Topographie, Antiquitäten und Geschichte: Aventinus, subura, velabrum, acamenta, naenia, optio, ferentarii, Salii, inqilinus, vindicta, lictor, proletarii, Ancus, Porsena, Vellejus, Vallaeus, Vespasius, Vitellius, Atilius, Egnatii.

36. Aber auch im allgemeinen sind mir so wenig lat. Wörter überig geblieben, dass nach meiner Ueberzeugung, eine fortgesetzte Vergleichung der lat. und gr. Sprache, nach vollständiger Ergründung und Begründung ihrer verschiedenen Lautsysteme auch jenen Rest in Null auflösen wird.

37. So sehe ich also in der lat. Sprache ein Mixum compositum aus lauter altialischen Dialekten, in diesen wiederum nichts als griechische Dialekte. Es entstand erstens durch die früheren und ununterbrochenen Einwanderungen von eigentlich griechisch redenden Völkern, dann zweitens durch Roms Verkehr mit dem gräcisierenden Hetrurien, mit Grossgriechenland und den Sikelioten, und endlich drieens durch die Adoption der griechischen Literatur. Die altialischen Sprache, von denen wir Proben theils in ganzen Monumenten, theils in einzelnen Wörtern haben, die sikelische, die oscische, die sabinische, die umbrische Sprache enthalten so viele auf den ersten Blick erkennbar griechische Elemente, dass der Schluss, eine weitere Forschung werde auch für den noch nicht entzifferten Theil die griechische Verwandschaft nachzuweisen vermögen, gewiss nicht voreilig ist.

Fremdwörter

Bei diesem Charakter der lat. Sprache, als einer Mischsprache, ist es ein äusserst schweres und missliches Geschäft zu bestimmen, welche Wörter als Fremdwörter, als erst in der historischen Zeit entlehnt, anzusehn seien; denn darf auch Niebuhrs hingeworfene Behauptung, dass man von jeher in Rom griechisch verstanden habe, für annoch unerwiesen gelten, so ist doch der Einfluss griechischer Sprache auf Rom so alt und so vielfach und so ununterbrochen, dass man um die Grenze verlegen sein muss, die zwischen der Urverwandtschaft beider Sprachen und ihrer erst durch den Verkehr herbeigeführten Uebereinstimmung zu ziehen wär.

47. Gegen die Ansicht von der allmählichen Bildung der lateinischen Sprache, demnach sie in Folge des vielerlei Einflusses von aussenher und namentlich Griechenland sich zu dem Griechischen nicht viel anders verhält, als das Französische zu dem Latein, hat sich mein Gefühl und meine Vorliebe zum Latein lange gesträubt. Vormag sich sie aber bis auf einen gewissen Grad von dem Charakter eines Jargons nicht freizusprechen, so darf ich mir auch Worterklärungen erlauben, vor welchen man bei Behandlung einer selbständigen durchaus organisch entwickelten Sprache erschrecken müsste.

Damit verbindet sich noch eine andere auffallende Erscheinung. Die Lateiner selbst hatten ein so tiefgegründetes Gefühl und Bewusstsein von der Unselbständigkeit ihrer Sprache, dass sich die Bedeutungen eines lateinischen Wortes veränderten oder vermehrten, wenn dasselbe aber einem heterogenen aber ähnlich lautenden griechischen Wort verglichen wurde.

Dieses Verhältnis entbindet nun einerseits keineswegs von der Verpflichtung, eine Gesetzmäßigkeit auch in der lat. Wortbildung vorauszusetzen, anderntheils berechtigt es aber auch, Anomalien und Willkührlichkeiten und inconsequenzen gelten zu lassen, welche bei der Behandlung einer andern Sprache den Sprachforscher denklich machen müsste. Noch weniger soll dadurch dem Latein das ihm von den neuern Sprachforschern vindicirte Lob streitig gemacht werden, dass es in vielen Fällen, in einzelnen Wörtern wie in der Grammatik, die ursprüngliche Form treuer bewahrt habe als die Griechen und in hundert Wortformen, die das folgende aufzählen wird. Jedenfalls wird dadurch mein Unternehmen, das Latein vor allem und einseitig, ausschliesslich mit dem Griechischen zu parallelisieren, sich als nicht unnütz darstellen. Der weitern Vergleichung mit den in aufsteigender Linie verwandten Sprachen sind, wie oben gesagt, ihre wohlbegründeten Rechte vorbehalten.

In der Ergründung des Ursprungs von genus/sexus stößt man darüber hinaus noch auf einen anderen Gegenstand, welcher nirgends seine Inbetrachtziehung erfährt, nämlich den des grammatikalischen Duals, welches in der Überführung in die Hochsprachen nicht übernommen wurde. Hierin gibt es einzig noch das Singular und Plural und verdeutlicht darüber noch einmal spezifizierend die Mißlichkeiten der Inbetrachtziehungen und Anwendungen, gegenüber der Gegebenheit, daß es das Eine ohne das Andere gar nicht gibt - das Jeweilige kein Singuläres ist und wo es zur Einheit wird, darin gleichermaßen wiederum die Zusammengehörigkeit die Grundlage bildet. Darauf fußt auch der Ursprung, welcher aus der Einheit des Ganzen die Einheit des Jeweiligen zu begründen suchte, dies jedoch der Voraussetzung des grammatikalischen Duals zur Benennung dessen als solches und somit auch der übertragbaren Anwendung entbehrt. Somit ergibt sich gerade darüber auch ein grundsätzliches sprachtechnisches Mißverhältnis, welches das Abbildungswesen zu Ideologien darüber umgestaltet, über die bedingende Umgehung dieses Übels. Über dieses Sprachverhältnis läßt sich weder abbilden, noch darstellen, was diese Tatsachen darlegen. So ist denn auch der Verlauf darüber in seiner Deutlichkeit ersichtlich, daß man zunächst über das Plural (der Einheit) ersuchte, die dualen Bestandteile daraus zu benennen und zu beschreiben, hingegen dies im Verlaufe zum Singular verfiel, aus dessen Verhältnis man es forthin beschrieb. Dem gegenüber ist zu bedenken, daß das Dual die Grundlage der getrenntgeschlechtlichen Fortpflanzung bildet und somit, gemäß dem die Sprache dies selbst nicht beinhaltet, es dieser hinzugefügt werden muß, um eine naturgemäße Abbildung darüber zu ermöglichen. Dies ist möglich und bildet sich über das dem entsprechende Naturverständnis heraus aus. Inwiefern es des Duals bedingt, hängt somit auch damit zusammen, inwiefern das Naturverständnis selbst die Grundlage bildet, in der Ersichtung des Seins, wohingegen es in Separierung dessen spezifisch über das Jeweilige selbst der sprachbildenden Mitteilung bedingt. Man bedenke hierzu als Musterbeispiel, daß in dieser Handhabe das Links bei L anzutreffen ist, separiert von dem Rechts bei R, dem gegenüber beides nicht getrennt voneinander existiert. Hierüber werden nicht nur die sich darüber aufweisenden Grundlagen des Seins außen vor gestellt und erfahren darüber auch nicht nur eine gänzlich Veränderung, sondern darüber eliminiert sich das 'an sich' aufweisende Verständnis und auch dessen Wesensart.


Verlag: Heinrich Ludwig Brönner
» «

sexus, us, m- secus, n. das Geschlecht. (scheint von secere, secare, schneiden, theilen, in der Bedeutung von Abtheilung, Theil, zu kommen, wozu dann virorum, mulierum zu denken wäre. Unwahrscheinlicher wäre die Ableitung von secere, sequi, in der Bedeutung von secta, obgleich secta mulierum vorkommt, denn in dieser Zusammenstellung ist es nur von secta im Allgmeinen einmal speciell eintlehnt).


Verlag: Hahn'sche Buchhandlung
» «

sexus, -us ist sicherlich von den hier angeführten Wörtern dasjenige, wo die Entstehung des u-Stammes aus einem alten Dual am wahrscheinlichsten ist. Die Erklärung aus *sec-tu- (sec-are "Abteilung", Vaniček a. a. O. 292) ist durch die bekannten lautgesetzlichen Verhältnisse ausgeschlossen; sexu- kann nur auf älterem sec(qu)-su- beruhen, da kein Anlass vorliegt dasselbe aus *sect-tu- zu erklären. Entweder muss also sexu- ein secundärer, aber ursprünglicher, vom s- Stamm seques- (secus) abgeleiteter u-Stamm sein, wofür mir jedoch keine Analogien bekannt sind, oder seine u-Flexion ist von der bezeichneten hysterogenen Art. Der Ausgangspunkt dieser Umbildung wäre, wie im vorigen Beispiele, der Gen. Du. gewesen: *sequ(e)s-ous = sexus "der beiden Arten" z. B. virilis et muliebris sexus (unbelegt), welche Form dann bei dem Zugrundegehen der Dualkategorie zum Singular (utriusque sexus) überführt wurde.

Man wird vielleicht gegen diese Etymologie einwenden, dass die dabei im Gen. Du. *sequ(e)s-ous anzunehmende Synkope des Stammsuffixes auffällig sei; denn so häufig diese Synkope in den Ableitungen der s-Neutra ist (anxius : angor augustus, saxun : sac(e)sna etc., s. Brugmann K. Z. XXIV, 10 f., Joh. Schmidt K. Z. XXV, 26), so selten erscheint sie im Paradigma selbst, so dass man sogar die Regel aufgestellt hat, dass in der Deklination der Vokal des Suff. -es gar nicht schwinden dürfe. Indessen, da es wohl nunmehr ausser Zweifel steht, dass auch diese Stämme von Haus aus den freien indog. Accent besessen haben (s. Möller Paul-Braunes Beitr. VII, 503 f., Osthoff M. U. IV, 182 m. d. Anm.), so wird diese an sich sehr verdächtige Verschiedenheit der Derivation und der Deklination auf sekundärer Uniformierung der letzteren beruhen. Sollte es übrigens, was ich nicht glaube, durchaus nötig sein, den alten Gen. Du. von seques- mit vollem Stammauslaut als *seques-ous anzusetzen, so könnte man in dieser sehr leicht als isoliert zu denkenden Form eine vor dem Rhotazismus liegende einzelsprachliche Synkope des mittleren e annehmen.


Max Niemeyer Verlag

» Immanuel Johann Gerhard Scheller «
» Ausführliches und möglichst vollständiges lateinisch-deutsches «
und deutsch-lateinisches Lexicon oder Wörterbuch

dritte Auflage von 1804/05
» lateinisch-deutsch - Erste Abtheilung A - C «
» lateinisch-deutsch - Zweyte Abtheilung D - K «
» lateinisch-deutsch - Dritte Abtheilung L - O «
» lateinisch-deutsch - Vierte Abtheilung P - R «
» lateinisch-deutsch - Fünfte Abtheilung S - Z «
» deutsch-latein - Erste Abtheilung A - L «
» deutsch-latein - Zweyte Abtheilung M - Z «


» Fünfter Band - Bibliographie, Quellenübersicht und Register «
Verlag: C.H. Beck

» Thesaurus Linguae Latinae «
Erfassung der gesamten Latinität von ihren Anfängen bis Isidor von Sevilla


(Lingua Historica Germanica 16)
Texte - Termini - Interpretationen
Verlag: De Gruyter
» «


Band 1 - Untersuchungen
Verlag: Walter de Gruyter
De Gruyter
» «

» Thesaurus linguae Latinae «
Schatzhaus des antiken Lateins
Bayerische Akademie der Wissenschaften

Der Thesaurus linguae Latinae ist das maßgebliche Wörterbuch des antiken Lateins: Als einziges Lexikon bezieht der Thesaurus alle überlieferten lateinischen Texte von den Anfängen bis 600 n. Chr. ein, berücksichtigt also neben der klassischen Latinität auch ausführlich die Besonderheiten der spätantiken und christlichen Texte. Untersucht werden nicht nur literarische Werke, sondern auch juristische und medizinische Gebrauchstexte, Inschriften, Graffiti und vieles mehr.

Die wissenschaftliche Zuverlässigkeit des Thesaurus konnte nicht durch die Revision bewährter Wörterbücher erreicht werden: Denn jahrhundertelang dienten Lateinlexika im Wesentlichen zur Verbesserung der aktiven Sprachbeherrschung, die nur an den besten Stilvorbildern (vor allem Cicero) geschult werden sollte. Um diese einseitige Sprachdarstellung zuverlässig korrigieren zu können, wurde ein Neubeginn nötig.

Basis des Wörterbuches ist das Zettelarchiv, wo der Schatz von rund 10 Millionen Zetteln gehütet wird: Die Texte ab dem Beginn lateinischer Schriftlichkeit bis einschließlich Apuleius (2. Hälfte des 2. Jahrhunderts n. Chr.) wurden vollständig verzettelt, jene der späteren Zeit von Spezialisten exzerpiert. Diese sinnvolle Beschränkung dämmte die Materialmenge auf ein beherrschbares Maß ein. Im Prozess der Ausarbeitung wird nun jeder Beleg für ein Stichwort hinsichtlich Bedeutung, Schreibweise, Prosodie etc. untersucht, bevor Gruppen ähnlicher Belege gebildet werden. Diese Gruppen werden nicht in Form von Listen mit Übersetzungsmöglichkeiten aneinandergereiht, sondern die Bedeutungsentwicklung wird in einem sich verästelnden Schema dargelegt. So wird die Geschichte jedes Wortes beschrieben, und zwar in der Ausgangssprache Latein.

» Allgemeine Theorie der Schönen Künste (1771) «
» Johann Georg Sulzer «

» Idiotismen (Redende Künste) «

Wiewohl dieses Wort aus der griechischen Sprache zuerst in die Lateinische und danach auch in die neueren kritischen Sprachen übergegangen ist, so hat es seine Bedeutung ganz geändert. Die lateinischen Grammatiker, die dieses Wort von dem Wort Idiota (welches einen ganz gemeinen Menschen bedeutet) abgeleitet hatten, nannten einen mit guter Überlegung gewählten, niedrigen, recht einfältigen und naiven Ausdruck, einen Idiotismus. Jetzt aber bedeutet es, das, was die Griechen und Römer durch das Wort Idioma ausdrückten; eine Redensart, einen Ausdruck oder eine Wendung, die einer Sprache so eigen ist, dass es nicht möglich ist, in einer anderen Sprache auf eine ähnliche Weise, dasselbe zu sagen. Doch kann man die Bedeutung des Wortes auch noch auf das ausdehnen, was die Sprache einzelner Menschen charakteristisches hat; das persönlich eigentümliche in der Sprache gewisser Dichter und Redner. Es gibt demnach nationale und persönliche Idiotismen. Beispiele der ersteren hat man an vielen Sprüchwörtern und Metaphern, die sich schlechterdings nicht übersetzen lassen. Wenn der gemeine Mann in Deutschland sagt: von Ort zu Ende, so kann man zwar den Sinn dieses Ausdrucks in jeder Sprache geben, aber nicht mit dem eigentümlichen desselben. Wenn ein Italiener sagt: Dall' un' all' altr' Aurora, so kann man zwar in jeder Sprache den Sinn dieser Worte angeben, aber nicht in jeder auf die Art, dass nur ein Substantivum, wie im Italienischen gebraucht werde.

Die eigentümlichen wahren Idiotismen sind bloß grammatisch und das Idiomatische liegt nicht in den Gedanken oder in den Bildern. Denn eine Metapher, die wir nur darum nicht übersetzen können, weil wir das Bild, worauf sie sich gründet nicht kennen, ist so wenig ein Idiotismus als ein griechisches Wort, dessen Bedeutung wir nicht mehr wissen. Darum muss man Ausdrücke, die ihren Grund in einem Bilde, Gebrauch oder in einer Vorstellung haben, deswegen noch nicht für Idiotismen halten, weil sie in gewissen Sprachen so häufig vorkommen, dass man sich des Grundes, worauf sie beruhen, kaum mehr bewußt ist. Bei solchen Ausdrücken, sie seien in der römischen, griechischen oder in einer morgenländischen Sprache, kommt es darauf an, ob das Bild uns bekannt sei, und, wenn dieses ist, ob es bei uns, auf der Stelle, da es vorkommt, seine Wirkung tue.

Divider


Band 4 - II. Brüder-Grimm-Symposium zur historischen Wortforschung
Verlag: de Gruyter
Herausgeber: ,

Günter Bellmann

Dem Wandel der Sprache ist üblicherweise der Wandel des Sprachverhaltens der Sprachteilnehmer vorgeordnet. Allerdings: mancher sich anbahnende Sprachwandel kommt über das Stadium des Sprachverhaltenswandels nicht hinaus, sondern begründet lediglich einen langandauernden oder überhaupt dauerhaften variativen Zustand, der durch sprachpragmatisch, sprachsozial und womöglich stilistisch unterschiedene Verwendung von Varianten gekennzeichnet ist. Beispiele dazu fallen uns sogleich aus dem Bereiche der Syntax ein, so etwa die (synthetische) Genitivform der normativen Typen der volkstümlicheren (analytischen) Genitivperiphrase. Variative Zustände dieser Art machen es der sprachhistorischen Forschung schwer, anzugeben, wann und wo ein punktueller Sprachwandel zum Abschluß gekommen ist, oder überhaupt von Wandel zu sprechen, solange statt diesem der variable Zustand dominant hervortritt.

Sprachverhaltenswandel heißt, daß die Sprachteilhaber einen anderen Gebrauch von der Sprache machen. Dieser läßt sich dann bestenfalls statistisch messen. Die Sprache selbst bleibt dieselbe. Gewandelt werden dabei hauptsächlich die Normen, die die Variantenverwendung und dann vor allem auch das Zusammentreten und die Frequenz der häufig und typischerweise gebrauchten (freien) Wortgruppen (Kollokationen) regeln, und zwar gilt dies für die Normen des mündlichen und des schriftlichen Sprachverhaltens. Sprachwandel hingegen erfaßt die Inventare und die Regelsysteme der Sprache selbst. In einem weiteren Sinne wird man dabei auch die Konstitution neuer und die Modifikation bestehender lexikalischer Felder einbeziehen müssen.

Denn wenn man nicht grammatische Elemente, sondern, wie es auf diesem Symposium geschieht, den Wortschat und dessen historische Dimension zum Thema macht, liegen die Dinge ein wenig anders. Um den wesentlichen Gedanken sogleich vorauszunehmen: Wortschaftswandel scheint gerade nicht notwendigerweise über einen langwierigen Sprachverhaltenswandel zu verlaufen. Statt dessen verschafft sich - von heut auf morgen - das aktuelle Kommunikations- und Benennungsbedürfnis der Sprachteilhaber Geltung. Mit anderen Worten: Hier spielt es keine Rolle, daß wir vermittels der Lexikoneinheiten (LE) auf die Dinge der Welt referieren, daß wir mit ihnen semantische Information (Bedeutung im engeren und im weiteren Sinne) transportieren und daß sie es sind, die uns als Vehikel, als die auditiv und/oder visuell wahrnehmbaren Stellvertreter der Begriffe, dienen. Ergibt sich durch die zivilisatorische, politische, technische oder sonstwie geartete Entwicklung eine Lücke im System der lexikalischen Mittel, so wird diese unmittelbar und ziemlich unvermittelt gefüllt, etwa nach der Regel: Null → LE. Es versteht sich, daß die Füllung lexikalischer Lücken, die Null-Substitution also, ebenfalls als eine Form des Wandels anzusehen ist. Neben dieser Erstbenennung steht als sprachliche Eins-zu-eins-Substitution die Umbenennung nach der Formel (LE)1 → (LE)2, die aus verschiedenen Gründen stattfinden kann.

Der Innovation steht als Pendant das Zurücktreten von Wortschatzeinheiten - gewissermaßen die Negativform des innovativen Wandels - gegenüber. Ich spreche absichtlich von Zurücktreten, denn eine lexikalische Einheit wird - in der Umkehrung des Innovationsprozesses - kaum jemals auf Null zurückgeführt. In der pluralistischen Gesellschaft, die zumindest von Staats wegen keinen gravierenden lexikalischen und begrifflichen Tabus unterworfen sein sollte, bleibt auch der Wortschatz von vorgestern in den Zeitungsarchiven, Lexika und Geschichtswerken sowie in anderen Formen des kollektiven Gedächtnisses erhalten und greifbar. Der Vorgang ist also nicht der einer Eliminierung, sondern vielmehr der einer Archaisierung nach der Regel: LE → (LE)Arch.

Divider

» Zur Entstehung eines Wörterbuchs der mittelalterlichen medizinischen (Fach-)sprache (2010) «
» Jörg Riecke «

Das Verzeichnis bietet insgesamt mit 359 lateinischen und 884 althochdeutschen Verwendungsweisen ein deutliches Übergewicht des Althochdeutschen. Statistisch gesehen stehen damit jeder lateinischen Bezeichnung etwa 2,4 Übersetzungsversuche gegenüber. Lässt man den seltenen lateinischen Wortschatz einmal außer Acht, der in althochdeutscher Zeit jeweils nur ein einziges Mal übersetzt worden ist, so gelangt man für den Rest der häufiger bezeugten Belege zu einem durchschnittlichen Wert von vier althochdeutschen Bezeichnungen pro lateinischem Lexem.

Auch wenn man davon ausgeht, dass in Einzelfällen vergleichbare Bildungen in anderen Einzelsprachen nur zufällig nicht überliefert sind, so ändert dies doch nichts Grundsätzliches an diesem eindeutigen Befund. Die althochdeutschen Krankheitsbezeichnungen sind fast ausnahmslos nicht alt, sie wurden erst in germanischer und vor allem althochdeutscher Zeit neu gebildet. Einen den Körperteilbezeichnungen vergleichbaren größeren Kernbestand und eine Kontinuität der schrittweisen Wissensaneignung in der Volkssprache gibt es hier nicht. Krankheiten wurden in älterer Zeit, etwa aus Gründen des Sprachtabus, in Folge einer veränderten Wahrnehmung, oder schlichtweg aus mangelnder Kenntnis, entweder gar nicht bezeichnet oder die Bezeichnung geschah unter Umständen auf eine Weise, die in christlicher Zeit nicht mehr akzeptabel erschien. Alle Sachbereiche sind durch im Althochdeutschen erstmals bezeugte Lexeme geprägt, sie sind größtenteils als Neubildungen anzusehen.

Von diesen 566 erstmals bezeugten Verwendungsweisen haben nur 60 eine Fortsetzung in neuhochdeutscher Zeit gefunden. Dies entspricht einem Anteil von 10,7 %. Allerdings sind nicht wenige dieser Lexeme heute, wie etwa wewo : Weh oder unheil : Unheil, nur noch eingeschränkt (etwa in Kopfweh, Zahnweh) oder gar nicht mehr in medizinischen Kontexten verwendbar. Der größte Teil der länger haltbaren Verwendungsweisen stammt aus dem insgesamt umfangreichsten Bereich von Wahnsinn und Besessenheit. Hier ist die Zahl der heute noch alltagssprachlich gebrauchten Bezeichnungen wie hirnwütig(hirnwuotig), Narrheit (narraheit) oder Tobsucht (tobasuht) besonders hoch. Letztlich bestätigt aber auch dieser Befund, dass die althochdeutschen Krankheitsbezeichnungen mehrheitlich nicht bis in die Neuzeit überdauert haben.

In den drei Bereichen verläuft die Entwicklung annähernd gleichartig. Die Haltbarkeit des ältesten medizinischen deutschen Wortschatzes nimmt in allen Bereichen und in allen Sprachstadien deutlich ab. Etwas stabiler ist der anatomische Wortschatz, im Bereich von Krankheit und Heilung vollzieht sich der Wortverlust etwas schneller. Im Mittelhochdeutschen sind, je nach Sachgebiet, immerhin noch 40 bis 50 % der aus dem Althochdeutschen überkommenen medizinischen Verwendungsweisen bezeugt. Im Verlauf der frühneu- und neuhochdeutschen Zeit gehen dann aber weitere 5 bis 10 % des Wortschatzes verloren. Erst in der Sprache der Gegenwart scheint die überwiegende Mehrzahl der Lexeme endgültig unterzugehen. Es bleibt schließlich nur ein Rest von ca. 20 % im Bereich des Körpers, 15 % im Bereich von Heilung und Gesundheit und sogar nur 10 % bei den Krankheitsbezeichnungen. Es zeigt sich also ein fortschreitender Wortschatzverlust, der aber, sofern die Angaben des DWB., gepaart mit der eigenen Sprachkompetenz, repräsentativ sind, erst im 20. Jahrhundert geradezu dramatische Formen annimmt. Eine jahrhundertelange Kontinuität geht schließlich zu Ende. Und auch die vergleichsweise wenigen Lexeme, die sich mit einer medizinischen Verwendungsweise bis in die Gegenwart gehalten haben, gehören nicht mehr alle dem einheimischen Fachwortschatz der Medizin an.

Divider

Anatomie

Divider

Die kulturelle Entwicklung, das körperliche Geschlecht gemäß der Neuzeit, als 'formelles Ermessungswesen' der Geschlechtlichkeit in Betracht zu ziehen, vollzieht sich zwar über die Botanik, jedoch findet die augenscheinliche Repräsentanz dessen bereits in der frühen Neuzeit im » 16. Jahrhundert « statt. Bis zu diesem Zeitpunkt war es nicht 'augenscheinlicher' Ermessungsgegenstand, sondern einzig männliche und weibliche Erscheinungsformen des Äußerlichen(den). Maßgeblich hierin ist die Unterscheidung, daß man in seinem Ursprung das Geschlechtswesen als ein Resultierendes in Betracht zog und grundsätzlich der Bezug die Ursachen des Erwirkten waren, aufgrund dessen man das Jeweilige in seiner Präsenz erfuhr. Somit war hierin auch das Ermessungswesen gegenüber den Geschlechtsorganen ein daraus Resultierendes und es drehte sich um die Männlichkeit und Weiblichkeit, zumal damit verbunden auch die Wesensart der Fortpflanzung die Grundlage dazu ausbildete. Dem gegenüber ist gerade die Anatomie ein demonstratives Muster für erneuerende Ideologie der aufkommenden Wissenschaften, worin das Jeweilige aus dem Selbst heraus seine Bestimmung und Erklärung erfährt. Hierin erfährt das Selbst eine isolierte Inbetrachtziehung, auf der Grundlage, daß aus der substanziellen Präsenz heraus die Eigenschaften hervor gehen.

In jener Zeit vollzog sich im medizinischen Verhältnis dieser Teil des grundsätzlichen kulturellen Wandels, welcher sich zumal über das damit verbundene Öffentlichkeitswesen erwirkte. Maßgeblich hierin ist, daß man selbst heute, gar nicht erkennt, wie gerade hierüber eines ins andere greift, denn was man wahrnimmt, ist der Enthusiasmus gegenüber dem Neuen, worüber Gegebenheiten in Erscheinung treten, welche man zuvor nicht kannte. Konkreter ausgedrückt, handelt es sich jedoch um ein 'derart' nicht kannte. So wurde auch das Geschlechtsorgan vorher gar nicht derart in seiner Eigenständigkeit in Augenschein genommen. Auf gravierende Weise verdeutlicht sich dies über das weibliche Geschlechtsorgan, welches bei demjenigen, welcher einst über sein Aufbringen, den stattfindenden Umschwung überhaupt erwirkt, nämlich Andreas Vesalius. Dieser hatte mit seinen erneuernden Schriftwerken vor allem auch Bildnisse geschaffen, welche in einer solchen Klarheit zuvor noch nicht existierten. Und hierin trifft man bei der Darstellung des weiblichen Geschlechtsorgans auf einen invertieren Penis. Elementar ist, daß man nämlich bis dato das weibliche Geschlecht, nicht nur auf das Körperliche bezogen, sondern generell gar nicht aus diesem selbst heraus in Betracht zog, sondern einzig das männliche Daseinswesen ergründete und daraus Rückschlüsse auf die Weiblichkeit zog. Einzig daraus ergaben sich die Bildnisse über die Weiblichkeit. Und eines dieser Bildnisse beruhte auf dem Verhältnis des herausragenden männlichen Penis gegenüber dem Gegensatz dessen beim Weiblichen. Und somit ersah man auch, in diesem spezifizierenden Bezugswesen, das Weibliche generell als ein Invertiertes des Männlichen und somit auch diesen Teil des Geschlechtsverhältnisses, gemäß dem es Vesalius das Vaginale der Frau als einen invertierten Penis darstellt.

Humanis Corporis Fabricia weiblich
» weibliches «
'invertiertes' Geschlechtsorgan
(Ausgabe 1555)

Humanis Corporis Fabricia männlich
» männliches «
Geschlechtsorgan
(Ausgabe 1555)


Erstausgabe in Basel
» «


An Annotated Translation of the 1543 and 1555 Editions
of De Humani Corporis Fabrica Libri Septem

by D.H. Garrison and M.H. Hast. Basel, Karger

A Translation of

Book V
The Origins of Nutrition and Generation

Verlag: Norman Publishing
by
Department of Classics University of Auckland
in collaboration with

Department of Anatomy University of Auckland


Verlag Georg Reimer
» «

Im Vorwort zur Fabrica übte er vehemente Kritik an Galen, der selbst nie ein Hehl daraus gemacht hatte, nur Tierkadaver seziert zu haben. Dieses sorgfältig typographisch ausgestattete Lehrbuch zeigt rund 200 zum Teil ganzseitige Illustrationen. Darin vertrat Vesal entgegen der allgemeinen Überzeugung die Ansicht, allein der menschliche Leib sei der zuverlässige Weg zur Erkenntnis des menschlichen Körperbaus. Mit seinem revolutionären Werk und der Lösung von den Lehren Galens war Vesal der Hauptbegründer der neuzeitlichen Anatomie.


Vierter Teil, S-Z, S. 1553
Hrsg.: » Christian Gottlieb Jöcher «

Vesaluis (Andreas), ein Doctor Medicina und Anatomicus, war den 30 April 1514 zu Brüssel gebohren. Er studirte zu Löven, und hatte schon in der zarten Jugend eine so grosse Lust zur Zergliederungskunst, daß er sich nicht scheuete, des Nachts allerhand Menschen-Knochen von den Gottes-Aeckern, ja so gar die Gerippe der Delingventen von Galgen und Rade herab zu holen, bekam aber dieserwegen das Consilium ebeundi, gieng also von hier nach Paris. An 1537 wurde er Professor Anatomices zu Padua, und machte sich durch seine Wissenschaften in der Anatomie sehr berühmt. Hernach wurde er verschiedener grosser Herren, sonderlich Caroli V und Philippi II Leib-Medicus, hatte eine Xantippe zum Weibe, reisete endlich vermöge eines gethanen Gelübdes nach Jerusalem, und wurde in der Rückreise, auf die Insel Zante verschlagen, woselbst er 1564 den 15, Oct. in elendem Zusande starb. Thuanus erzehlet, daß der Maximiliano von Egmont, Gragen von Buren in Gelderland, den Tag und die Stunde seines Todes zuvor gesagt, welches auch richtig eingetroffen. Seine Schrifften sind de humani corporis fabricia libb. 7, so er im 28sten Jahre geschrieben; eorundem eptome, welches rare Buch Mic. Fontanus 1642 mit Anmerckungen zu Amsterdam edirt, Alb. Corinus aber 1543 ins Deutsche übersetzt; anatomicarum Gabrielis Fallopii observationum examen; Epistola docens venam axillarem dextri cubiti in dolore laterali secandam; de radice chinae epistols; paraphrasis in librum IX Rhazae ad regem Almansorem de affectuum singularum corporis partium curatione; Consilium pro Terrae-novae ducis sistula; consilium pro visu partim depravato parim abolitio; de arthiritide consilis; chirugia magna in 7 libros digesta, die Prosper Borgarutius 1569 verbessert heraus gegeben; exercitat. de-ossibus ad Galeni doctrinam; emendationes ad Jo. Guinteri institutiones anatomicas; de loxo incidendae venae in pleuritide; de venarum arteriarumque sectione; verbesserte auch die Uebersetzung einiger Bücher des Galeni; Consilia medica. Seine versprochene anatomia practica ist so wenig, als sein Tractat des formatione fortus zu Vorschein gekommen. Er hat übrigens nebst dem Alb. Corino und Gerh. Toletano unterschieene Wercke des Rhazis aus dem Arabischen ins Lateinische übersetzet, die zu Basel 1544 in folio unter dem Titel Rbaza opera exquisitiora gedruckt worden. Ob ihn Mic. Massa mit Recht eines Plagii beschuldigt, ist noch nicht ausgemacht. Die Ursache seiner Wallfahrt nach dem gelobten Lande soll diese gewest seyn: Es war in Spanien ein vornehmer Herr, bey dem er curirt hatte, nach seiner und anderer Einbildung gestorben. Weil er nun gern die Ursache des Todes wissen wolte, bat er um Erlaubnis den Körper zu seciren, fand aber, als er ihn öffnete, daß das Herze noch schlug; daher er von dessen Freunden vor der Inquisition als ein Mörder angeklagt wurde, und auf den Scheiter-Haufen solte gesetzt werden. Allein der König brachte es durch viel Mühe dahin, daß die Straffe auf diese Weise mitigirt wurde : wiewohl andere die ganze Sache leugnen. Seine sämtlichen Schrifften haben Boerhave und Albinus 1725 zu Leiden sehr schön, nebst Vesalii Lebens.Beschreibung heraus gegeben.


Janus - Archives Internationales
pour l'Historie de la Médicine
et la Géographie Médicale

F. M. G. de Feyfer

Die Schriften des Andreas Vesalius Grafik
» Iconographische Tafel «
Reproduktionen und Verbreitung seiner Werke

In Valverde's Ausgaben der Übersetzungen von Vesalius' Werken hingegen, trifft man auf die Auslassung der Darstellung dieser Invertiertheit, wohingegen man in der lateinischen Übersetzung seines Werkes dieses Bildnis hingegen wiederum einbringt, was jedoch nicht von diesem selbst stammt. Maßgeblich hierin ist, daß die Spezifikation der weiblichen Anatomie, wie auch in seiner Unterscheidung zur Männlichen, zu jener Zeit überhaupt erst zu seiner effektiven augenscheinlichen Ergründung gelangte, während vor allem das Weibliche, gemäß der antreffenden Bildnisses darüber, maßgeblich noch über die althergebrachten Ideologien ausgeprägt waren. Gerade dies demonstrieren diese Verbildlichungen und Hervorheben das weibliche invertierte Geschlechtsorgans, denn die tatsächlich Ergründung war noch gar nicht vollzogen und stand überhaupt erst noch aus und gerade darüber ergaben sich auch die aufreibendsten Auseinandersetzungen, in der Ergründung dessen, wie es sich denn tatsächlich verhält, mit dieser neu auftretenden anatomischen Bildnisse. Darin bestand auch der Grundsatz des Gegenübertretens gegenüber dem Althergebrachten, nämlich in dem Zerwürfnis, welcher sich darüber zwangsläufig darüber einstellte. Maßgeblich ist somit auch hierin, daß sich über diese isolierten Ausschnittsbetrachtungen, was es gegenüber dem Alten ist, ein völlig anderes Erscheinungsbildnis ergibt und selbst wenn dies augenscheinlich zu ersichten ist, doch die Vorstellung darüber erst einmal seiner Ausbildung bedingt, um es als solche wiederzugeben. Gerade dies spiegelt sich in den folgenden Entwicklungen vor allem über das weibliche Geschlechtsorgan wieder, worüber reichlich Auseinandersetzungen darüber stattfanden, wie es sich denn tatsächlich damit verhalten würde. So ist denn auch die Folgezeit zunächst einmal recht fragil, was die diversen Aufbringungen hervorbringen, dem gegenüber jedoch ein wesentliches Handikap der Anatomie entgegen steht, nämlich daß ihr Grundstock der Ergründung tote Leiber sind und diese entbehren nun einmal ein wesentliches: das Leben. Es ist eine Sache, darüber den Knochenbau zu ergründen, jedoch ein ganz anderer Sachverhalt, ein lebendiges Gewebe darüber zu ergründen, welches überhaupt erst 'in seiner Lebendigkeit Erfüllung' wahrlich in Erscheinung tritt.

Anatome_corporis_humani-männlich (Hamusco)Anatome_corporis_humani-weiblich (Hamusco)
links » männliches «, rechts » weibliches «
'invertiertes' Geschlechtsorgan
(lateinische Ausgabe 1607)


Vierter Teil, S-Z, S. 1437
Hrsg.: » Christian Gottlieb Jöcher «

Valverde (Johnnes), ein spanischer Medicus im 16 Seculo, wird gemeiniglich de Amuseo, oder im Lateinischen Hamuscenus beygenannt, weil er an einem Orte dieses Nahmens in der Diöces von Palencia in Alt-Castilien gebohren war. Weil er von dem Cardinal Johanne von Colet zum Leib-Medico erwehlet worden, folgte er demselbigen nach Rom, wo er sich mit vielem Eifer der Anatomie befliß. Als er von dannen zurück nach Spanien kam, und dieser Wissenschaft auch gern in seinem Vaterlande aufhelfen wolte, erklärte er anfänglich des Vesalii Anatomie einigen Studierenden, befand aber hernach, daß solches Werck vor Anfänger zu schwer sey, und verfertigte deswegen selber einen Tractat de compositione corporis humani, den er erst in spanischer Sprache 1556, nachhero aber auch in seiner eigenen italiänischen Uebersetzung 1560 zu Rom drucken ließ, und den Realdus Columbus, des Valverda Lehrmeister in der Anatomie so hoch ästimirte, daß er selbst nach einiger Zeit eine lateinische Uebersetzung davon verfertigte, die zu Venedig 1589 in folio heraus gekommen.


Verlag: Routledge

In den spanisch/kastillischen und italienischen Werken von Valverde ist die weibliche Darstellung des invertierten Geschlechts nicht enhalten. Auch nicht in der niederländischen Version, jedoch in der lateinischen Version des Buchdruckers (ursprünglich Buchbinder) » Christoph Plantin «.


spanisch/kastilisch - Erstausgabe 1556 - Rom


italienisch - Erstausgabe 1559
In Venetia - nella stamperia de Giunti


lateinisch - Erstausgabe 1566
Hrsg.: Christopheri Plantini


niederländisch - Erstausgabe 1568
Hrsg.: Christoffel Plantinijy

» Plantin-Moretus Museum «

Und somit wird dies vor allem jedoch zu einem Schauspiel des Sensationellen, um darüber die Popularität zu erlangen, welche die Entwicklungen fördern. Vaselius ist hierin formaler Wegbereiter, nicht nur in seinen publizierenden Kunstwerken, sondern auch in seinem künstlerisch inszenzierenden Handeln. Zwar führt dies, nicht unerwartet, zu vielfältigen Auseinandersetzungen, vor allem auch über die kollegialen Übereinkünfte und nicht nur, was die anatomischen Kenntnisse betrifft, jedoch bildet gerade auch dies einen wesentlichen Beitrag zur Ausbreitung der beschäftigenden Aktivitäten. Und so erkennt man auch, daß hierin die Übertriebenheit, nicht nur, aber vor allem über die Bildnisse, ihre demonstrative zur-Schau-Stellung erfahren. Es stellt dar, was es zu erlangen gilt und doch nicht das Tatsächliche ist, wie es gegeben ist. Es entwickelte sich jedoch in Folge dessen auch zunächst derart, wie es Vesalius gemäß seiner Bildnis vorausschickte. Die anatomischen Veranstaltungen wurden sogar öffentlich zugänglich gemacht, um dafür Sorge zu tragen, das die Bildnisse sich auch erfüllen, welche man geprägt hatte. Es wurde zu wahren Inszenarien an Showdarstellungen. Eindeutigerweise ging es Vaselius darum, daß dieser Entwicklung ihr wahrer Wert entsprechend ermessen wird und dies gelang ihm auch auf eindrucksvolle Weise. Es gab viele Nachahmer, welche in seine Fußstapfen traten und brachte den Motor auch entsprechend zum Laufen.

public domain from https://commons.wikimedia.org/wiki/File:Fabrica_title_pg_UMich_frc.png
Titelbild von Andreas Vesalius'
De humani corporis fabrica libri septem
Erstausgabe 1543

» Die frühe Baseler Anatomie (2010) «
» Auszug der Universität Basel «
» Michael Stolberg «

Für die Entwicklung der frühneuzeitlichen Medizin und Naturwissenschaft ist die Anatomie von überragender Bedeutung. Zusammen mit der Botanik wertete sie die empirische Beobachtung zum vorherrschenden erkenntnistheoretischen Ideal auf. Dabei half sie, so manchen «Irrtum» der überlieferten, vielfach auf Tiersektionen gegründeten Anatomie zu korrigieren. Doch diese Korrekturen betrafen mit wenigen Ausnahmen Details: Das Wissen um die einzelnen anatomischen Strukturen des Menschen veränderte und differenzierte sich zunächst nur geringfügig.

Für die medizinische Praxis war das neue Wissen zunächst wenig bedeutsam. Die zahlreichen inneren Krankheiten, mit denen sich die akademisch gebildeten Ärzte befassten, wurden vor allem auf krankhaft veränderte bewegliche Säfte und Dünste im Körper zurückgeführt, nicht auf Veränderungen der einzelnen Organe, Gewebe oder Zellen. Für die grobe Lokalisierung und gegebenenfalls gezielte Entleerung solcher Säfte und Dünste reichte ein ungefähres Wissen über die Lage der einzelnen Organe im menschlichen Körper völlig aus.

Die neue, auf persönliche «Autopsie» gestützte Anatomie zeigte jedoch die Möglichkeit und Notwendigkeit, die überkommenen Lehren der Autoritäten kritisch zu hinterfragen und zu korrigieren. Die Anatomie eröffnete für die Ärzte zudem ganz neue Möglichkeiten der professionellen Selbstdarstellung. Lange hatten sie ihren Anspruch, die geheimnisvollen Vorgänge im Körperinneren ihrer Patienten ergründen zu können, vor allem auf ihre Fähigkeiten in der sogenannten Harnschau gegründet, dem überragenden Diagnoseverfahren der mittelalterlichen Medizin. Doch hier waren sie zunehmend gegenüber den ungelernten Heilern ins Hintertreffen geraten. Die öffentlichkeitswirksame Inszenierung anatomischer Kenntnisse war dagegen weitgehend den studierten Ärzten vorbehalten.

1543 erschienen in Basel die «De humani corporis fabrica libri septem» von Andreas Vesal (1514-1564), dem Begründer der neuzeitlichen Anatomie. In dem opulent aufgemachten und illustrierten Werk zeigte der Autor anhand von zahlreichen eigenen Sektionen diverse frühere «Irrtümer» auf. Vesal wurde zur Ikone der neuen Anatomie. Er kam 1542 nach Basel und schrieb sich an der Universität ein. Es ist nicht sicher, ob er aktiv am universitären Leben teilnahm und Vorlesungen hielt, verbürgt ist aber, dass er im Mai 1543 die Leiche des hingerichteten Jacob Karrer aus dem Elsass sezierte und das präparierte Skelett der Universität schenkte. Dieses war hier lange aufgestellt und ist bis heute im Anatomischen Museum erhalten.

Entscheidend für den Aufstieg der Basler Medizinischen Fakultät seit den 1570er-Jahren waren zwei führende Anatomen: Felix Platter (1536-1614) und Caspar Bauhin (1560-1624). Sie hatten im Süden Europas studiert, wo sich schon seit Längerem das Bemühen um eine mehr empirische, auf persönliche Erfahrung gestützte Ausbildung durchgesetzt hatte, in der Anatomie wie auch am Krankenbett. Dies war damals Hauptmotiv für viele Medizinstudenten von nördlich der Alpen, zumindest einen Teil ihres Studiums an den grossen Universitäten des Südens zu absolvieren.

Auch der Platter-Schüler Caspar Bauhin studierte im Ausland, so in Padua, wo er bei öffentlichen Sektionen zusah und selbst dabei mitwirkte. Nach seiner Rückkehr nach Basel übernahm er 1582 zunächst die Professur für Griechische Sprache, begann aber bald öffentliche Sektionen abzuhalten und führte einen anatomischen Demonstrationskurs durch. 1589 wurde ihm die neu geschaffene Professur für Anatomie und Botanik verliehen, und im selben Jahr richtete man im Unteren Collegium ein ständiges » anatomisches Theater « ein. Die Anatomie war damit in Basel fest institutionalisiert.

Als anatomischer Schriftsteller trat Bauhin sehr ausgedehnt in Erscheinung. Schon seine «Anatomica corporis virilis et muliebris historia» erlebte mehrere Auflagen. Am bekanntesten wurde er durch sein umfangreiches «Theatrum anatomicum» von 1605. Mit über 1300 Seiten, weit über 100 Abbildungen, zahllosen Belegstellen aus der älteren und jüngeren Literatur, einem ausführlichen Index und Erklärungstafeln bot es, in Albrecht Burckhardts Worten, «das erste handliche und doch vollständige Lehrbuch der Anatomie».

Im Nachfolgenden einmal eine ausschnitthafte Beschreibung der stattgefundenen Auseinandersetzungen von Schober. Tatsächlich kommen nämlich die erforderlichen Inputs nicht von den Anatomen selbst zustande, sondern zunächst anderweitig über die Beschäftigung mit Hermaphroditen, hingegen gelangt dies darüber zu konkretisierenden Auseinandersetzenden, indem man darüber die diversen Details austauscht. Das man sich hierin gar darüber streitet, wer als erster die Klitoris als solche überhaupt entdeckt hat, gehört wie so vieles darüber sich Verbreitenden, zu den Anekdoten der Geschichte, denn diese war in keiner Weise unbekannt, sondern im Gegenteil, hat überhaupt erst über deren isolierte Eigenständigkeit der Neuerung dazu beigetragen, daß sie überhaupt derart ins Unbekannte geriet. Die Kliteros erfährt nämlich seit Urzeiten in vielen Kulturen ihre ganz besondere Aufmerksamkeit, was man vor allem über die Beschneidungsriten erfährt, sowie auch das Verhältniswesen zu den Hermaphroditen. Gerade in diesen Bezügen fand nämlich sehr wohl, gegenüber dem, was man als regulär erachtet, eine konkretes in-Augenschein-nehmen der Geschlechtsorgane und so auch der Klitoris statt. Was hingegen als Neuheit in Erscheinung tritt, ist hingegen die spezifizierende und vereinheitlichende Bezeichnung 'Clitoris'. Nicht nur in den anatomischen Verhältnis bezieht man sich jedoch einzig auf die griechischen und römischen Ursprünge und gerade darin trifft man solche Inbetrachtziehung auch einzig in Ausnahmefällen an, sodaß es sich dem gegenüber auch als regläre Erneuerung stellt. Wesentlich hierbei ist jedoch, daß man gerade hierüber zum Verhältniswesen des weiblichen Penis gelangte, gemäß dem sich dieses Organ nämlich repräsentiert. Betrachtet man sich hierzu die daraus resultierende Darstellung von Bartholin, so erfährt dies darüber auch seine ersichtliche Deutlichkeit. Wie man dem entnehmen kann, gestaltet sich dem gemäß auch nicht mehr das Erscheinungsbildnis über die Vorstellung, sondern man geht dazu über, aus dem Ersichtlichen heraus die Vorstellungen zu erneuern und dem anzupassen. Auch dies beruht auf den Neuerungen, welche auf dem wissenschaftlichen Prinzip beruht, nämlich die Gegebenheiten dem gemäß wiederzugeben, wie sie sich 'augenscheinlich' darbieten. Nicht die Ideologie der Vorstellungswelt ist hierin das Maß der Inbetrachtziehung, sondern die Ideologie der Vorstellungswelt über das Augenscheinliche.

Thomae_Bartholini_01.jpg
Thomae_Bartholini_02.jpg
Thomas Bartholin
Anatomia (1655)


enthält keine Zeichnungen
» «

De Mulierium partibus generationi dicatis (1597)
-

enthält keine Zeichnungen
Verlag: Ludovici König
» «
-
Observationes: Krankheitsbeobachtungen in drei Büchern (1963)
Verlag: H. Hubert
Aus dem Lateinischen übersetzt von Günther Goldschmidt
bearbeitet und herausgegeben von Heinrich Buess
-
Felix Platters "Observationes" (2003)
Verlag: Schwabe
Katharina Huber


» Anatomes (1591) «
» Anatomica corporis virilis et muliebris historia (1597) «

monstrosorumque partuum natura
Verlag: de Bry
» «


Caput XXXIV - De Clitoride (S. 167)
Zeichnungen von Vesal: S. 125,127,153,158
» «


historia epistola anatomica
enthält keine Zeichnungen
» «


ex Caspari Bartholini Parentis Institutionibus
Zeichnungen siehe rechts
» «

» De Re Anatomica Libri XV (1659) «
enthält keine Zeichnungen
» Realdus Columbus «

» Rufus von Ephesus «

Divider


Mediziner in Basel um 1600
Campus Verlag
» «


L'Homme - Europäische Zeitschrift für
Feministische Geschichtswissenschaft
(01/18)
Institut für Geschichte - Universität Wien
» «

Die erste bekannte frühneuzeitliche Erwähnung der Klitoris findet sich in Erasmus 'Adagien', einer Sammlung antiker Sprichwörter und Redewendungen. Die Textstelle nimmt das Verb kleitoriazein in den Blick:

"Κλειτοριάζειν Vulgato conuitio dicebantur ij, qui puerorum amoribus oblectarentur, aut, ut ait Diogenianus, mulieres immodice lbidinosae."

Das griechische Verb bezeichne demnach unzüchtige sexuelle Praktiken - zwischen Männern oder von Frauen. In späteren Ausgaben wird dies in der Erklärung mit einer vagen, auf Hesychius und Suidas basierenden Vorstellung von einem weiblichen Körperteil und dessen Reibung verknüpft. In der Basler Ausgabe der 'Adagien' von 1513 allerdings gelang es Ersasmus noch nicht, sich einen Reim auf das antike Sprichwort zu machen - sein scheitender Erklärungsversich zeigt deutlich, dass ihm die Klitoris noch unbekannt war.

Auch dreißig Jahre später bot das wohl berühmteste anatomisch Werk der Frühen Neuzeit keine weiterführenden Informationen. Andreas Vesal (1514-1564) erwähnte in seiner in Basel 1543 erschienenen 'Fabricia' den Körperteil mit keinem Wort. die anatomische Karriere der frühneuzeitlichen Klistoris begann vielmehr nur wenig später in Italien, mit den beiden kurz hintereinander publizierten Werken von Realdo Colombo (1516-1559) und Gabrielle Fallopio (1523-1562). Während sich die Mitglieder der res publica litteraria noch darüber stritten, wem die Ehre der Entdeckung des Organs gebührte oder ob es sich nicht doch um seit der Antike bekanntes Wissen handelte, setzte sich Vesal in einer ausführlichen Antwort auf Fallopio mit den Thesen seines Schülers auseinander. Diese Antwort ist aufschlussreich in Bezug auf den zentralen Aspekt des frühneuzeitlichen Klitiorisdiskurses - die Frage nach der Funktion des Körperteils. Vesal degradierte hier nämlich die Beobachtung Falloppios vom allgemeinen Fall zum nur in wenigen Fällen auftretenden Spiel der Natur (naturae lusum) - zumal bei Hermaphroditen. Es würde sich lediglich um einen Auswuchs ohne Funktion handeln. Damit wurde die Klitoris in Vesals Replik zum Bestandteil des frühneuzeitlichen grotesken Körpers, wie ihn Michail Bachtin beschrieb. Der groteske Körper bestand aus funktionslosen oder ihrer Funktion entfremdeten, nach außen drängenden Auswüchsen. Der anatomische Körper Vesals setzte dem den nur über den anatomisierenden Schnitt und die Beobachtung des Anatomen erschließenden 'inneren Körper' entgegen. Dieser zeichnete sich dadurch aus, dass jedem Körperteil, das eben kein bloßes Spiel der Natur, kein 'lusus naturae' war, eine Funktion für das Körperganze zukam. Vesal wollte dezidiert keine reinen Äußerlichkeiten beschreiben und nichts, das keine allgemeinere Funktion hatte.

Vesals Antwort auf Fallopio konnte nicht verhindern, dass sich vor allem in Frankreich eine aufgeregte Diskussion entwickelte, an der sich einige der heute bekanntesten Autoren der Zeit beteiligten, etwa auch Ambroise Paré (um 1510-1614). Die Inhalte waren gesellschaftlich brisant und reichten von der Faszination angesichts der Lokalisierbarkeit der weiblichen Lust bis hin zu Forderungen nach umfangreichen Klitoridektomien - als Genitalverstümmelungen.

In den 1580ern und 1590ern erreichte das Thema Basel. Es fand Aufnahme in die Publikationen der beiden Ärzte und Universitätsprofessoren Felix Platter (1536-1614) und Capar Bauhin. Vermutlich waren beide dem entsprechenden Wissen während ihrer Studien in Padua und Montpellier begegnet, wo mit Gabriele Fallopio und André du Laurens wichtige Protagonisten des Klitorisdiskurses lehrten. Zurück in Basel integrierte Platter die Klitoris in die Abbildung der weiblichen Geschlechtsteile, die er von Vesal übernahm - und um eine deutlich detailliertere Darstellung der Vulva ergänzte. bauhin beschäftigte sich seit 1590 in mehreren anatomischen Publikationen mit der Klitoris und übernahm dabei auch die Abbildungen seines Kollegen. Die Textstellen zur Klitoris in Bauhins Werken ähneln einander sehr, sind jedoch unterschiedlich ausführlich. In der nachfolgenden Darstellung von Bauhins Argumentation habe ich daher seine verschiedenen Publikationen im Blick, konzentriere mich aber auf das 'Theatrum anatonicum' von 1605. Dieses Werk ist nicht nur inhaltlich am umfangreichsten und am gründlichsten in der Zitation seiner Quellen, sondern war auch in der Folge Bauhins einflussreichste anatomische Publikation.

Bei seiner Darstellung der Klitoris zelebrierte Bauhin sein gegenüber Vesal deutlich erweitertes Wissen richtiggehend. Im ersten Satz in der Randzeile, in welcher Bauhin sorgfältig seine Quellen auflistete, konstatierte er umgehend, dass die Klitoris bei Vesal fehle: 'Vesal de Clitoride nil habet'. Bei der Aufnahme der Klitoris in Bauhins umfassendes anatomisches Kompendium ging es allerdings um deutlich mehr als lediglich um einen Seitenhieb auf Vesal. Im Gegensatz zu Vesal erkannte Bauhin die Klitoris als Körperteil an und integrierte sie als solches in das von ihm im 'Theatrum anatonicum' definierte anatomische Standardwissen der Zeit. Für Bauhin war die Klitoris ganz klar 'membrum' - ein in der Anatomie zu beschreibender Teil des menschlichen Körpers.

Dadurch, dass Bauhin im 'Theatrum anatonicum' auf den ersten Blick kaum deutliche und eigenständige Bewertungen und Präferenzierungen anbot, sondern Wissen von anderen Autoren zusammenfügte, liegt hier ein zunächst merkwürdig diffus und widersprüchlich anmutendes Konglomerat vor. In Bauhins Klitorisdarstellung kreuzen sich Partikel verschiedenster Diskurse von weiblicher Lust, misogyner Zurücksetzung, Befriedigung und (männlichen) Ängsten. Bauhin sprach wie Fallopio vom 'obszünen griechischen Verb' als Herkunft des Wortes Klitoris, vom 'weiblichen Penis', aber erwähnte auch Colombos überschwängliche Bezeichnung 'dulcedo amoris'. Er rief den zeitgenössisch ebenso faszinierenden wie Ängste auslösenden Tops afrikanischer Tribaden, Frauen mit vergrößerter Klitoris, denen homoerotische Praktiken und die Fähigkeit der Befriedigung anderer Frauen zugeschrieben wurde, ebenso auf wie die Bezeichnung 'contemptum virorum' - 'Verachtung der Männer'. Die Klitoris besitze Öffnung und Vorhaut, aber keinen Durchgang, könne anwachsen, reagiere auf Berührung und setze Imaginationen in Gang. Aus der Fülle von frühneuzeitlichen Klitorisbedeutungen und -zuschreibungen, die etwa James Steintrager in seinem Beitrag zur Klitoris zusammengetragen hat, fehlt in Bauhins Darstllung kaum ein Detail. Lediglich die Schutzfunktion der inneren Geschlechtsteile etwa vor Luftzug, wurde bei Bauhin statt der Klitoris differenzierter den Schamlippen zugeordnet.

Am auffälligsten ist seine in der Forschung ja durchaus nicht unbemerkt gebliebene Hervorhebung der Bezeichnung 'penis' oder 'virga muliebris'. In der Reihe der zeitgenössischen Klitorisbezeichnungen strich er diese heraus, indem er sie mit dem Adverb 'proprie' versah. Außerdem beschäftigte ersich damit in der Folge viel ausführlicher als mit den anderen Bezeichnungen wie 'albathara', 'klitoris' oder 'tentigo'. bauhin nutzte so die in der Zeit häufig verwendete Möglichkeit, Körper über Analogisierungen zu beschreiben. Dies diente jedoch einem Zweck. Es ging ihm nämlich nicht einfach um eine Gleichsetzung von männlichen und weiblichen Geschlechtsteilen im Sinne des 'one sex models'. Er betonte sowohl Ähnlichkeiten wie Unterschiede (um Beispiel, dass die Klitoris deutlich kürzer sei als der Penis, nämlich laut seinen Kollegen Platter die länge eines Kaninchenpenis habe). Die Analogisierung ermöglichte es ihm, seine zentrale Aussage für den männlichen Leser verständlicher zu machen - und zugleich die 'Organisierung' der Klitoris als konstitutives membrum des Körperganzen zu unterstreichen. Indem er die Klitoris als ein dem Penis analoges Organ einführte, bereitete Bauhin nämlich den Kern seiner Ausführungen vor: Viel wichtiger als eine ähnliche Lokalisierung oder Form war für ihn die korrespondierende Funktion der Klitoris - das Auslösen des Samenergusses.

Die Analogie zum Penis, oder genauer zum Frenulum, wie im eingangs angeführten Zitat, betonte also nicht die Gleichheit der Körperteile, sondern diente als Verständnishilfe, um die Funktion zu begreifen und damit die Klitoris zu einem eigenständigen 'Organ' des weiblichen Körpers zu erklären. Letztlich schrieb Bauhin die größte Bedeutung weder der Klitoris noch dem Penis zu - sondern den für die Prokreation als nötig erachteten Flüssigkeiten.

Was die Geschichte, wie überhaupt das Verhältnis der Anatomie betrifft, so gilt es sich zu verdeutlichen, daß es eine solche für sich beanspruchende, wie man es im Nachfolgenden antrifft, gar nicht existiert, sondern die anatomischen Kenntnisse regulär über diverse Bezugsverhältnisse zustande kommen. Hierin ist das Gemeinsame die Anatomie des menschlichen Körpers, jedoch nicht die der Inbetrachtziehung, worüber es erlangt wird. Vor allem ist im althergekommenen Bezugsverhältnis der Körper selbst weitläufig gar nicht der eigentliche Inbetrachtziehungsgegenstand, aus dem heraus die Abbildungen stammen. Gerade diese Relationsverhältnisse werden infolge des wissenschaftlichen Werkens in einen Topf geworfen und und als 'wissenschaftliche Vorläufer ausgegeben und führen gerade darüber zu gänzlichen Mißverständnissen über die jeweiligen Sachstände. Vor allem ergibt sich daraus auch gar kein tatsächliches Ersichten der Ursprünge. So ist auch Vesal(ius) in keiner Weise der Grundsteinleger zur Ergründung der menschlichen Anatomie, sondern einzig der erneuernden wissenschaftsideologisierten Anatomie. Zumal das Verhältnis der Ärzteschaft hin zur Medizin dazu in Betracht zu ziehen ist, welches in den wissenschaftlichen Neuerungen gleichermaßen ein völlig neues Bezugswesen aufbringt, welches sich in keiner Weise in eine Reihe stellen läßt mit dem Alten. Die substanzierenden Grundlagen sind völlig andere, was sich vor allem jedoch über das Verhältniswesen der Philosophie gegenüber der Naturwissenschaft darlegt und wie zuvor beschrieben, auch über das markante substanzielle Differenzierungswesen, welches sich sprachtechnisch über das Geschlecht darlegt. Wie sich gerade über die heutige Gegenwart zwischenzeitlich aufweist, ist beides in keiner Weise miteinander vereinbar. Gravierend ist jedoch in dem Bezug, daß man die Geschichte über diese Handhabe der Darlegung des angeblich Einen, gänzlich verändernd umschreibt. Auch hierin trifft man somit auch auf den immer wiederkehrenden Mechanismus, daß man rückwirkend auf das Vormalige einwirkt, sodaß dies selbst darüber gar nicht nur nicht in Erscheinung tritt, sondern in ein ganz anderen Daseins daraus sich erwirkt.


De l'Imprimerie de D. F. Levrault
» «
Dr. en Médicine et Professeur d`Anatomie à Strasbourg

Beschreibung:
» Medicinisch-chirugische Zeitung (1818) «
zweiter Band - S. 43

Der Hr. Verf. füllt mit der Unternehmung dieses Werkes eine Lücke in der Geschichte der menschlichen Kenntnisse aus. Goelicke und Portal haben zwar eine Geschichte der Anatomen, aber nicht der Anatomie geliefert, Lassus begnügte sich, die verschiedenen Epochen der Entdeckungen in dieser Wissenschaft aufzustellen, und Schulze, Leclerc, Freind, Dujardin, Peyrilhe und Sprengel befaßten sich in der Geschichte der Medicin und der Chirugie nur gelegentlich und im allgemeinen mit derselben.

Die Einleitung handelt den Ursprung der Anatomie ab.

I. Buch. Anatomie der Aegypter. Literatur. Einbalsamierung. Skelette.

II. Buch. Anatomie der griechischen Philosophen, historisch und biographisch. Anaxagoras, Democrit, Empedocles, Alcmeon.

III. Buch. Anatomie der Asklepiaden. Allgemeine Geschichte derselben. Im Tempel von Cos fand keine Anatomie statt. Anatomie des Hippokrates und seiner Zeitgenossen. Grundsätze zur Beurteilung derselben. Anatomie des Aristoteles und seiner Zeitgenossen. Besondere Geschichte der Anatomie der Asklepiaden, den verschiedenen Distincten, organischen Systemen und Gebilden nach. Ein besonderer Abschnitt am Schlusse dieses Buches zur Biographie des Hippokrates, Diocles, Aristoteles und Protagoras.

IV. Buch. Anatomie der Alexandrinischen Schule. Allgemeine Geschichte derselben zu Alexandrien und in Italien. Besondere Geschichte derselben in der Osteologie, Myologie u.s.w. Biographischer Abschnitt. Zerophilus, Eudemus, Erasistratus, Celsus, Soranus, Moschion, Rufus, Marinus, Quintus, Lycus, Aelianus, Pelops, Salyrus.

V. Buch. Erster Abschnitt. Anatomie des Galenus. Leben und Charakter desselben. Anatomische Schriften des Galen's. Dessen Anatomie der Thiere, menschlicher Leichnahme, und des Affen, dessen Structur er mit der des Menschen übereinstimmend hält. (Der Verf. macht hier mit Recht die Bemerkung, daß es unbegreiflich sey, wie Galen, welcher über alle Theile der Arzneywissenschaft so viel schrieb, noch Zeit zu Zergliederungsen einer bedeutenden Anzahl der verschiedensten Thiere fand. Er zergliederte auch einen Elephanten.). Pathologische Anatomie Galen's. Besondere Anatomie der organischen Systeme und Gebilde. Anatomie der Schwangern und des Fötus. Zweyter Abschn. Nachfolger des Galen's unter den Griechen. Historischer Theil, welcher die pathologische Anatomie begreift, und biographischer Theil über Oribases, Meletius, Theophilus, Aetius, Vegetius, und über die dem Galen zugeschriebenen Werke. Dritter Abschn. Die Araber. historisch und biographisch. Rhazes, Avicienna, Albucasis, Averrhoes. Vierter Abschn. Anatomie im Mittelalter. Parallele zwischen diesem und dem Alterthum. Ursprung der Universitäten. Erste Versuche zur Wiederherstellung der Wissenschaften. Hindernisse für die Cultur der Anatomie. Biographie von Constantin, Royer, Galicetti, Lanfranchi, Mondini, Guy de Chauliac, de Gradi, Zerbis. Fünfter Abschn. Wiederherstellung der Wissenschaften. Allgemeine und besondere Geschichte der Anatomie in dieser Periode. Biographie von Achillini, Benedetti, Berenger, Massa, Sylvius, Günther, Fernel, Etienne, und Angabe einiger minder bedeutenden Schriftsteller, z. E. Gersdorf, Riff, Le Vasseur, Oryander u.s.w.

VI. Buch. Anatomie der italienischen Schule. Vesal legt den ersten Grund zur Anatomie des Menschen. Oeffentliche Anstalten. Anatomische Abbildungen. Vergleichende Anatomie. Pathologische Anatomie. Besondere Geschichte der italienischen Schule in der Anatomie der einzelnen organischen Systeme, und Gebilde, in den verschiedenen Entwicklungsstufen u.s.w. Im biographischen Theile kommt von italienischen Anatomen das Leben des Vesal, Columbus, Fallopius, Eustach, Vidius, Valverde, Ingrassias, Canani, Aldrovandus, Piecolhomini, Arantius, Fabricius, Varol, Casserius, Jasolinus, Licetus, Spiegel; von deutschen das Leben von Fuchs, Coiter, Schenk, Plater, Alberti, Bauhin und F. R. Salzmann; von französischen das Leben von Rondelet, Delaurens, Cabrol, Pineau, Botall; von holländischen das Leben von Bontius, Zeurnius, Paaw; von dänischen das Leben von Bartholin.

Wie es sich mit der Anatomie als solches verhält, erfährt man über die Gegenwart, zumal über die Präsenz Gunther von Hagens' Körperwelten. Was kaum jemanden bekannt ist, ist der Umstand, daß seine Intension einst darüber entstand, daß dieser sich in seinem Medizinstudium mit Plastikpuppen als Lehrmaterial konfrontiert sah, die sich diesem Studium gegenüber regelrecht als vorsinnflutlich erweisen. Seine Intension hat sich, wie sich aufzeigt, nach wie vor nicht geändert, jedoch hat sich gerade dieser Bezug bisher nur vereinzelt umsetzen können, um Zeitgemäßes als wissenschaftliche Lehrexponate zu etablieren. Der Punkt ist jedoch und dies wurde auch eindeutig Vesalius einst nicht klar, daß es regulär doch gar nicht die Ärzte und Anatomen sind, welche in diesem Lehrbetrieb ausbilden. Die Lehrkörper haben regulär gar keinen Bezug zur Praxis, zumal alle miteinander der Vorbedingung dieser Ausbildung unterliegen. Wie kann sich somit hierin das Pragmatikertum überhaupt einbringen und umsetzen? Nämlich in dem Konstrukt in keiner Weise, da es hierüber nämlich aus seinem Grundsatz heraus außen vor gestellt wird, räumlich, sachlich, wie personell auf der Trennung basiert. So gelangt ein Pragmatiker auch überhaupt nicht dort hinein und darauf basiert es auch, daß man pragmatische Exponate auch daraus fern hält. Die Pragmatiker können einzig neue Kenntnisse ausbilden, jedoch wie diese darin zur Umsetzung gelangen, bestimmt sich in diesen Lehranstalten in keiner Weise über das Pragmatische, sondern über die dem entsprechende Abgrenzung dazu und somit steht auch die Erkenntnissgewinnung darüber außen vor. so walten darin auch nach wie vor noch die alten Chematas vor, in welchem die Bildnisse darin die Grundlagen bilden und man einzig darüber ausbildet. Es ist an sich auch das Pondant zum Handwerk, wo der Lehrling nicht die Tätigkeit vollzieht, wofür dieser im Anschluß an die Lehre hingegen seine Bescheinigung erhält. Es trägt hier wie dort einzig den Schein eines Statuses, welcher als solcher erfüllungstechnisch gar nicht existiert. Tatsächlich ist die erforderliche pragmatische Lehre in beiden Verhältnissen dem Jeweiligen selbst überlassen, inwiefern er sich dies selbst verschafft und darauf beruht der Status, welcher dies nämlich im Anschluß daran von diesem selbst einfordert. Wem ist dies jedoch bewußt?

» Andreas Vesalius «
Welcome (1543)

Vesalius_body.jpg

» Honoré Fragonard «
» Musée Fragonard «
» Pferd und Reiter (1771) «

Fragonard.jpg

» Gunther von Hagens «
» Körperwelten «
Pferd und Reiter (2000)

Von_Hagens.jpg

Was suggerieren diese Bildnisse der Repräsentanten der Anatomie?

Das Leben!

Das Elementare, was mit der neuen Wissenschaft auf den Plan tritt, ist das gänzlich andere Substanzwesen. Während man zuvor den Menschen im Verhältnis von Leib (dem Körperlichen) und der Seele (Anima) erachtete, wandelte sich dies zu einem reinen Verhältnis des Körperlichen, dem gegenüber man die Unkörperlichkeit als eine unhaltbare Substanzlosigkeit ins Abseits stellte und einzig noch den Geist als ein zu erachtender Bestandteil aktzeptiert, welcher dem Körperlichen zugeordnet wird. Was zeigen jedoch diese Bildnisse? Körper ohne Leben. Ist jedoch das Leben einzig eine Suggestion? Wie kann sein, daß ein Körper einerseits lebendig und anderseits ohne Leben ist und sich körperlich doch gar nicht voneinander unterscheidet, sondern erst im Verlaufe der Leblosigkeit eine verändernde Erscheinung zutage tritt? Ist das Leben (k)eine Substanz? Wie man hieraus sich vor Augen führen kann, hat in dieser wissenschaftlichen Entwicklung im Dunkeln verborgen etwas stattgefunden, was an sich gar nicht übersehen werden kann. Und doch ist es der Stand der Dinge, nach wie vor, daß man einzig die substanzielle Präsenz, welche den Augen ersichtlich ist, als alleinige Präsenz des Seins erachtet. Das Leben als solches existiert darin einzig als eine Mechanik und im Regelfall fällt es den Menschen noch nicht einmal auf, aufgrund der Selbstverständlichkeit der Verbundenheit der Menschen Körper mit dem Leben. Und so verwundert es diesen auch nicht, wo doch das Leben sich über das Körperliche fortsetzt, dem gegenüber es beim Tode sich verflüchtigt. Den Tod bewahrt man indess im Dunkeln, genau so, wie die Sexualität, sodaß auch ja nicht in Erscheinung treten kann, was sich darüber darbietet.

Divider

Der binäre Gen-o-Typ

Divider

Den Inbetrachtziehungen und Ideologien gegenüber dem Differenzierungswesen der Geschlechter, gilt es, die zugrundeliegenden Prinzipien des Einheitswesens gegenüber zu stellen. Während man ursprünglich die Wesensart aus der Fortpflanzung zu ergründen und begründen ersuchte, hat sich dies dahingehend gewandelt, dies auf das substanzielle Selbst zu übertragen und ergründet daraus das Vereinigungswesen. Elementar ist hierin jedoch, daß die geschlechtliche Differenzierung zu dem bestehenden Organismus in seinem Ursprung hinzu gelangte und somit ist auch der Organismus weder ein Ungeteilter, noch ein Geteilter darin, da dies eben nicht dem Organismus wiederfuhr, sondern sich diese Differenzierung dem hinzufügte. Hingegen funktionieren die organischen Einheitswesen in ihrem funktionalen Konstrukt gemäß eines Kollektivs, sodaß jeder funktionale Bestandteil auf den Gesamtorganismus, wie auch der Gesamtorganismus auf das jeweilige Einzelne aufeinander einwirkt und miteinander kombiniert sich umsetzt. Somit ergibt sich daraus auch eine entsprechende Unterscheidung über die Gesamtwesensart, die sich im Verlaufe daraus entwickelt hat, jedoch handelt es sich um keine Andersartigkeit des Organismus, sondern um eine ausdifferenzierende Prägung, welche auf der Wesensart der Funktionalität des Geschlechts- und Fortpflanzungswesens beruht. Hierzu gilt es zu bedenken, daß die Einheit der Organismen aus einem Einheitswesensverbund beruht und man hierin grundsätzlich das Vereinigungsprinzip der Synonymität antrifft. Auf der Grundlage der Vereinigung der Gemeinsamkeit mit der Ergänzung beruht das, was man als Lebendigkeit erfährt und so ist es auch nicht nur erfahrbar in dem, was man zu dem Organischen zählt, denn die Gemeinsamkeiten, Ergänzungen und Widersprüche bilden die generelle Grundlage der Einheiten innerhalb des Seins.

Gemeinsamkeiten & Ergänzungen ↔ Widersprüche

Zum Nachvollzug der ursprünglichen Sichtweisen zum Geschlechtswesen, welche man über die Schriftenwerke erfährt, gilt es sich vorab die Kenntnisstände vor Augen zu führen, dem gegenüber vor allem die Gegebenheit, daß das weibliche Ei erst im 19. Jahrhundert als solches entdeckt und bekannt wurde, die Besonderheit des Vorigen ausmacht. Gerade auf der Grundlage dieser spezifischen Unkenntnis und das man dies damit verbunden auch nicht in Betracht zog, beruhten die Ideologien, in welchen man auch gar nicht das Selbst, sondern seine Beschreibung und Inbetrachtziehung aus dem allgemeinen Fortpflanzungswesen heraus ergründete. Es basierte somit vor allem auch nicht auf der Inbetrachtziehung des Geschlechts selbst, sondern des Prinzips. Maßgeblich hierin sind zumal auch die mystischen Grundlagen, in welchen man den Ursprung der Dinge und das Stattfinden der Wirkungen, im Wesentlichen ursächlich Göttlichkeiten zuschreibt und sich darin vor allem darauf bezieht, da man den ersten/letzten Grund nicht (anders) kennt und die diversen Verhältnisse entsprechend prägt. Hingegen verschiebt sich dies, gemäß des Ausbreitens der Naturwissenschaften hin zu den zugrunde liegenden Symptomen, was auf dem neuerlichen Naturverständnis beruht, in welchem, gemäß des Atoms, das Jeweilige im Selbst begründet man erachtet. Gravierend ist somit auch, daß sowohl sach-, wie sprachtechisch man es hierin mit einer ganz anderen substanziellen Weite zu tun hat, dem gegenüber die Neuerungen zwar Detaillierungen hervorbrachten, welche zuvor nicht präsent waren, es sich jedoch hierbei um eine reine absolute Quantisierung handelt, dem gegenüber das Vorige darüber nicht mehr darin ersichtlich ist und auch nicht nachvollziehbar. Die Inbetrachtziehung des Alten ist somit auch generell aus dem heutigen Gegenwartsverhältnis unmöglich, sondern es bedingt dazu grundsätzlich des Hineinbegebens in die jeweilige Gegenwärtigkeit und dessen inhaltliches Verhältniswesen.


(Bekanntgabe zur Entdeckung des menschlichen Eies)
» «

Über Entwickelungsgeschichte der Thiere

» Zweiter Teil (1837) «
(vergleichende Embryologie)
» «


Die Grundlegung der Embryologie im 19. Jahrhundert
Verlag: Shaker
Hrsg.: Prof. Dr. Dr. Ortrun Riha, Sächsische Akademie der Wissenschaften zu Leipzig

Ortun Riha: Obwohl die internationale Wissenschaftshistoriographie in den letzten Jahren eine ganze Reihe von theoretischen, ideen-, kultur-, sozial- und mentalitäts- geschichtlichen Fragestellungen entwickelt hat, die in Bezug zur Embryologie stehen, blieben die ersten Jahrzehnte des 19. Jahrhunderts ein weitgehend 'unbeackertes' Feld. Die Forschungslücke zwischen den beiden bisherigen Schwerpunkten im 17./18. Jahrhundert einerseits und dem späten 19. bzw. dem 20. Jahrhundert anderseits wird mit der vorliegenden Monographie geschlossen. Deren Gegenstand ist somit genau diejenige Phase, in der sich die Embryologie von naturphilosophischen Erklärungsmustern löste, sich die 'modernen' naturwissenschaftlichen Methoden zu eigen machte und in deren Gefolge wiederum eine neue Begrifflichkeit und eine neue theoretische Fundierung erfuhr. So fallen die für das Verständnis der Entwicklungsvorgänge grundlegenden Entdeckungen in diesen Zeitraum: Keimblattkonzept, Säugetier-Ei, Chorda dorsalis und Kiemenanlagen bei Landtieren; allein dieser Umstand macht eine solche Untersuchung zu einem lohnenden Unterfangen. Für das Akademie Projekt "Wissenschaftsbeziehungen im 19. Jahrhundert zwischen Deutschland und Russland auf den Gebieten Chemie, Pharmazie und Medizin", in dessen Rahmen das Buch entstand, bot sich diese Thematik jedoch darüber hinaus insofern an, als die Akteure - allen voran Christian Heinrich Pander, Karl Ernst von Baer und Martin Heinrich Rathke, aber auch andere Forscher, die bisher weniger Beachtung fanden, - ganz überwiegend in der relativ kleinräumigen Wissenschaftsregion zwischen Königsberg und St. Petersburg (und damit zwischen Preußen und dem Russischen Reich wechselnd) tätig waren; vor allem die Universität Dorpat spielte durch ihre transnationale Scharnierfunktion eine zentrale Rolle. Die Ergebnisse der Untersuchung gehen jedoch über Biographien und Institutionengeschichte hinaus: Der durchgängige Rückgriff auf die historischen Originalarbeiten ermöglichte zum einen die Veröffentlichung bisher unbekannten Materials und zum andern auf dem Weg der Diskursanalyse eine Neubewertung des Paradigmenwechsels in der Embryologie. Dieser vollzog sich keineswegs abrupt, sondern in zäher Auseinandersetzung mit nach wie vor persistierenden naturphilosophischen Konzepten, denen nicht nur ein Teil der Terminologie, sondern auch die Affinität zu Deduktion und Analogie entstammte. Parallel dazu lässt sich die Ablösung der Säftelehre durch die Zelltheorie beobachten, aber auch auf dieser Ebene konnte das neue Modell seine Überlegenheit gegenüber traditionellen Plausibilitäten nur langsam erweisen, so dass insgesamt die Gründungsphase der modernen Embryologie weniger einen Umbruch als die 'Gleichzeitigkeit des Ungleichzeitigen' exemplifiziert.

Somit ist auch bezüglich der Ärzteschaft, welche man über die Griechen vermittelt bekommt, zu bedenken, daß deren Grundlagen sich elementar von dem der neu entstandenen Medizin unterscheidet. Gleich ist indess, daß sich dies ebenfalls aus dem Generellen der allgemeinen substanziellen Naturkundlichkeiten heraus begründete und dem gemäß einst auf den vier Grundelemente von Erde, Wasser, Luft und Feuer beruhte. Gemäß dem erachtete man die Befindlichkeiten auch gemäß des Verhältnisses der Eigenschaften der Elemente. Zu Grunde liegender Unterschied ist jedoch, nicht nur gegenüber dem Neueren der Medizin, sondern auch gegenüber den einstigen griechischen Philosophen, deren Anwendung des elementaren Grundprinzips der Ausgewogenheit. Wie sich aufweist, so stammt gar beiderlei von den Ägyptern, wohingegen das Elementarprinzip der Ausgewogenheit einzig von den Ärzten und wie sich ausfindig machen läßt, auch von den Pythagoreern derart zur Grundlage wurde, wohingegen es bei den Ägyptern auf der Basis der Grundwesensarten, vor allem auch das Prinzip der Gerechtigkeit repräsentierte. Dem gegenüber ist es bei den griechischen Philosophen nicht nur in dem Bezug der Geist das Zentrum der Erachtung der Gerechtigkeit, sondern generell wird darin das Sein daraus ergründet, sodaß hierin die Erkenntnis die Grundwesensarten begründeten. Gerade diese geistige Grundwesensart, welche im späteren Verlauf auch in unsere Kultur gelangte, löste aus diesem Verhältnis heraus auch die elementare Unterscheidung von Wahrnehmung und Vorstellung auf, was man speziell über die Auflösung der Unterscheidung von Bewußtsein, Geist und Gehirn erfährt. Dies und die gänzliche Quantisierung des pythagoraischen Zahlensystems, bilden indess die Grundlage des neueren naturwissenschaftlich-physikalischen Natursystems.

» Melancholie im Mittelalter «
Eine antike Tradition als Vorentwurf der Moderne
Daria Norma Jansen

Mit einem Krankheitsbegriff, der nicht länger totalisierend, sondern dynamisch und lokal verstanden wird, entwickelt die Humoralpathologie eine Distanz zum Numinosen und bildet Assoziationsmechanismen zwischen Symptomatik, menschlicher Konstitution und Umwelt aus. Dabei steht ein ursprüngliches naturwissenschaftliches Bestreben im Zentrum dieser Medizin: die Suche nach einem rationalen Verständnis und das Durchdringen kausaler Ursache-Wirkung-Beziehungen. Silke Esterl erkennt in der mit dem Corpus Hippocraticum gebildeten Schule das "Bestreben, über die Nosologie hinaus zu einer Ätiologie, also einer Ursachenbestimmung, zu kommen.

Für die Beschreibung und Therapie geistiger Erkrankungen bietet die Humoralpathologie einen Raum außerhalb theologischer Praktiken, indem eine direkte Verbindung zwischen Seele und Körper fokussiert wurde. Die Humoralpathologie lässt sich damit als einen frühen Versuch verstehen, seelische Störungen mit empirisch nachvollziehbaren Termini zu beschreiben und kausal auf überschaubare Ursachen zurückzuführen, um ihnen dadurch "einen Teil ihres Schreckens und ihrer Unberechenbarkeit" zu nehmen. Indem psychische Erkrankungen zu medizinischen Phänomenen erhoben - und somit dem Kompetenzbereich der Ärzte und nicht länger den Priestern oder Magiern zugeordnet - werden, vollzieht sich eine elementare, trennscharfe Abgrenzung der Disziplinen: "In seinem Buch Über die heilige Erkrankung [de morbo sacro] vollzieht Hippokrates deshalb nicht nur eine Trennung zwischen Beobachtung und Aberglaube, sondern auch eine zwischen Medizin, Philosophie und Theologie, dem Glauben und dem Wissen.

Die Denkrichtung der hippokratischen Medizin von einer deskriptiven Nosologie zu einer interpretierenden Ätiologie gelingt über die Etablierung eines theoretischen Systems, der Elemente- und Säftelehre, die den Rahmen markiert, innerhalb dessen Diagnose und Therapie praktiziert werden können. Die Säftelehre postuliert die Vorstellung, dass die Gesundheit des Menschen auf einem Gleichgewicht (eukrasia) der Mischung (krasis) der vier humores (Blut, Schleim, gelbe und schwarze Galle) basiere. Mit einer Störung dieses Gleichgewichts entstehe ein Missverhältnis dieser Säfte (dyskrasia), was als Ursache für die Ausprägung seelischer und körperlicher Krankheiten verstanden wird.

In dem Text De natura hominis ('Über die Natur des Menschen', ca. 400 v. Chr.), der wahrscheinlich von Polybos stammt, wird die idealtypische Vorstellung der eukrasia anschaulich beschrieben: "Am gesundesten ist der Mensch dann, wenn ihre gegenseitige Mischung, Wirkung und Menge ausgewogen und wenn sie am innigsten verbunden sind, krank aber, wenn einer der Säfte in zu großer oder zu geringer Menge vorhanden ist oder sich im Körper absondert und nicht mit allen vermengt ist." In der hippokratischen Lehre entsprechen die vier Körpersäfte den "kosmischen Elementen und Perioden, sie beherrschten das ganze Sein und Verhalten des Menschen" und können in ihrer Zusammenstellung je nach Jahreszeit schwanken (so dominiert die schwarze Galle zum Beispiel im Herbst, während ihr der Winter unlieb und der Frühling feindlich). Extreme Abweichungen vom Gleichgewicht dieser Säfte führen dabei zu pathologischen Veränderungen des menschlichen Organismus und können psychische und physische Krankheiten auslösen.

Die Verehrung der Vierzahl und die Vorstellung, dass eine krankhafte Veränderung aus der Störung einer Gleichgewichtslage erwachse, lassen sich auf einen pythagoräischen Ursprung zurückführen.

Alkmaion von Kroton, ein pythagoräischer Arzt, der um 500 v. Chr. gelebt hat, erklärt, die Gesundheit werde durch das gleiche Recht (ἰσονομία) der Kräfte (δυνάμειζ) erhalten [...]. Die 'Alleinherrschaft' (μοναρχία) einer unter ihnen sei die Ursache der 'Krankheit"; und er faßt den Begriff der Gesundheit in die Formel der 'gleichmäßigen Mischung der Qualitäten' (σύμμετροζ τῶν ποιῶν κρᾶσιζ) zusammen.

Und auch wenn die Pythagoräer die Vier-Säfte-Lehre nicht selbst entwickelten, "bereiteten sie den Boden dafür, indem sie eine Reihe tetradischer Zuordnungen aufstellten [so z.B. [...] Feuer, Wasser, Luft und Erde; Frühling, Sommer, Herbst und Winter], in deren System die vier Säfte späterhin eintreten konnten." Empedokles erweitert das vollkommene Zahlensystem der Pythagoräer um den semantischen Gehalt einer kosmischen Elementenlehre. Mit Blick auf die pythagoräische Tradition postuliert Empedokles eine Beziehung zwischen den Naturstoffen und der Dynamik der Jahreszeiten. Bei Empedokles lassen sich an dieser Stelle Gedanken der älteren Naturphilosophen, wie Thales oder Anaximenes, wiederfinden, die alles Sein und alles Stoffliche auf ein einziges Urelement zurückführen. Dieses Postulat der Einheit verbindet Empedokles mit dem System der Vielheit der Pythagoräer und gelangt dabei zu einer Elementen-Lehre, "die die 'vier Wurzeln des Alls' [mit] vier [...] kosmischen Grundwesen gleichsetzte: Sonne, Erde, Himmel, Meer". Über Philiston wird dieses Konzept um "den Gedanken [ergänzt, dass] jedes dieser Elemente eine bestimmte Qualität (δύναμιζ) besitze: 'zum Feuer gehört Hitze, zur Luft Kälte, zum Wasser das Feuchte und zur Erde das Trockene'." Durch diese Verbindung tritt die Empedokleische Elementenlehre in Einklang mit einer Qualitätenlehre - "mit dem Erfolg, daß die Elemente ihre starre Stofflichkeit verl[ie]ren". Empedokles betont neben Verteilung und Mischung auch die Bedeutung eines ausgewogenen Mengen- und Größenverhältnisses. Erst eine vollkommene Mischung ergebe den Menschen, "der den größten Verstand und die schärfsten Sinne besitz[e]".

Dieses ideengeschichtliche Kompendium fließt in Polybos 'De natura hominis' zu der eigentlichen Vier-Säfte-Lehre zusammen. Es gelingt, die "rein medizinische Säftelehre und eine allgemein-kosmologische [...] Spekulation in einen systematischen Zusammenhang zu bringen".

Polybos versteht das Gleichgewichtsideal der eukrasia als Basis der menschlichen Gesundheit. Die Absonderung oder 'Alleinherrschaft' eines der Säfte stört die versierte Harmonie und führt somit zu einer Erkrankung des Organismus: "Wenn einer davon sich absondert und für sich allein bleibt, muß nicht nur die Stelle, die er leer läßt, krank werden, sondern auch diejenige, wo er hinfließt und sich ansammelt, weil die Überfüllung Schmerz und Beschwerde verursacht." In diesem Wirkzusammenhang zwischen Gesundheit und Krankheit steht auch die humorale Therapie, die das Ziel verfolgt, die Körpersäfte wieder in ein harmonisches Gleichgewicht zurückzuführen, indem überschüssige, krankmachende Säfte aus dem Organismus entfernt werden. "Dies erfolgt z.B. mithilfe von Brechmitteln, Aderlässen, Blutegeln, Brandgeschwüren zur Erzeugung von Heilfieber." Präventiv soll eine gesunde Diätetik dazu beitragen, dass das Gleichgewicht der Säfte bestmöglich unterstützt wird.

In dieser Form gewinnt die Vier-Säfte-Lehre eine weitreichende medizinische und naturphilosophische Bedeutung. Im 2. Jahrhundert n. Chr. knüpft der Eklektiker Galen explizit an die hippokratischen Schriften an und etabliert "die Säftelehre, also den Urbestand der hippokratischen Medizin", als einen zentralen Bestandteil kanonischer Lehre, der bis zu den Naturphilosophen des Mittelalters in dieser Form Gültigkeit behalten sollte.

Wie sich aufweist, so sieht man sich nicht in der Lage, die Grundlagen der ägyptischen Astrologie nachzuvollziehen, woraus sich deren Mythologie begründete, was darauf beruht, daß man hierin die Verknüpfung mit der Astronomie voraussetzt, an dem man es zu ermessen sucht. Über dieses Musterbeispiel gilt es einmal hervorzuheben, was sich daraus entwickelt und wie es sich damit verhält. Dies läßt sich hierin vor allem auch aus der Gegenwart heraus demonstrieren, über die präsente Anwendung der daraus abgeleiteten Astrologie, in welcher man nämlich die Astronomie daran gekoppelt hat. Und es kann auch ein Jeder für sich darüber nachvollziehen, über deren Anwendung der astrologischen Charakter, bei dem man nämlich diesen aus dem Geburtszeitpunkt heraus, übertragend auf die Sternenkonstellation berechnet. Im Moment der Geburt findet nämlich gar nicht die Prägung der mentalen Veranlagungen und somit auch nicht die des Charakters statt, sondern im Moment der Zeugung (worüber schwanger Frauen zu berichten wissen, da im Mutterleib sich dies bereits anhand seiner Lebhaftigkeit zeigt). So basiert dem gemäß auch die Ermittlung des Charakters, nicht berechnend aus den Sternenkonstellationen, sondern aus dem Ermitteln des Wirkens des (geborenen) Menschen, welches man dem Prinzip des jeweiligen Sternenbildes gegenüber stellt, um es daraus zu ermessen und nicht, um es daraus zu ermitteln. Das Verhältnis und Anwendungsprinzip verdeutlicht sich vor allem auch über deren Götter, welche gemäß der Mythologie, zunächst auf der Erde lebten, sich jedoch davon entfernten und zu Sternen am Himmel wurden. Maßgeblich hierin ist, daß das Wirken gar nicht an und in den Sternen zu ermessen ist, sondern einzig aus dem Wirken auf der Erde. Zumal es hierin darum ging, das Wirken selbst (und somit der Götter) zu ermessen und nicht das von Planeten und somit hatte es auch nichts mit der Astronomie zu tun, die sich dem gemäß davon scheidet. Hingegen ist die Entwicklung, dies miteinander zu verbinden schon das Richtige, nur bedingt es darin auch des funktionalen Verbundes, denn man augenscheinlicherweise noch nicht korrekt vollzogen hat.

» Die Abwägung des Herzens «

Weighing_of_the_Heart.jpg

obere Reihe: Hu und Sia, Hathor, Horus, Isis und Nephthys, Nut, Geb, Tefnut, Shu, Atum, Ra-Horakhty

untere Reihe: Tutu, Ani, Renenutet und Meshkenet, Ani's ba, Ani's Herz, Meretseger, Shay, Anubis, Feder von Maat, Thoth, Monster Ammut

Die Ma'at ist das Prinzip und gleichzeitig repräsentierende Göttin. Die Feder ermißt auf der Waage die Ausgewogenheit des Menschen Seelenleben. Und miteinander bildet dies die Grundlage des Verhältnisses des Seins, welche dem Lebensprinzip der Ausgewogenheit gegenüber gestellt wird, sodaß es auch im Angesicht des Todes über das darüber hinaus stattfindende Leben sich bestimmt, inwiefern es sich fortsetzt. In Anbetracht der Evolution ist es genau das, was sich darüber darlegt, worin einzig das sich evolutionär fortsetzt, was dem Sein und dem Sein des Selbst, als solches zuträglich ist, hingegen Lebenswidrigkeiten darin ihrer Verlustigung unterliegen. Aus dieser Gegebenheit heraus stellt sich auch alles andere als ein Umgebendes und Geleitwesen, welches die Verhältnismäßigkeit darin formt und prägt und damit verbunden auch Zeugnis darüber ablegt.

Was die Bezugnahmen zu den althergebrachten kulturellen Gegebenheiten betrifft, so sind diese weitläufig bis zur Gegenwart erhalten. Markanterweise ist sogar das gleiche Verhältnis des Ursprunges zum Samen nach wie noch über unsere gegenwärtige Sprache präsent. Hierin wurde nicht nur die Bezeichnung, sondern auch die Ideologie aus dem lateinischen ursprünglich übernommen (lateinisch: semen, griechisch: σπόροι/spóroi). Man vergleiche hierin den Pflanzensamen und den Samen des Menschen. Darüber verdeutlicht es sich. Hingegen entspricht jedoch, gemäß der neueren Kenntnisse, der Pflanzensamen gar nicht dem Samen des Menschen, denn der Pflanzensamen beinhaltet bereits die Frucht. Die Frucht der Pflanze bezeichnet jedoch das Gemeinsame von Fruchtfleisch und inneliegendem Samen. Dem gegenüber ensteht jedoch aus dem Samen nicht die Frucht, sondern daraus tritt der Keimling hervor, worüber sich der Organismus ausbildet. Über diese Verhältnisse erfährt man somit auch ein konkretes Abbildnis der Ursprünge und dessen Bildnisse aus den aktuellen sprachtechnischen Gegebenheiten heraus. Zwar nennt man mittlerweile den menschlichen Samen differenzierend gemäß des altgriechischen σπέρμα Sperma, jedoch handelt es sich dabei um die Aussaat, gemäß des Samens in seinem Verbund mit der Spermaflüssigkeit. Diesbezüglich gilt es auch zu bedenken, daß Vergrößerungsgläser erst zur Zeit des Aufkommens der Botanik zur Entwicklung gelangten und die Erkenntnisse darüber sich über diese zunächst ausbildeten, jedoch wie man aus dem Sprachschatz heraus erfahren kann, die Entwicklung darin regelrecht stehen geblieben ist. Diese Prinzipien beruhten jedoch auch nicht auf Erkenntnissen der Ärzte, wie auch generell nicht auf dem den Menschen, sondern repräsentierten die Naturverständlichkeit in seiner generellen Wesensart und stammten von den Philosophen.

Was die alten Prinzipien der geschlechtlichen Inbetrachtziehung betrifft, so hat Allen den sozialen Kern der Unterscheidungen ergründet und wie man dem entnehmen kann, so basiert dies vor allem auf dem, was noch heute zugrundlegendes Thema ist und nicht nur für Frauen, sondern auch für Männer gleichermaßen, von je her die Grundlagen der besonderen Umstände ausmachten, nämlich das geschlechtliche Regularium und dessen Prinzipwesen. Dieses Regularium des sozialen Verhältnisses des Mit- und Zueinanders, basiert auf der Grundlage, dem regulär Animalischen eine geistig fundierte Ideologie entgegen zu setzen und dient darüber in seiner elementaren Bewandtnis, dem Erlangen und Aufrechterhalten der funktionalen Einheit des Ganzen, aus dem heraus es sich fundiert, im Gegensatz der Präsenz des Einzelnen, was einzig dem gegenüber gestellt wird. Bei dessen Bezug zur Fortpflanzung geht es dem gemäß auch um das sachliche Erbe und den Erhalt dessen als solchen und erst daraus resultierend, um das daraus Erwirkende für den Einzelnen. Auch dieses substanzielle Händling, trifft man sprachtechnisch noch heute in seiner Herkunft der Anwendung an, nämlich über den Begriff der Sinnlichkeit und dessen Synonyme, welche zweierlei Bedeutung haben: zum Einen bezieht es sich auf das Verhältnis des Empfindungs- und Gefühlswesen und zum Anderen auf das der geistigen Sinnhaftigkeit. Darin besteht des Wesens Kern der geistigen Hervorhebung und der isolierten rein sachlichen Handhabe dessen, daß darüber selbst keine Empfindungen und Gefühle hervortreten und damit verbunden über diese reinen Versachlichungen, der Fixierung und Monisierung dessen, das instinktive Auftreten der Empfindungen und Gefühle und somit das, was das Animalische ausmacht, außen vor stellt. Gerade darauf beruht auch die Trennungserachtung der Geschlechter, dem gegenüber die Sinne der Sinnlichkeit eine ganz andere Aussage darüber abbilden, worüber überhaupt erst das eigentliche Einheits- und Abrenzungswesen in Erscheinung tritt, es sich darin um das Vereinigungswesen sich dreht und darüber die Geschlechter miteinander (ver)bindet. Nur sprechen diese eben nicht die Sprache, welche dies wiedergibt und treten diese schon gar nicht in den Schriftwerken der Inbetrachtziehung in Erscheinung, sodaß gerade das Sprachwerk dies wiederum außen vor stellt. Aufgrund dieser Grundlage, ergibt sich daraus auch keine Binarität der Geschlechter, sondern primär eine Binarität des Selbst zu seinem Geschlecht, was sich auch als Ausgangslage des erlangten 20. Jahrhunderts erweist, worin nämlich gegenüber den scheinbaren Fortschritten der Erkenntnisse, dies genau zum Gegenteil führte und seitdem mehr in Frage stellt, als je zuvor. Gerade das Verhältnis von "sex unify", "sex polarity" und "sex complementary" ist darin nämlich zum elementaren Bestandteil der Auseinandersetzung mit dem Selbst geworden.

The Concept of woman

» Volume 2 - Part 1 - The Early Humanist Reformation 1250-1500 (2002) «
» Volume 2 - Part 2 - The Early Humanist Reformation (2002) «
» Volume 3 - The Search for Communion of Person 1500-2015 (2016) «
Verlag: Eerdman's Press (Volume 1 first: Eden Press)
» «


Von Robert Grosseteste bis Bartholomäus von Brügge (1246/1247-1309)
Verlag: Brill

An dieser Stelle sei auf zwei Beispiele einer solchen Rezeption der aristotelisehen philosophischen Texte zur Ehe eingegangen: 1981 veröffentlichte die amerikanische feministische Philosophin Jean Bethke Elshtain ihr Buch "Public man, private Woman. Women in Social and Political Thought". Das Buch übt sozialphilosophisch-feministische Kritik an der dichotomen Unterscheidung zwischen einer dem Mann zugeordneten Sphäre des "Öffentlichen" und einer der Frau zugeordneten Sphäre des "Privaten". Die Autorin setzt sich kritisch mit der Entwicklung dieser geschlechtsgebundenen Unterscheidung in der Philosophiegeschichte auseinander. In diesem Zusammenhang hinterfragt die Philosophin auch die Ausführungen über das Verhältnis von Mann und Frau im ersten Buch der Politik und distanziert sich von ihnen als einer unzulänglichen Vereinnahmung der Sphäre des Öffentlichen durch den Mann.

Als zweites Beispiel von Rezeption der aristotelischen Philosophie der Ehe in einer Arbeit, der eine feministisch-philosophisclre Intention zugrunde liegt, sei hier eine umfangreiche Studie von Prudence Allen aus dem Jahre 1985 genannt. Die amerikanische Philosophin beschreibt in ihrem Buch, das den Titel "The Concept of woman. The Aristotelian Revolution, 750 B.C. - A.D. 1250" trägt, philosophische Konzepte der Frau und der Geschlechterbezichung von den Vorsokratikern bis an die Schwelle des Spätmittelalters. Ihre Absicht ist es, die Geschichte der philosophischen Konzeptualisierung der Frau in ihrer Beziehung zum Mann aufzuarbeiten und so einen Beitrag zu aktuellen philosophischen Diskussionen um die Identität der Frau und um die Beschaffenheit der Geschlechterbeziehung zu leisten. Allens Deutung zufolge lassen sich die gesamten antiken und früh- und hochmittelalterlichen philosophischen Ausführungen zum Thema "Frau" und "Geschlecht" auf drei philosophische Grundpositionen zurückführen, die sie als "sex unify", "sex polarity" und drittens als "sex complmentary" qualifiziert. Die erste Position zeichne sich dadurch aus, dass sie die Existenz eines realen Unterschieds zwischen den Geschlechtern bestreite. Die zweite Position - sex polarity - gehe demgegenüber von einem wesentlichen Unterschied zwischen den Geschlechtern aus, verstehe Mann und Frau als Gegensätze und ordne den ersteren der letzteren hierarchisch über. Die letzte Position schließlich - sex complementary -, mit der Allen deutlich sympathisiert, erkenne zwar die Existenz eines wesentlichen Geschlechtsunterschieds zwischen Mann und Frau an, verstehe aber beide als komplementäre, gleichrangige und gleichwertige Partner. Die Philosophin sieht in Aristoteles den Gründer des Konzepts der sex polarity also einer hierarchisch und antagonistisch verstandenen Geschlechterbeziehung. Bemerkenswert ist auch, wie sie ihrerseits das Fortleben dieses als aristotelisch gedeuteten Geschlechterkonzepts der sex polarity in der Geschichte darstellt. Prudence Allen zufolge ist die Geschichte der Antike und des Früh- und Hochmittelalters eine Geschichte der allmählichen Durchsetzung dieses aristotelischen, hierarchisch-antagonistischen Geschlechterkonzepts - deshalb der Titel Aristotelian Revolution -, deren Höhepunkt in der Institutionalisierung aristotelischer Schriften im Lehrplan der Pariser Universität im Jahre 1255 erreicht wird.

Was die Ergündung der Zeiten vor der Renaissance betrifft, so ist hierin vor allem zwischen drei Verhältnissen zu unterscheiden: zum Einen gibt es überhaupt nur wenige tatsächlich erhaltene Originale. Und davon wiederum sind weitläufig einzig Fragmente erhalten. Zum Anderen beruhten grundsätzlich die Schriften auf Handschriften und davon angefertigte Abschriften, sodaß sich in Frage stellt, inwiefern man hierin überhaupt von einem Original ausgehen kann, worin die Erforschung dessen auch immer weiter fortschreitet, dies (in seiner Relation) zu ermessen, dem gegenüber sich jedoch das nachvollziehende Verständnis umso mehr verliert, umso weiter das Zeitgemäße sich in seinem Verständniswesen voneinander entfernt. Des weiteren trifft man darin weitläufig auf Signaturen von Verfassern, die sich zwar als Bezugnahme zum Verfasser erweisen, jedoch nicht vom Verfasser selbst stammen. In der Hauptsache bestehen die Präsenzen jedoch auf Wiedergaben oder Bezugnahmen zu Aufgebrachtem und somit generell neuerlichen Interpretationen, in Verbindung mit sprachtechnisch interpretierten Übersetzungen, wobei in der Hauptsache es sich rein um Zuschreibungen handelt. Nicht erst seit dem Mittelalter fand das Händling der Aufbereitungen statt, sondern dies ist durchgängig anzutreffen, bereits aus seinem Ursprung heraus und vermischt damit verbunden auch weitläufig alles miteinander. Diesbezüglich gilt zu bedenken, daß kein Text den Originaltext wiedergibt, insofern der Wortlaut nicht der Gleiche ist, was mit der Spezifikation der Sprache zusammenhängt, in welchem jedes Wort und jede formulierte Aussage, seine ganz eigenes Bildnis repräsentiert. Darüber hinaus ist auch vor allem das kulturell ideologische Sinnverhältnis darin auch maßgeblich, worüber überhaupt dies seine Inhaltlichkeit erfährt. Stellt man somit verfügbare Originale den Bildnissen dessen gegenüber, wird man feststellen, daß kein Bildnis dem Original entspricht, außer wenn es den original Wortlaut wieder gibt. Dies liegt in der Natur der Sprache, worin selbst aus einer rein grammatikalischen Umformulierung einer Aussage, eine ganz andere Aussage daraus wird. Damit verbunden gilt auch hierin das Prinzip, daß die Kultur und somit auch deren Wiedergaben, ein Verbund mit dem jeweiligen Dasein sind, sodaß das Jeweilige auch einzig sich vermittelt und vermittelbar ist, gemäß dem Bezugsverhältnis zur kulturellen Verbundenheit. So ist gemäß dem auch die Kultur des Ursprunges, das des Wiedergebenden und das der Gegenwart im Nebeneinander in Betracht zu ziehen, um das Relativum darin gemäß dem zu realisieren. Erst daraus ergibt sich eine angemessene Vermittlung.

Sammlung_Tusculum.jpg
Sammlung Tusculum

Frauenmedizin.jpg
Frauenmedizin in der Antike

» Sammlung Tusculum «
» Bibliographie der Ausgaben «
» Wikipedia-Liste der Werke «

Seit 1923 erscheinen in der Sammlung Tusculum maßgebende Editionen griechischer und lateinischer Werke mit deutscher Übersetzung. Die Originaltexte werden zudem eingeleitet und umfassend kommentiert; nach der neuen Konzeption bieten schließlich thematische Essays tiefere Einblicke in das Werk, seinen historischen Kontext und sein Nachleben. Die hohe wissenschaftliche Qualität der Ausgaben, gepaart mit dem leserfreundlichen Sprachstil der Einführungs- und Kommentarteile, macht jeden Tusculum-Band zu einer fundamentalen Lektüre nicht nur für Studierende, die sich zum ersten Mal einem antiken Autor nähern, und für Wissenschaftler, die spezifische Aspekte eines Werkes vertiefen möchten, sondern für alle, die sich durch vertrauenswürdige Übersetzungen einen Zugang zur Antiken Welt verschaffen wollen.

Divider


Griechisch-lateinisch-deutsch
Reihe: Sammlung Tusculum
Verlag: De Gruyter (Artemis & Winkler)
und

Medizin und Gesellschaft

Die Entwicklung der wissenschaftlichen Medizin
Celsus, De medicina - Über die Medizin

Die Ordnung der Geschlechter
Xenophon, Oikonomikos - Von der Hauswirtschaft
Platon, Leges - Gesetze
Aristoteles, Politica - Politik
Tacitus, Annales - Annalen
Soranos, Gynaecia - Frauenheilkunde

Geburtenkontrolle und Abtreibung
Corpus Hippocraticum, De natura muliebri - Über die Natur der Frau
Corpus Hippocraticum, De carnibus - Über das Fleisch
Platon, De re publica - Staat
Aristoteles, Politica - Politik
Hippokrates, lus iurandum - Eid
Celsus, De medicina - Über die Medizin
Plinius, Naturalis historia - Naturgeschichte
Soranos, Gynaecia - Frauenheilkunde
Digesta - Digesten

Die Theorie: das Bild des weiblichen Körpers in der Medizin

Die Anatomie der weiblichen Geschlechtsorgane
Corpus Hippocraticum, De victu - Über die Diät
Soranos, Gynaecia - Frauenheilkunde
Galenos, De semine - Über den Samen
Galenos, De uteri dissectione - Über die Anatomie der Gebärmutter
Galenos, De usu partium - Über den Nutzen der Körperteile

Befruchtung und Empfängnis
Parmenides
Corpus Hippocraticum, De aeribus - Über die Umwelt
Corpus Hippocraticum, De morbis - Über die Krankheiten
Corpus Hippocraticum, De genitura - Über den Samen
Corpus Hippocraticum, De natura pueri - Über die Natur des Kindes
Corpus Hippocraticum, De victu - Über die Diät
Corpus Hippocraticum, De superfetatione - Über die Überbefruchtung
Corpus Hippocraticum, De muliebribus - Über die Frauenkrankheiten
Aristoteles, De generatione animalium - Über die Zeugung der Tiere
Soranos, Gynaecia - Frauenheilkunde
Galenos, De semine - Über den Samen
Galenos, De usu partium - Über den Nutzen der Körperteile

Menstruation, Geschlechtsreife und Pubertät
Corpus Hippocraticum, De natura pueri - Über die Natur des Kindes
Corpus Hippocraticum, De muliebribus - Über die Frauenkrankheiten
Aristoteles, De generatione animalum - Über die Zeugung der Tiere
Aristoteles, Historia animalium - Geschichte der Tiere
Celsus, De medicina - Über die Medizin
Soranos, Gynaecia - Frauenheilkunde
Galenos, De simplicium medicamentorum temperamentis et facultatibus
- Über die Mischung und Wirkung von nicht zusammengesetzten Heilmitteln

Das Werk, welches die sprach- und sachtechnischen Grundlagen hingegen aus seinem lateinischen Ursprung heraus in einem weitreichendem Umfang wiederspiegelt, ist markanterweise das Einzige, welches es in dieser Art gibt, nämlich die Enzyklopädie des Isidor von Sevilla. Zumal es sowohl für das Verständnis der Dinge, sowie auch für dessen Abbildung über die Sprache die Grundlage bildet, für den Nachvollzug und die Darlegung des Einheitswesens des Seins. Wendet man diesen Maßstab auf die deutsche Sprache an, wird man erkennen, warum ein solches darin nicht anzutreffen ist, nämlich aufgrund seiner gravierenden widersprüchlichen Inklusionen. Zumal sich eine Übersetzung des Isidor's Enzykopädie als unmöglich stellt, da es sich gar ins Gegenteil dazu entwickelte und sogar aus den entstandenen sachlichen Enzyklopädien Lexikas wurden. Dem gemäß entwickelte sich auch weiträumig unsere Sprache. Nicht nur daß hierin das Links bei L und das Rechts bei R steht, sondern alles miteinander seine gänzliche Abtrennung voneinander erfährt, bildet hierin auch gar nicht der Zusammenhang des Verständnisses die Grundlage, sondern das jeweilige für sich stehende isolierte Wissen. Auch dies basiert auf dem Abwendungs- und vor allem Umkehrverhältnis der Wissenschaft gegenüber der Philosophie, indem nämlich in dieser sich das Sein aus dem Einzelnen (der Atome) zusammensetzt und daraus sich jegliche Gegebenheiten ergeben, hingegen jedoch im Philosophischen sich aus dem Ganzen das Einzelne heraus ergibt. Verständnis und Wissen trennen sich somit auch substanziell aufgrund dieser Differenzierung. Gerade darin findet jedoch die Wesensart der Binarität (binär: 1-0) seine Umsetzung, welche nicht erst im 20. Jahrhundert sich durch das daraus entstehende ausbreitende Vakuum vermittelt. Es stellt sich generell gemäß des elektrischen Stromkreises, worin zwar einzig in der zuführenden Leitung Strom fließt, jedoch dieser einzig fließt, wenn der Stromkreis geschlossen wird, und man ganz einfach die Inbetrachtziehung und Erklärung ausläßt, was denn eigentlich im Rückfluß fließt, wo darin doch kein Strom fließt. Das der Computer indess die Null als Zahl interpretiert, hingegen kein Nichts existiert, klärt unter anderem darüber auf, daß die Binarität darin noch eine ganz andere ist, indem nämlich darin sowohl die Eins, wie auch die Null sich als binär stellt. Somit erweist es sich auch nicht als verwunderlich, daß einst die Atomwissenschaftler zu dem Resultat gelangten, daß das Atom, daß sie als ihre Grundlagen erachteten, gar nicht als solches existiert. Inwiefern hat man zwischenzeitlich jedoch die naturwissenschaftlichen Grundlagen daran angepaßt? Das ursprüngliche Prinzip gilt darin nach wie vor. Wie ist dies möglich? Indem man die Dinge isoliert. Und so ist auch Isidor's Händling in der Art von Markantz, daß dieser die Dinge darüber nicht einfach nur darstellt, sondern sie gar spezifisch in Frage stellt, inwiefern sie so sind, wie man es besagt. Was ist und was wer besagt, waren auch schon immer zwei verschieden paar Schuhe, die unauflöslich miteinander einher gehen und man gerade hierin keine Binarität antrifft, hingegen einzig im Öffentlichkeitswesen, dem gegenüber es sich jedoch dem persönlichen Erleben gegenüber anders stellt.

» Isidor von Sevilla «

» Isidori Hispalensis episcopi etymologiarum sive originum libri XX «
» Book XI «
Latin text by W. M. Lindsay
published by Oxford University Press, 1911


Verlag: Weidmann

» Die Enzyklopädie des Isidor von Sevilla (2008) «
Marix Verlag
» Lenelotte Möller «
» Rezension von Cardellede Hartmann «


Truth from Words
Verlag: Cambridge University Press


Verlag: De Gruyter


Nach der Pariser Handschrift und den Monseer Fragmenten
Verlag: De Gruyter
» «


Quellen und Forschungen zur Sprach- und Kulturgeschichte der Germanischen Völker
» Bd. 1. Textkritische Ausgabe der ersten Fassung Buch I - X (1974) «
Bd. 2. Textkritische Ausgabe der zweiten Fassung Buch I - VI (1982)
sowie des Buches XI in Kurz- und Langfassung

» Bd. 3. Wortschatz. Register der deutschen Glossen und ihrer lateinischen Bezugswörter (1995) «
Verlag: Walter de Gruyter

Vollständiges lateinisch-althochdeutsches Wörterbuch
zur althochdeutschen Isidor-Übersetzung
()

Institut für deutsche Sprache und Literatur (DAWB)
» «

Lateinisches und Romanisches aus den Etymologiae des Isidorus von Sevilla ()
(Forschungen zur griechischen und lateinischen Grammatik 9)
Untersuchungen zur lateinischen und romanischen Wortkunde
Lexikalische Untersuchungen zu den Etymologiae des Isidorus von Sevilla

Divider

Isidor von Sevilla ()
Sein Leben, sein Werk und seine Zeit
Verlag: J. P. Bachem
Original: Justo Pérez de Urbel: San Isidoro de Sevilla. Su vida, su obra y su tiempo (1945)
deutsche Übersetzung von

Die historisch-geographischen Quellen in den etymologiae des Isidorus von Sevilla

» Band 2 - Textausgabe und Quellenangabe (1913) «
Verlag: Weidmann

» Isidor-Studien () «
Verlag: Beck

» Die Lagerung und Verbreitung der Handschriften des Isidorus von Sevilla () «
Verlag: Beck


Das Bild der Geschichte in der Enzyklopädie Isidors von Sevilla (S. 1-62)
Verlag: Böhlau

Divider

Summarium Heinrici



Verlag: Walther de Gruyter


Werkentstehung, Textüberlieferung, Edition
Max Niemeyer Verlag

So gilt es sich dem gemäß auch primär zu verdeutlichen, was Sprache eigentlich ist. Sie ist nicht das Sein und auch kein Abbildnis, sondern basiert in seinem Grundwesen auf einer symbolischen Kodierung, welche einen Hinweis liefert für das Jeweilige, auf was es hindeutet. Der Bezug der Sprache bildet sich indess aus der geistigen Vorstellung heraus und diese fundiert sich über die Wahrnehmung, welche zur Erinnerung wird und daraus hervortritt. Gerade dies repräsentiert jedoch ebenfalls in keiner Weise das Sein selbst, sondern, wie John Locke es gemäß Plato nennt, eine Idee über das Seiende, welche daraus hervortritt. Hinzu kommt, daß auch über die Wahrnehmung einzig die reflektierenden Wirkungen des Jeweiligen vermittelt wird und somit auf diese Weise nicht des jeweiligen inneres Selbst, sondern einzig Äußerlichkeiten. Aus dem Grund bedingt es vor allem auch der Verbundsbezüge des Seins, um darüber das Jeweilige selbst daraus in Erfahrung zu bringen. Dies bildet die Grundlage für das Verständnis und wird über das reflektive, einander ergänzende Verhältnis von Wahrnehmung und Vorstellung generiert. Darauf beruht auch die besondere Stellung der Begriffe in der Sprache, da sie selbst solche Verbundsverhältnisse ausdrücken und darüber vermitteln, wie das Begreifen auf das Ergreifen und das daraus Entstehende verweist. Und wie sich demonstrativ über Isidor hervorhebt, bedingt es zur Erfüllung der Funktionalität des Verbundes von Sprache und Verständnis, dessen Einheitswesen dem gemäß in seiner funktionalen Einheit zu fundieren, um sowohl als auch zu gewährleisten. Sprache funktioniert somit auch einzig, gemäß dessen Anwendung als koordinierendes Werkzeug und in keiner Weise, wie man es suggeriert, rein als Information, in welcher eine jegliche Bezeichnung nicht mehr als einen Namen hervorbringt, gemäß dem man es bezüglich des sexualwissenschaftlichen Verhältnisses von Bi- und Ambisexualität sich mustergültig verdeutlichen kann, wie es sich damit stellt.

Elementar bezüglich des sinnlichen Erlebens ist darüber hinaus, daß in die Erinnerung weder Empfindungen, noch Gefühle übertragen werden, sondern dies einzig als Versinnbildlichung dort hinein gelangt und somit kann auch einzig dies in der geistigen Vorstellung daraus hervortreten. Auch die Sprache ist, wie die geistigen Hervortretungen sinnenleer und in dessen Verbund erfahren wir auch das Extrem reiner Versachlichungen, welche damit einher gehen. Gerade aufgrund des Umstandes, daß das sinnliche Erleben generell nicht nach außen übertragbar ist, erfährt dies auch seine Besonderheit des rein persönlichen Erlebens, welches als solches anderen nicht vermittelbar ist, außer regulär über die Auswirkungen, welche darüber stattfinden. Den Schmerz und die Freude kann man zwar geistig versinnbildlicht und indirekt durch körperliche Auswirkungen vermitteln, jedoch nicht das eigene persönliche sinnliche Erleben dessen selbst. Das Einzige, worüber es sich gemäß seiner Relation vermittelt, ist die sinnliche Reflektion, wie man sie speziell im Sexuellen erfährt, indem sich das sinnliche Erleben über die Reflektion miteinander verbindet und darin spiegelt. Vor allem, was man anderweitig über das sprachlich Kommunikative antrifft, beinhaltet somit auch gar nicht das sinnliche Erleben. Dies betrifft sowohl die physischen Reize, als auch das Reflektierende des Selbst, was sich als Gefühle von Harmonie und Disharmonie separiert. Gerade die Gefühle sind somit jedoch der wesentliche Kern der Gegebenheit, das Selbst darüber zu erfahren. Und darüber erfährt man auch, daß dies in keiner Weise rein physisch ist, was und worüber es hervortritt.

Geist und Sprache beinhalten von Grund auf nicht die funktionale Grundlage, die Sinnlichkeit zu vermitteln. Darüber wird auch ersichtlich, daß die Philosophie in ihrer Eingeschlossenheit der Sprache, in der reinen Vergeistigung verloren ging, dem gegenüber sich die Wissenschaft, in ihrer generellen Versprachlichung der Dinge, in der reinen Versachlichung verlustigt ging. Und selbst im persönlichen Umgang, worin bereits zuvor geistige Ideologien vorherrschten, übertrug man dieses Handlungsgebahren formal auf die Sprache, worin diese dann letztendlich allumfassend bestimmend darüber vorherrscht, was in Erscheinung tritt und was sein Händling erfährt. Und all dies tritt in seiner koordinierten Form über das Strafwesen in Erscheinung, worüber das letztendliche Regularium dessen stattfindet. Es ist die Instanz, worin alle Fäden zusammenlaufen. Betrachtet man sich hierin das Geschlecht, so kann man daraus ersehen, daß es darin einzig um dessen kulturelles Ansehen sich dreht und darin das Selbst dem gegenüber steht und darin gar nicht in Erscheinung treten kann, aufgrund des substanziellen außen vor stehens dessen reinen Sprachbezuges. So sind es hierin auch einzig die Sachlichkeiten, welche darin ihr Händling erfahren. Und so schützt, wie es in der Natur des Seins anzutreffen ist, dies hierin auch das Selbst vor fremden Zugriffen, dem der Zugang einzig gegeben ist, über das gemeinschaftsbegründete miteinander koordinieren. Darum nimmt die Sexualität auch einen derartigen Stellenwert in des Menschen Leben ein und verdeutlicht, daß keineswegs die Fortpflanzung dessen Grundlage ist, sondern sich primär substanziert auf dem Vereinigungswesen und die Fortpflanzung ein Zusätzliches/Anhängiges ist darin. Diese Primärstellung des Sexualwesens ergibt sich auch aus der Sache selbst, da keine Fortpflanzung stattfindet, ohne die vorausgehende Vereinigung, hingegen Vereinigung stattfindet, ohne Fortpflanzung.

» Strafrechts- und Kriminalitätsgeschichte () «
der Frühen Neuzeit
Verlag: de Gruyter

S. 20: Das frühneuzeitliche Reich und das gemeine Recht konstituierten einen grenzübergreifenden strafrechtlichen Raum, in dem sich grundlegende Strukturen und Probleme eines transnationalen Strafrechts ausformten. Dies gilt für die staatliche, territoriale, politische und jurisdiktionelle Räume bzw. Grenzen übergreifende Strafverfolgung wie für die Ausformung von Nacheile, Requisition, Rechtshilfe, Verfolgungs- und Bestrafungspflicht, stellvertretender Strafrechtspflege, Gerichtsstand, Asyl und Auslieferung als spezifischen grenzübergreifenden Instrumenten und Praktiken. Im frühneuzeitlichen Reich - wie auch in anderen europäischen Ländern - vollzog sich Strafjustiz folglich in komplexen Kommunikations- und Interaktionsprozessen in einem Mehrebenensystem, das durch Rechtspluralismus, Diversität, Heterogenität, Hybridität und Fragmentierung gekennzeichnet war. Die unterschiedlichen interdependenten Räume, Ebenen, Jurisdiktionen, Interaktionen und Kommunikationen im frühneuzeitlichen Reich bilden für die Strafrechtsgeschichte wie für die Untersuchung von Kriminalität eine besondere methodische Voraussetzung und Herausforderung, sowohl im Hinblick auf die Analyse von Kriminalität als auch bezüglich des Strafrechts und der Praxis der Strafiustiz. Nimmt man nur den Zustand am Ende des Alten Reiches um 1800, dann übten mehr als 250 Reichsstände (8 Kurfürsten, über 200 Fürsten und 50 Reichsstädte) die hohe Strafgerichtsbarkeit über zumindest ein Strafgericht bzw. entsprechende juridische Institutionen aus, wobei meist die jeweiligen juristischen Fakultäten der Landesuniversitäten (soweit vorhanden) einbezogen waren. Dazu kamen die Strafgerichtsbarkeiten der kleineren Reichsmitglieder (z.B. der Reichsritter) und die unzähligen lokalen Strafgerichte, welche die niedere Strafgerichtsbarkeit und in einigen Fällen auch die höhere ausübten, sowie zahlreiche spezifische Gerichtsbarkeiten von Kirche/Geistlichkeit, Universitäten, Zünften und weiteren intermediären Gewalten. Die Zahl der Normgeber und juridischen Institutionen im frühneuzeitlichen Alten Reich geht folglich in die Tausende; ein umfassender Überblick existiert nicht und nur ein kleiner Teil ist in meist räumlich, zeitlich und thematisch begrenzten Fallstudien erforscht.

Elementar hierin ist, daß Jegliches was das Heutige substanziell in unserem Lande ausmacht, in keiner Weise aus dem Selbst heraus begründet ist. Das Land wurde von Wandervölkern bevölkert und deren Ausbreitung wurde zum Maß des Ermessens. Deren gewohnheitsrechtlichen kulturellen Grundlagen wurden indess durch das römische Rechts- und Verwaltungswesen ersetzt. Und das, was alles miteinander vereinte, ist die hochdeutsche Sprache, worüber es überhaupt dazu gelangte und die Regulate der Individualwesen darin auflöste. Die Ableitungen aus den Dialekten basieren darin auf einer Spiegelung, worin dem Inhalt das Subjekt entzogen wird. Die Hochsprache begründet sich nämlich auf dem Neutrum, worin das Subjekt einzig als Objekt in Erscheinung tritt. Wie man im Bezug zu vorigem Aufweisen entnehmen kann, so ergibt sich diese Grundlage aus dem isolierenden Verhältnis der geistigen Vorstellung, im Verbund mit der Sprache, was sich substanziell von dem des Empfindungs- und Gefühlswesens abtrennt und es hingegen dessen Vereinigung bedingt, um miteinander in Erscheinung zu gelangen. Gerade dies ist auch in der pragmatischen Gegebenheit der Dialekte der Grundstock, sodaß hierin grundsätzlich das Selbst darin enthalten ist. Wie das Funktionswesen des Selbst aufweist, so ergibt sich dies aus dem zwangsweisen entweder-oder-Verhältnis des Geistes, zu dem es im Falle der Anwendung dieser subjektlosen Sprache das geistige Verhältnis zwingt, indem nämlich nur das Eine oder das Andere seine Anschauung erfahren kann. So ist aber auch die Grundlage dieser Sprache eine reine Gegenüberstellung mit dem darüber darstellenden Sein, zumal sich über die Ausgrenzung des Sinnlichen darüber auch die reine Versachlichung ergibt.

Hochsprache.svg

Es liegt somit in der Natur der Sache, wie es sich damit stellt, jedoch zeigt sich, daß man zu diesem Ursprung keinerlei Bezug herzustellen weiß, was jedoch ebenfalls daran gelegen ist, daß man dies über die hochdeutsche Sprache und somit über das Prinzip derer praktiziert. Zumal man zu dieser Funktionsweise des inneren Selbst gar nicht den erforderlichen Bezug darin ausgebildet hat, was sich spezifisch über das Verhältnis zum Bewußtsein und dessen enstandene Begrifflichkeit darlegt. Dies fand seine spezifizierende Begründung über » René Descartes « und seinem Prinzip, daß das Bewußtsein im grundsätzlichen Verbund mit dem Denken einher ginge, woraufhin » Christian Wolff « aus dem dialektischen 'bewüst seyn' dies als substanzielles (Substantiv) 'Bewust seyn' spezifizierte, man dem daraus entstandenen Bewustsein jedoch später noch ein weiteres 's' hinzufügte, um darüber hervorzuheben, daß es doch tatsächlich von 'bewissen' abstamme, was Descartes über seine Beschreibungen (in Latein) aufbrachte. Tatsache ist dem gegenüber, daß man bis heute kein anderes hervorgebracht hat, worüber die Empfindungen und Gefühle hervortreten, sodaß sich darüber ebenfalls wiederum die zwangsläufige Zuordnung des Geistes ergibt. Wie man daraus ersehen kann, ergibt sich bereits hierüber aus dem Einen das zwangsläufige Andere und hierin liegt auch der elementare Grundstock begraben, aufgrund dessen sich das Ganze ungehindert umsetzt, denn aus diesem Mißverhältnis heraus läßt sich auch gar nicht 'sachlich' zwischen fühlen und denken unterscheiden, insofern es nämlich keine funktionale Unterscheidung des Hervorbringenden gibt - das WAS bringt es hervor wird hierin grundweg dem Geiste zugeordnet. Die logischen Bezüge dazu gibt es indess sehr wohl, wie man über » Aristoteles « Aufbringen des 'koinê aisthêsis', sowie über dessen übersetzenden Inbetrachtziehungen des » Inneren Sinnes « erfahren kan, hingegen erfährt dies nicht seine erforderlichen Inbetrachtziehungen, was jedoch auf dem Urwesen beruht, worin es dessen außen vor stellens bedingt, um sich als solche umzusetzen.


in der Theorie des Civilrechts
Verlag: Arnoldische Buchhandlung

Das deutsche Billigkeit stammt von Bill, welches im Altdeutschen so viel war als Recht, empfundenes Recht, im Gegensatze des gegebenen, geschriebenen Rechts. Es scheint mithin zunächst eine allgemeine Rechtsnorm bedeutet zu haben, die neben dem positiven Rechte und zur Ergänzung desselben bestand, so wie mehrere Schriftsteller die römische Aequitas juris civil correctio oder emendatio nennen. Billig war dem Naturrechte gemäß und mithin mehr als der Billigkeit gemäß im heutigen Sinne. Auch das Zeitwort billigen, welches nicht bloß für billig, sondern auch für recht erkennen bedeutet, umfaßte ursprünglich mehr, als man dabei sich zu denken jetzt gewöhnt ist. Diese wahre Bedeutung ist aber fast ganz verschwunden, und daher kommt es, daß die Juristen, welche von der Existenz und der Stellung der aequitas im Sinne des römischen Rechts keine deutliche Vorstellung haben, von Billigkeit im jure civili nichts hören wollen, indem sie dabei über die Idee der moralischen, christlichen Billigkeit, als etwas mit der Ausübung des Rechts unereinbaren, die richterliche Willkür möglicher Weise befördernden, sich nicht zu erheben vermögen. Nun ist es vollkommen wahr, daß moralische Billigkeit, als etwas ganz subjectives, nur Sache der Parthei, nicht des Richters ist, mithin auch nicht Theil oder Gegenstand der Theorie des Rechts sein kann. Aber um so gewisser ist diese Billigkeit, in so fern sie in einem Nachlassen von der Strenge des Rechts besteht, der römischen Aequitas ganz fremd und spricht eben dadurch für die Wahrheit der Existenz dieses Begriffs in der Theorie des Rechts, an der deßhalb auch nie mit Grund gezweifelt worden ist. Jene setzt klare Bestimmungen des Rechts voraus, vollkommene Rechte, die aus subjectiven Gründen von dem Berechtigten selbst freiwillig gemildert werden; diese aber den Mangel positiven Rechts oder dessen Unbestimmtheit, welche die Schöpfung einer neuen Rechtsnorm, der auquitas selbst, als Vermittlerin zwischen jus und factum, nöthig macht, damit ein gegebener Fall nicht unentschieden bleibe, was bei einem wohl organisierten Rechtszustande, selbst in Ermangelung positiver Gesetze, nicht denkbar seyn kann, noch darf. Billigkeit im Sinne des deutschen Wortes finden wir im römischen Rechte und bei den Classikern vornehmlich durch humanitas, officium pietatis, benignitas, temperamentum benignitatis u.a. bezeichnet. Um von dem wesentlichen Unterschiede, der zwischen moralischer und, um die römische aequitas hier im Gegensatze so zu nennen, juristischer Billigkeit obwaltet, sich zu überzeugen darf man nur erwägen, wie die erstere von unseren ausgezeichnesten Moralisten definirt und ihrem Wesen nach bezeichnet wird.

Adelung, in seinem Wörterbuche der hochdeutschen Schreibart, sagt von Bill: dieses Wort ist von jeher am meisten von dem empfundenen Recht, dem Rechte der Natur gebraucht worden, im Gegensatze dessen, was dem gegebenen Rechte oder den eigentlichen Gesezen gemäß ist. Campe, in seinem Wörterbuche der deutschen Sprache, nennt die Bill geradezu ein Wort, welches ehemals das Recht bedeutete. Es ist zu bedauern, daß beide Sprachforscher sich nicht gründlicher über die ursprünglichen Bedeutungen dieses Wortes verbreiten. Wenn Campe a.a.D. von Bill sagt: es verdiene für dasjenige, was Recht und Gesetz werden soll, was es auch im Englischen bedeute, wieder eingeführt zu werden, so setzt er voraus, daß es diese Bedeutung gehabt habe, ohne jedoch eine nähere Nachweisung zu geben. Ueber den Ursprung des Englischen, auch im Französischen recipierten Bill habe ich keine genügende Auskunft gefunden. Das Wort Bill kommt in der englischen Sprache in andern, sehr verschiedenen Bedeutungen vor, die jedoch in keinem Zusammenhange mit dem altdeutschen Bill zu stehen scheinen. Nicht uninteressant ist es, das deutsche Bill und billig mit einigen Fremdwörtern zu vergleichen, die seine Ableitung aus dem Lateinischen zu rechtfertigen scheinen. Von dem lateinischen bilanx, zwei Waagschalen habend, also ein Mittel zum Abwägen, Erwägen, ausdrückend, stammt das italienische bilancia, die Waage, das Gleichgewicht. Davon bilicare, in's Gleichgewicht bringen, figürlich: wohl erwägen, und bilico, das Gleichgewicht. Alle diese Worte sprechen für eine Verwandtschaft mit dem deutschen Bill in Klang und Sinn und scheinen synonym mit aequum, aequitas, aequilibrium. Selbst die mit dem englischen bill verbundene Bedeutung, nach welcher es ein Vorschlag des Parlaments ist, der, wenn er von beiden Häusern genehmigt wird, mithin gleichsam in beiden Waagschalen der Erwägung aeque beurtheilt worden ist, durch königliche Genehmigung zur Parlamenstacte wird, spricht für die Verwandschaft mit dem deutschen Bill und den angeführten lateinischen und italienischen Worten.

Wie dieser Auszug aus dem Rechtswesen darlegt, worin nämlich das Billigen und Mißbilligen das Kernwesen des natürlichen Umganges begründete, in dem hierin das Empfindungs- und Gefühlswesen im Bezug auf die Sachlichkeit seine erforderliche Berücksichtigung erfuhr, so kann man dies in späterer Zeit gar nicht mehr nachvollziehen. Des Menschen reflektierendes Urteilswesen beruht auf zweierlei zugrundeliegenden Wesensarten: zum Einen auf dem von Empfindungen und Gefühlen, in dessen Verbund das Instinktive und Intuitive reflektiv hervortritt und davon separierend, auf dem des reflektierenden geistigen Willens und somit auch des Bewilligens, welche grundsätzlich beide funktional im Nebeneinander präsent sind, jedoch nicht bedingend miteinander im Einklang stehen. So ist der Ursprung auch in diesem Nebeneinander zu finden, sodaß sich hierin das Billigen und Bewilligen darin in seinem entsprechenden Nebeneinander darlegt, worüber dies auch auf die zugrundeliegende Bedachtheit verweist, daß der Mensch von seinem konstruktiven funktionalen Ursprungswesen und somit seines substanziellen Wirkwesens her, ein Empfindungswesen ist, dem sich erst in Erweiterung dessen das Geistwesen hinzugesellt, sodaß sich das Billigen als die Grundlage und somit Grundform stellt, in welchem es sich auf die Einheit dessen bezieht und das Be-willig-en sich als ein geistes Bezugswesen stellt. In der Wahrheitsfindung bedingt es, aufgrund der Gegebenheit auch primär der Feststellung, inwiefern die Aussage der eigenen Wahrheit entspricht oder sich dies als eine Lüge erweist, gemäß dem, inwiefern dies mit seiner Wesensart des Selbst in Einklang steht und erst sekundär stellt sich dies gegenüber der Wahrheitsfindung zur Sache selbst. Gerade die Lüge gibt es nämlich einzig im Geiste, wohingegen Empfindungen und Gefühle einem zwar trügen können, gemäß der Sinnestäuschung, jedoch nicht betrügen, gemäß der Lüge. Voraussetzung ist somit hierin auch, daß der geistige Wille im Einklang mit dem Wesen des Selbst in Einklang steht und dem gemäß handelt.

Dem gegenüber hat sich indess gerade diese Gegebenheit in die Umkehrung dessen verklärt, sodaß man nicht nur den geistigen Willen über den durch das instinktive Selbst sich Vermittelnde stellt, sondern gar Letzteres gänzlich außen vor stellt. So beruht jedoch gerade dies wiederum auf der Bewandtnis der Vereinbarkeit der Einheit von Geist und Hochsprache, sodaß es der Bedingung des außen-vor-stellen des Instinktiven bedingt. So ist denn auch das Billigen nach wie vor noch heute in allgemeiner und auch rechtlicher Anwendung, gemäß der Präsenz dessen natürlichen Erscheinen, dem gegenüber man jedoch sachtechnisch, wie man dem Autor entnehmen kann, bereits zu jener Zeit überhaupt keinen Bezug mehr herstellen kann, zu seinem Inhalt und Ursprung, da man diese Gegebenheit als solche gar nicht mehr ersah in den Neuerungen hochdeutscher rein geistiger Inbetrachtziehungen. Auch hierin wiederum trifft man auf den Umstand, daß der Mensch die Gegebenheiten rein aus der Sprache heraus zu fassen sucht, ohne in Betracht zu ziehen, was die Funktionaltität des Selbst darüber darlegt. Es ist somit noch nicht einmal ein reines Betrachten des Äußeren, sondern gar einzig der Bildnisse der Sprache, welche hierin zur Sichtung gelangen und somit dies auch der zwangsläufigen Willkür der Spekulation unterliegt, über welche man dann diese Sprache und Sache des weiteren ausbildet. Maßgeblich hierin ist jedoch, daß das außen vor Stellen nicht die Gegebenheit beseitigt und somit dessen Wirkwesen weiterhin sich fortsetzt, jedoch ohne seine erkennende Achtung zu erfahren, als solches auch nicht reflektiert. Man bedenke somit auch diese gravierende Wirkung, welche hieraus entsteht, daß insofern das Selbst keinen Anspruch erfährt, es damit verbunden auch außen vor stehen bleibt.

Während Albrecht über die Synonyme des Lateinischen aufklärt, oder konkreter, sie auzuklären sucht und dieser darüber dazu gelangt, daß es bei den Römern gar keine Klarheit darüber gab, erläutert hingegen in Nachfolgendem Eberhard das Verhältnis deutscher Gerechtigkeit, in dessen Synonymitäts- und Wirkwesen. So gilt es, sich darin vor Augen zu führen, wie dieser ein und dasselbe in den drei unterschiedlichen Anwendungswesen darlegt und sich darüber auch veranschaulicht, worin es seine reguläre Bewandtnis fand. Nämlich einzig in Ersterem, in welchem es um das reine Gewohnheitsrecht und somit des personell eingeschränkten Miteinander geht, welches auf der Vereinbarung untereinander beruht und in kurzen Worten die Klarheit gegeben ist, da es sich in sich klärt. Dem gegenüber verliert dieser sich gegenüber dem (durch Andere vor-)geschriebenen Gesetze in der Umfänglichkeit, da es darin gar nicht enthalten ist und zu vermitteln sucht, wie es denn Betroffene erfahren. Hierin liegt tatsächlich noch die Billigung beim Richter, jedoch bezieht sich dies darin auf das Maß der Ermessung des sachlichen Rechts. Im dritten Abschnitt hingegen nimmt dieser gar die Position des Betroffenen ein, welcher darin dem Rechtswesen gegenüber steht und darüber auch erfährt, daß es die Gefühle sind, dessen es darin entbehrt. Und so ist seine Schlußfolgerung jedoch noch nicht vollständig miteinander verknüpft, um daraus zu ersehen, daß es doch die reine Sachlichkeit der Sprache ist, aufgrund dessen dies auch die Gefühle gar nicht anspricht, sodaß ein solches Händling sich als nicht derart einwirkend stellt, als wenn die Gefühle als solche Bestandteil sind und als solche angesprochen werden. Der Geist steht darin regelrecht unbeteiligt anbei, ohne daß dies ihn berühren kann, sodaß dieser es auch dem entsprechend handhabt, da der unangesprochene Instinkt darauf nicht reagiert.


in einem kritisch-philosophischen Wörterbuche
der sinnverwandten Wörter der hochdeutschen Mundart

Dritter Theil - F-G
Verlag: Ruffsche Buchhandlung

Gerecht. Billig. - Gerechtigkeit. Billigkeit.

Die Fertigkeit, nichts gegen das Recht eines anderen zu thun, ist die Gerechtigkeit und Billigkeit; wer danach handelt, handelt gerecht und billig, und was beyden gemäß ist, das ist gerecht und billig. Obgleich das natürliche Gefühl schon diese Begriffe unterscheidet, und seine unentwickelten Urtheile darüber in der Sprache niedergelegt hat: so ist es doch nicht überflüssig, sie in einer allgemeinen Synonymik genauer zu zergliedern. Denn es ist nicht nur sehr angenehm, mit seinen Gedanken bey den Betrachtungen der ersten großen Grundpfeiler der allgemeinen Gesellschaft des menschlichen Geschlechts zu verweilen; die genauere Bestimmung dieser Begriffe, die von so großer Wichtigkeit sind, ist auch noch so wenig vollendet, daß kein Beytrag zu derselben unnöthig angesehen werden kann. Hingegen muß auch diesem, trotz des Titels darbietenden Verbundenheit zum Dialekt, gemäß des dritten Abschnittes, von anderer Stelle vermittelt werden, worin gerade die Grundlagen bestanden, worüber auch das seine Darlegung erfährt, was zuvor zur Rede kam, daß nämlich hierin die Gefühle das Persönliche ausmachen und ein elementarer Bestandteil des Gerechtigkeitsverhältnisses ist.

Divider

Die allgemeine Ansicht der Begriffe, die diese Wörter bezeichnen, führt auf den Unterschied, der der Gerechtigkeit die strengen oder vollkommenen Pflichten zu ihrem Gegenstande zutheilt, das ist, diejenigen, zu welchen wir können gezwungen werden, der Billigkeit hingegen die unvollkommenen, die Pflichten der Menschenliebe, die Niemand von dem Andern mit Recht erzwingen kann. Dieser Unterschied ist nicht unrichtig, allein er bestimmt den Begriff der Billigkeit noch nicht genau genug.

Denn zuvörderst gibt es eine allgemeine Gerechtigkeit welche sowohl die Gewissenspflichten der Menschenliebe als die strengen oder Zwangspflichten in sich begreift; die belohnt und bestraft, dem Wohlthäter mit Dank vergilt, das Verdienst schätzt, und dem Nothleidenden hilft, kurz der die Würdigkeit und Bedürftigkeit der Menschen eben so heilig ist, als das eigentliche Mein und Dein.

Von diesem allgemeinsten Begriffe ist sogar die Bedeutung des Wortes gerecht in der deutschen Sprache ursprünglich ausgegangen. Denn gerecht bedeutet wie recht, von dem es nur eine andere Form ist, das was seinem Grunde gemäß ist. So ist ein Kleid demjenigen for den es bestimmt ist, gerecht, wenn es ihm paßt, und also seine Größe und Form nach dem Körper, dem es anliegen soll, genau bestimmt ist. Eine Handlung ist in diesem Sinne gerecht, wenn sie durch den vernünftigen Grund, der sie bestimmen soll, bestimmt ist. Derjenige theilt Lob und Tadel gerecht aus, der in seinen Urtheilen über Andere keinen andern Gründen, als ihrem erforschten und erkannten Verdienste oder Unverdienste folgt. Die Gerechtigkeit will, daß wir einem jeden das Seinige lassen; denn das sind all die Güter, wovon wir aus vernünftigen Gründen mit völliger Gewißheit erkennen, daß sie zu ihm und zu keinem andern gehören.

Wenn also die Pflichten der Menschenliebe mit in der Tugend der Gerechtigkeit enthalten sind: so muß es noch einen besonderen Nebenbegriff geben, wodurch sich die Billigkeit von der Gerechtigkeit unterscheidet; und dieser ist die Ausübung seiner Rechte, so wie es der innern Verbindlichkeit gegen Andere, oder den Pflichten der Menschenliebe gemäß ist.

Die Gerechtigkeit kann nämlich von zwey Seiten betrachtet werden; zuvörderst von der Seite der Pflichten gegen Andere, sowohl der Zwangspflichten, als der Pflichten der Menschenliebe, und hiernächst von der Seiten der Rechte. Nach der ersten Seite erstreckt sich die Gerechtigkeit über alle menschlichen Handlungen; sie müssen all gerecht und also der Zwangsverbindlichkeit und der Verbindlichkeit zur Menschenliebe gemäß seyn. Nach der Seite der Rechte begreift sie nur die Zwangsrechte, und sie muß in ihrer Ausübung durch die Billigkeit gemäßigt, oder welches einerley ist, durch die Menschenliebe eingeschränkt werden, wenn der Mensch, der der Gegenstand und das Opfer derselben ist, nicht unter dem Gefühle der Härte sich soll beklagen zu haben.

Dieser Begriff der Mäßigung in der Ausübung strenger Recht ist folglich der erste, unter welchem einem jeden Menschen die Billigkeit erscheint. Die Gesetze der Gerechtigkeit schreiben mir meine Pflichten vor, und machen mich mit meinen Rechten bekannt; die Gesetze der Billigkeit schreiben mir vor, wie ich den Gebrauch meiner Rechte durch meine Pflichten mäßigen, einschränken, bestimmen muß. Der Billige ist auch in allen seinen Handlungen gerecht; denn er beobachtet alle seine Pflichten gegen andere, und mäßigt sich in dem Gebrauche seiner Rechte, indem er sich seine Ausbildung derselben bloß seine Rechte, er kennt auch seine Pflichten, und mäßigt den Gebrauch der Ersteren durch die Beobachtung der Letzteren.

Die erste Bestimmung unserer Rechte durch unsere Pflichten kommt bey den Rechten vor, die uns die positiven Gesetze geben. Da gibt es eine gesetzgebende, eine richterliche und eine vollziehende Billigkeit. Denn der Gebrauch dieser drey Gewalten muß durch die Pflichten und die Gesetze der natürlichen Gerechtigkeit bestimmt werden, wenn er der Billigkeit gemäß seyn soll. Und hier kann das nähmliche Gesetz ungerecht und unbillig heißen; aber in verschiedener Rücksicht; ungerecht, sofern es der natürlichen Gerechtigkeit oder dem Naturgesetz entgegen ist, unbillig, sofern der Gesetzgeber sein Recht nicht den Naturgesetzen gemäß gebraucht hat. Man hält das Gesetz für unbillig, daß der älteste Sohn das ganze väterliche Vermögen erbt, weil man glaubt, daß der Gesetzgeber dabey nicht die natürliche Gerechtigkeit zu Rathe gezogen hat.

Divider

Der angegebene Unterschied läßt sich auch, in Ansehung des Wortes billig, durch den Ursprung desselben rechtfertigen. Denn es stammt von dem veralteten Bill, gefühltes Recht, ab, wovon noch in den oberdeutschen Mundarten, insonderheit in der Schweitz, Unbill, gefühltes Unrecht, übrig ist. "Bill, sagt Lessing in den Beyer. zu e. d. Gloss. Das Unbill, indignatio, Unwillen". Es ist aber eigentlich das Unrecht durch dessen Gefühl die Indignation erregt wird. Die Billigkeit und Unbilligkeit wird aber mehr durch das Gefühl beurtheilt, und kann nicht in jedem Falle zu Jedermanns Befriedigung durch Zergliederung der Vernunft dargelegt werden. Die Quelle der natürlichen Billigkeit ist die innere Verbindlichkeit des Gewissens und die allgemeine Gerechtigkeit, angewandt auf den Gebrauch unserer strengen Rechte, und unter diese innere Verbindlichkeit ist es oft schwer, den Eigennutz und die Leidenschaft zu überzeugen, indeß man durch die Aussprüche der strengen Gerechtigkeit oder den Buchstaben der geschriebenen Gesetze alle Zweifel und Einwürfe zum Schweigen bringen kann. Inzwischen ist eine unbillige Behandlung oft schmerzhafter, als eine ungerechte, eben deswegen, weil sie tiefer gefühlt wird.

Nachfolgend einmal ein Muster aus den Verhältnissen des Mittelalters. Wie man dem entnehmen kann, so vermischten sich hierin die Übernahmen aus dem Latinischen und Griechischen, welche inhaltlich unerreichbar weit entfernt waren, mit den Kenntnissen und der Sprache eigener Herkunft, wie es jedoch auch zumeist üblich ist. Kern der Angelegenheit ist vor allem in der Zeit des Mittelalters, daß vor allem bei den alten Griechen, die geistige Betätigung eine besondere Stellung einnahm, auf dem Grundwesen der Anwendung von Sprache und Schrift, was hingegen anwendungstechisch auch von den Römern übernommen wurde und gerade darin die Begrifflichkeit noch eine Weiterentwicklung erfuhr. Dem gegenüber war jedoch nicht nur in unserem Lande, sondern zu jener Zeit des Mittelalters generell in unseren Breitengraden, das Handlungswesen rein auf den praktischen Nutzen ausgerichtet und so existierte auch kein Schriftentum, welches überhaupt derartige Beschäftigungen darboten, wie sie von den alten Griechen, Arabern und Römern herüber gelangten. Anwender waren zunächst auch einzig die christlichen Vereinigungen, derer es aufgrund deren Ausbreitung einer einheitlichen Sprache bedingte, vor allem jedoch auch zur Grundlagenschaffung für die Worte der in hebräisch verfaßten heiligen Schriften. Dem gegenüber ist zunächst das allgemeine Verwaltungsschriftentum der Ausbilder der Schriftsprache des Umgangswesens. Somit vermischen sich hierin auch die vorherrschenden Kenntnisse, mit dem, was die eigene und die diversen Sprachen besagen. Man vergleiche dies einmal mit Isidors Aufbringen, worüber sich verdeutlicht, daß man sich hierin zwischen den Welten befindet und gemäß nachfolgendem Abbildnis dessen, erfährt dies auch seine Anschauung. Der elementare Wandel, welcher sich vollzieht, ist somit aber auch, neben dem aufbringenden Inhalt, vor allem jedoch überhaupt das Aufbringen des Schriftwesen, welches als erneuernde Grundlage seinen Einzug erfährt. Das ist nämlich der elementare Wandel, welcher sich im Mittelalter vollzieht, daß nämlich die Schrift zur Grundlage des Daseins wird, wie man sich in aller Deutlichkeit vor allem über den Verlauf des Rechtswesens vor Augen führen kann, worin darüber das Personelle zum Allgemeinen wird und sich über die Jahrhunderte völlig umkehrt in seinem Ermessungswesen. Noch deutlicher wird dies über das Geld, worin zunächst die Wertigkeit des Gegenstandes die Grundlage der Ermessung ist, hingegen es sich dazu wandelt, den Wert nach der schriftlichen Bekundung auf einem Papier zu bemessen, gemäß eines Schuldscheins. Es ist das Maß des Ermessens, was sich hierüber generell umkehrt.

Konrad von Megenberg: Das Buch der Natur, Von den tiern
Universitätsbibliothek Heidelberg
Werkstatt Diebold Lauber
» D-Initiale mit Liebespaar «

» Buch der Natur (ca. 1350) «
Übersetzung von
» Conradus von Megenberg «
der Urschrift
» Liber de natura rerum (ca. 1230) «
» Thomas von Cantimpré «

Das Buch der Natur ist in 8 große Teilbereiche gegliedert, die in den Ausgaben der Prologfassung durch Pro- und Epilog gerahmt werden. Die Kapitel im Buch der Natur sind - mit Ausnahme der I., II. und VIII. Teilbücher - alphabetisch nach den lateinischen Begriffen der Themen geordnet. Diese Ordnung geht nicht über den ersten Buchstaben der Begriffe hinaus. Buch I umfasst Glieder und Organe des Menschen, die in der Reihenfolge von Kopf bis Fuß abgehandelt werden. In Buch II werden zunächst die himeln, dann die siben planeten und letztendlich die Elemente beschrieben. Die Planeten und Elemente sind nach den Himmelssphären (Kosmologie des Mittelalters) in absteigender Reihenfolge geordnet. Das Kapitel III A0 enthält eine Erklärung hinsichtlich der Ordnung der Tiere nach ihren Habitaten. Das VIII. Buch weist keine erkennbare Ordnung auf.

Buch I

I.0 Von dem menſchen in ſeiner gemainen natur. I.1 Von der hirnſchal. I.2 Von dem hirn. I.3 Von dem har. I.4 Von dem ſlaf. I.5 Von den augen. I.6 Von den augenbran. I.7 Von den oren. I.8 Von der naſen. I.9 Von dem part. I.10 Von dem mund. I.11 Von den czenden. I.12 Von der czungen. I.13 Von der ſtimme. I.14 Von dem aichleinn. I.15 Von dem uberual. I.16 Von der ſluntrorn. I.17 Von der luftrörn. I.18 Von der keln. I.19 Von dem hals. I.20 Von den achſſeln. I.21 Von den armen. I.22 Von den mäuſlein. I.23 Von den henden. I.24 Von den vingern. I.25 Von den negeln. I.26 Von den pain. I.27 Von dem margk. I.28 Von dem flaiſch. I.29 Von der haut. I.30 Von dem ruck. I.31 Von der pruſt. I.32 Von den pruſtlein. I.33 Von dem herczen. I.34 Von der lebern. I.35 Von der gallen. I.36 Von der lungen. I.37 Von dem miltz. I.38 Von dem pauch. I.39 Von dem magen. I.40 Von dem nabel. I.41 Von der plaſen. I.42 Von den nyeren. I.43 Von den adern. I.44 Von den pant adern. I.45 Von den czaichen, ob ein fraw ſwanger ſey. I.46 Von welhen ſachen ein fraw ſwanger werd eins knaͤbleins. I.47 Von den czaichen, ob ein fraw ein knaͤblein trag. I.48 Wie dye gepurd an dy werlt kom. I.49.1 Von den czaichen der naturlichen ſyten vnd dez erſten von dem har. I.49.2 Von der varb. I.49.3 Von den augen. I.49.4 Von der uberpra. I.49.5 Von den naſlochern. I.49.6 Von der ſtirn. I.49.7 Von dem mund. I.49.8 Von dez menſchen antlucz. I.49.9 Von den oren. I.49.10 Von der ſtymme. I.49.11 Von dem flaiſch. I.49.12 Von dem lachen. I.49.13 Von der wegung. I.49.14 Von dem hals. I.49.15 Von der pruſt. I.49.16 Von den rippen. I.49.17 Von den achſeln. I.49.18 Von den armen. I.49.19 Von den henden. I.49.20 Von den fueſſen. I.49.21 Von den ſchrieten. I.49.22 Welher kün ſey. I.49.23 Welher vorchtig ſey. I.49.24 Welher gutz ſyns ſey. I.49.25 Wer einen wolgeſtallten leib hat. I.49.26 Wer dy weiſhait lieb hat. I.49.27 Wer ſtumpfs ſynns ſey. I.49.28 Wer vnſchamig ſey. I.49.29 Wer czornig ſey. I.49.30 Von ainem vnkewſchen mann. I.49.31 Der ein weibiſchen mut hat. I.49.32 Von den poſen mannen. I.50 Von den trawmen.

Buch VIII

1 Von den wunderlichen prunnen. VIII.2 Von den wunder menſchen. VIII.3 Von den wunderleichen læuten.

Divider


von Conrad von Megenberg
Die erste Naturgeschichte in deutscher Sprache
In Neuhochdeutscher Sprache (neu gefaßt - )
Verlag: Julius Abel

46. Von den Ursachen der Empfängniss eines männlichen Kindes

Will man wissen, wodurch eine Frau ein männliches Kind empfängt und woraus ersichtlich ist, ob sie einen Knaben gebären wird, so ist zunächst zu bemerken, dass in den Fällen, wo das Sperma virile heiss und reichlich vorhanden ist, dieses die Oberhand besitzt, so dass durch die Cohabitatiou ein Knabe erzeugt wird. Eine weitere Ursache hierfür ist gegeben, wenn das Sperma grösstenteils aus dem rechten Testikel herrührt und in die rechte Seite des Uterus gelangt. Die rechte Seite ist nämlich wärmer wie die linke, und das Sperma aus dem rechten Testikel kräftiger wie das aus dem linken. Desshalb ist mein Rath, dass die Frau, wann sie eines Knaben genesen will, sich gleich nach der Cohabitation auf die rechte Seite legen soll. Einige geben auch an, dass, wenn das Sperma des Mannes aus dem rechten Testikel in die rechte Seite den Uterus gelange, ein Knabe gezeugt werde, wie ich vorher schon sagte, gerathe aber das Sperma aus dem linken Testikel in die rechte Seite des Uterus, so entstehe ein Mannweib. Kommt das Sperma aus dem rechten Testikel in die linke Seite, so entwickelt sich ein weibischer Mann. Wenn aber das Sperma aus dem linken Testikel in die linke Seite des Uterus geräth, so soll daraus ein Mädchen werden. Zur Erzeugung eines Knaben hilft ferner die Kälte der Luft, sowie das kältere Klima überhaupt, und der Wind, der vom Sternbild des Wagens nach Süden weht und lateinisch Aquilo heisst. Die Kälte treibt nämlich die natürliche Wärme in den Leib hinein und vermehrt dadurch die innere Wärme. Zur Entstehung eines Knaben ist grössere Wärme nöthig, wie zu der eines Mädchens.

49. Von den Kennzeichen des Charakters
ff - Wer einen weibischen Sinn hat

Ein weibisch gesinnter Mann ist ungeduldig, gegen Schmerz empfindlich, leicht verführt und ebenso leicht bekehrt, ebenso rasch erzürnt wie versöhnt. Bei allen Thieren sind nemlich zumeist die weiblichen Individuen äusseren Eindrücken leicht zugänglich. Sie sind auch listiger wie die Männchen, leichter zum Handeln bereit oder vorschnell und schamloser. So spricht Rhaazes. Die Frauen haben auch einen kleineren Kopf, schlankeren Hals und zierlichere Gesichtsbildung. Die Brust ist eng, die Schultern sind schmal, die untere Parthie der Brust und die Wölbung derselben ist weniger entwickelt wie beim Manne. Dagegen sind die Hüften und das Gesäss breit angelegt. Die Beine sind klein, Hände und Füsse zierlicher gebaut. Bei allen Thieren sind die Weibchen furchtsamer wie die Männchen.

49 gg. Von den Castraten

Ein Castrat oder Kappaun, das heisst ein Mann, der der Zeugungstheile entbehrt, ist böse veranlagt, denn er ist thöricht, habgierig und unüberlegt, und unternimmt in Folge dessen mehr, als er zu leisten im Stande ist. Wer aber nicht absichtlich castrirt sondern als Solcher geboren ist, oder dessen Genitalien ungenügend entwickelt sind, ist einem Kappaun zu vergleichen, auch wächst ihm niemals ein Bart. Solche Leute sind die bösesten unter Ihresgleichen.

Von den wunderbaren Menschen

Die Wundermenschen mit körperlichen Gebrechen besitzen entweder ihre Glieder nicht völlig oder in grösserer Zahl, als sie haben sollen. Der Ursachen hierfür giebt es mancherlei. Ein Hauptgrund ist der, dass die Frauen sich während der Cohabitation nicht richtig benehmen und hin und her bewegen, so dass sich der männliche Samen im Uterus theilt. Theilt er sich gleichmässig in der unteren und oberen Hälfte des Uterus, so entstehen Zwillinge, die dann zunehmen, wie sich Zwillinge zu entwickeln pflegen. Geschieht die Theilung des Samens nur oben und unten nicht, so entsteht ein Mensch mit zwei Köpfen und einem Unterkörper, der sich dann auch weiter entwickeln kann. Vollzieht sich die Theilung des Samens unten und nicht oben, so wird eine am Unterkörper gedoppelte Missgeburt daraus.

Es kommt auch vor, dass der Samen in reichlicher Menge vorhanden und besonders kräftig ist. Dieser lässt dann einen, über das gewohnte Maass grossen, Menschen entstehen. Ist dagegen bei geringer Quantität die Kraft des Samens vorwiegend, so fehlen der Frucht einige Glieder, zum Beispiel die Arme oder einige Finger oder die Füsse und Beine. Dasselbe ereignet sich auch dann, wenn die Quantität des Samens zwar zureicht, seine Qualität dagegen zu wünschen lässt. Aus wenigem und schwachem Samen entsteht ein Zwerg. Ist der Samen quantitativ grade genügend, seine Kraft aber zu stark entwickelt, so macht sie das Glied, für welches sie grade besonders in Betracht kommt, ausnahmsweise gross oder bringt es in grösserer Zahl hervor. Desshalb hat ein Neugeborenes oftmals einen grossen und einen kleinen Fuss oder einen grossen Kopf und einen kleinen Körper oder sechs Finger an jeder Hand beziehentlich sechs Zehen an jedem Fuss oder auch nur an dem einen und am anderen nicht. So hat man denn auch ein Kind gesehen, das elf Mundöffnungen und zwei und zwanzig Lippen hatte, allerdings unvollkommen entwickelt, wie denn auch das Kind todt geboren wurde.

Es ereignet sich auch, dass zwei wirksame Kräfte gleich stark sind. Die eine derselben wirkt nach der männlichen, die andere nach der weiblichen Richtung, und die Folge ist ein Geschöpf, das männlich und weiblich gleichmässig entwickelt und auch befähigt ist, sich nach beiden Seiten hin gleichmässig zu bethätigen. Leute mit beiderlei Genitalien heissen lateinisch Hermaphroditae. Ist die Vertheilung der in Frage kommenden Kräfte dagegen ungleich, so entwickelt sich das eine Genitale vollkommen, das andere dagegen nicht.

Wir finden auch, dass die Frucht im Mutterleibe sich nach dem Gedankengange der Mutter entwickeln kann. Deshalb sollen Schwangere keine unschönen Gegenstände betrachten, sondern schöne Menschen und schöne Bildwerke. Dies gilt besonders für die erste Zeit der Schwangerschaft, wenn die Natur die Frucht erst noch bildet und dieselbe noch nicht entwickelt ist.

Divider

» Enzyklothek «
Literaturhinweise


Untersuchungen zu seiner Text- und Überlieferungsgeschichte
Verlag: De Gruyter


von Konrad von Megenberg
Die erste Naturgeschichte in deutscher Sprache
Verlag von Karl


Das Wissen seiner Zeit
Verlag: C. H. Beck
Hrsg.: Claudia Märtl, Gisela Drossbach, Martin Kintzinger


Sachkunde und Dinginterpretation bei
Jacob van Maerlant und Konrad von Megenberg

Max Niemeyer Verlag


Die illustrierten Handschriften und Inukabeln
Böhlau Verlag

Divider

Thomas Cantimpratensis ()
Liber de Natura Rerum
Editio princeps secundum codices manuscriptos I

Verlag: de Gruyter
» «


Liber de naturis rerum - Redaktion III (Thomas III)
Reihe: Wissensliteratur im Mittelalter - Band: 54.1
Reichert Verlag
Hrsg.:

» Thomas Cantimpratensis «
Liber de natura rerum - version: Thomas III
Edition von Vollman-Hünemörder (1993)

Divider

» Der "Experimentator" (1998) «
eine anonyme lateinische Naturenzyklopädie
des frühen 13. Jahrhunderts
Dissertation von Janine Deus

Den Anlaß zum Thema der Dissertation gaben die Zitate im "Liber de natura rerum" des Dominikaners Thomas von Cantimpré (ca.1201-ca.1270), die Thomas einem anonym überlieferten Werk entnahm und die er einem sogenannten "Experimentator" zuschrieb. Christian Hünemörder entdeckte 1968 in Stuttgart bei seinen Forschungen zu Thomas eine Handschrift, in der sich die dem "Experimentator" zugeschriebenen Zitate teilweise wiederfanden. Weitere Nachforschungen förderten weitere Handschriften zutage (Sloane, Chambéry, sowie eine Kurzfassung desselben Werkes). Heinz Meyer entdeckte bei seinen Forschungen über das Werk "De proprietatibus rerum" des Franziskaners Bartholomaeus Anglicus, mit dem das Werk des "Experimentators" grundlegende Gemeinsamkeiten aufweist wie den fast identischen Prolog, den Werkaufbau und das verwendete Material, weitere Handschriften des "Experimentators". Aufgrund der Beziehungen des "Experimentators" zum Werk des Bartholomaeus Anglicus wird der anonym überlieferte "Experimentator" ebenfalls unter dem Namen des Bartholomaeus Anglicus und unter dem Titel "De proprietatibus rerum" in den Handschriftenverzeichnissen aufgeführt. Da der tatsächliche Zusammenhang beider Werke in weiten Teilen noch ungeklärt ist, wird hier der bislang zugeschriebene Titel "De proprietatibus rerum" nicht beibehalten.

Autoren der im Werk benutzten Quellen genannt: Isidorus von Sevilla (ca. 570-636), u.a. "Etymologiarum sive originum libri XX", Gregorius der Große (ca.540-604), u.a. "Moralia in Iob", Beda Venerabilis (672/73-735), u.a. "De natura rerum", Pseudo-Dionysius Areopagita (um 500), u.a. "Celestis Hierarchia", Basilius der Große (um 330-379), "Hexaemeron", Ambrosius von Mailand (um 340-397), u.a. "Hexaemeron"; für Buch XII fälschlicherweise Plato (anstelle von Johannes Platearius [Ende des 11.Jahrhunderts] und Mattheus Platearius [gest.1161] "Circa instans"); für Buch VI Aristoteles (384-322), u.a. "De celo", "Meteorologica", Pseudo-Aristoteles u.a. "De mundo", "De proprietatibus elementorum", Macrobius (um 400), u.a. "Commentarius in somnium Scipionis", Martianus Capella (Anfang des 5. Jahrhunderts n.Chr.) "De nuptiis Philologiae et Mercurii", Alphraganus = al-Fargani (gest. 816) "Rudimenta astronomica", "Differentie scientie astrorum", Ptolemaeus (2. Jahrhundert n.Chr.), u.a. "Almagestum"; für die Inhalte bezüglich der Komplexionenlehre (nach der das Überwiegen eines Saftes im menschlichen Körper, also Blut, Schleim, gelbe oder schwarze Galle, Aussehen, Charakter und Krankheitsdispositionen eines Menschen bestimmt) Aristoteles (384-322), "De animalibus libri XIX" und Constantinus Africanus (gest.1087), u.a. "Pantegni", "Viaticum", "De gradibus".

Als erstes wird eine Begründung für die Reihenfolge der im Werk zu behandelnden Themen gegeben: Die Darstellung folgt der Ordnung der Substanzen, da die Eigenschaften der Dinge dieser folgen. Als nächstes wird der Zweck des Werkes genannt: Es ist nützlich, um die Rätsel der Heiligen Schrift zu verstehen und das Haus Gottes zu errichten. In dem Werk sollen zuerst einige natürliche Eigenschaften, dann die künstlichen behandelt werden. Begonnen wird mit den unkörperlichen Substanzen, dann folgen die körperlichen. Es folgt die Übersicht über den Inhalt der einzelnen Bücher, wobei auffällt, daß entgegen der Ankündigung die künstlichen Dinge nicht behandelt werden.

So ist denn auch der Kampf gegen den Schriftglauben, den man in der Renaissance bekämpft, ein uraltes und noch heute bestehendes Mißverständnis gegenüber dem Glauben, speziell dem des Christentums, indem es darin eben nicht um die Ergründung und Darbietung der Göttlichkeit sich dreht, sondern um die Worte Gottes und somit der heiligen Schrift, womit der damit verbundene allgemeine Schriftglaube einher geht. Maßgeblich hierin ist, daß auch die aufkommende allgemeine ärztliche Versorgung sich über die Klöster und deren aufbringenden Kenntnisse vollzog, was auf den Übernahmen des griechischen Ursprunges beruhte und getreu der besagenden Worte seine Anwendung erfuhr, gemäß dem es sich auch darüber hinaus ausbreitete, gegen das Prinzip sich die Gegenwehr der Anatomen richtete. Die Worte der heiligen Schrift repräsentiert den christlichen Glauben und bildet die Grundlage der Ermessung. Tatsächlich jedoch erwirkt das ausführende Händling ein fälschliches Gesicht, da es derer drei Arten zu dessen umsetzenden Präsenz bedingt, nämlich für die allgegenwärtigen Grundlagen des Seins, der Theosophie, zur Übertragung der Worte der heiligen Schriften und damit verbunden, der Worte Gottes, der Theleologie und zur Vermittlung der daraus entstehenden Lehren der Theologie. Zumal man darin auch speziell zwischen dem göttlichen, weltlichen und menschlichen Verhältniswesen unterschied, da es ja doch vor allem auch um die Vermittlung sich dreht, als ein dazwischenstehender Mittler darin zu funktionieren. So trifft man es auch weitläufig an, daß sich Theosophie und Philosophie überschnitten und auch im Nebeneinander und kombiniert miteinander einher gingen und es sich gar als gravierendes Mißverhältnis stellt, daß die Philosophen gerade dieses Dreiecksverhältnisse gar nicht in Betracht zogen. Doch auch diese Trennungen ersieht man nicht, wie auch, daß zwischen Esoterischem und Exoterischem ein gewaltiger Unterschied besteht, sodaß gerade in dem Bezug auch die Bildnisse darüber nicht wirklich aufklärend sind, da sie die Unterscheidungen nicht achten, die das Wesentliche ausmachen.

Elementar ist, daß gerade in diesem Dreieck die erforderliche Grundlage steckt, nämlich das Verhältnis von Sein, der Wahrnehmung dessen und die Vorstellung darüber. Inwiefern unterscheidet sich die Vorstellung als solche von dem Glauben? Inwiefern entspricht das, was man sich vorstellt, der Wahrheit? Und inwiefern ist das, was man wahrnimmt das, was sich darüber vermittelt? Des Menschen Dasein bestimmt sich vor allem darüber, daß sich diesem das Sein einzig über die Wahrnehmung von Wirkungen vermittelt und sich darüber versinnbildlichende Abbildnisse ergeben. Es ist somit auch grundsätzlich eine Gratwanderung zwischen den Weltsichten des Daseins. Und einzig, indem man diese funktionalen Gegebenheiten voneinander trennt und für sich im Nebeneinander in Betracht zieht, ergibt sich überhaupt erst eine einrichtbare funktionale Einheit dessen. Inwiefern hat man sich indess in der Entwicklung mit der Illusion beschäftigt, was es damit auf sich hat und wie dies funktioniert? Man wird es nicht antreffen, sondern einzig im Bezug des Glaubens die relative Beschäftigung damit erfahren. Jedoch nicht, weil der Glaube sich als Illusion stellt, sondern im Gegenteil, da der Glaube das wahre Sein repräsentiert, welches man darin handhabt. Das man sich hierin auf die Worte der heiligen Schrift fixiert, mag darüber täuschen, jedoch handelt es sich hierbei im Kernwesen um Gleichnisse, an dem sich das Sein ermisst, wie es auch Isidor in seiner Prinzipialität vorführt. So ist es denn auch als ein gravierendes Mißverhältnis zu ersehen, daß die katholische Kirche in Verbindung mit ihrer Neubegründung im 19. Jh., die Ergründungen fortan untersagt und die Lehren auf die von Thomas von Aquin zurücksetzt. In die Zeit nämlich, wo das Regulat noch ein ungestörtes war, hingegen sich im Verlaufe alles mögliche dort hinein vermischte und das Regulat als solches sich letztendlich nicht mehr umsetzen konnte.

Philosophie   Theleologie
anima vegetiva spiritus vegetativus
anima sensitiva/sentiens spiritus animalis
anima rationalis spiritus rationalis

So erfährt aber auch die entstandene Philosophie durchweg gar keine Eigenständigkeit, was sich darüber darlegt, daß darin einzig das Verhältnis einer Philosophie des Geistes anzutreffen ist und somit ein relatives Verhältnis des 'Spiritus' des Christenglaubens, über das sie nie hinaus reichten und über die aufkommenden Naturwissenschaften sich gemäß der ausbreitenden Physis und dem Dualismus des einstigen Materie-Energie-Verhältnisses spezifizierend ausgrenzen ließ und somit im Leib-Seele-Problem versandete. Gerade darüber zeigt sich jedoch, daß sie einzig die Worte, aber doch in keiner Weise den griechischen Ursprung übernahmen, denn darin besteht dieses Verhältnis eben nicht. Darin repräsentiert die Seele - das Leben - die Substanz und der Körper ist die Form, über die es sich erhält und trägt. Man verdeutliche sich hierzu den Werdegang der Naturwissenschaft, worin diese im Verlaufe selbst die Energie als Materie definiert und man in der Ergründung der Atome letzendlich darin mündete, gar kein materielles Atom ausfindig machen zu können. Darüber kann man sich den Ursprung verdeutlichen, indem man nämlich die Gegebenheiten gemäß Wirkwesensarten in Betracht zieht, welche man gemäß des Wahrnehmungsverhältnisses als substanzielle Objekte erfährt. Die Substanz, welche den Raum erfüllt, ist hingegen nämlich tatsächlich gar nicht wahrnehmbar, da die Wahrnehmung darauf beruht, einzig Wirkungen wahrzunehmen, aufgrund dessen die raumausfüllende Substanz einzig indirekt erfahrbar ist, da sie selbst keine Wirkung ist - und auch nicht enthält, wie man es in der Naturwissenschaft vermutete. Darauf basiert das gesamte Mißverhältnis, welche das Verhältnis zum Substanzwesen bis zur Gegenwart durcheinander bringt, da man nämlich hierin nicht die Funktionalität der Wahrnehmung gemäß der Erfordernis ergründete. Gerade dies ist nämlich einzig über die Ergründung im Selbst, gemäß seiner darin präsenten funktionalen Gegebenheit ergründbar. Und gerade diese introspektive Analyse ist es, die fortwährend systematisch außen vor gestellt wird, obwohl das Selbst gerade den Bestandteil hervorbringt, welcher uns das Sein vermittelt und auch einzig darin in seiner wahrnehmungsgetreuen Funktionalität ergründbar ist. Es ist nämlich nicht das äußere Auge, welches wahrnimmt, sondern dieses Auge vermittelt einzig, sondern es ist das innere Auge, welches ersieht und somit auch ein elementarer Unterschied, was darüber ersehen wird - das Selbst ersieht.

Was gravierenderweise allzu leichtfertig übersehen wird ist, daß gerade über die diversen Vorgänge der Entwicklung, vor allem auch eine elementare Selbstfindung des Menschen einher geht, was sich herrausragenderweise über die Renaissance darlegt, in welcher man das eigene Erleben und die eigene Erfahrung, als Kontrapunkt dem durch das Schriftwesen Vorgegebenen gegenüber stellt. Wer einmal in diesem Kontext die stattgefundenen Entwicklungen in Betracht zieht, wird genau dieses Kernwesen darin antreffen, in jeglichen Verhältnissen der Umstürze, indem nämlich in jeglicher Entwicklung, an jeglichem Anfang, die Vorstellung und schriftsprachliche Präsenz über eine Sache im Raume stehend, eine daraus erfolgende spezifische Ergründung und dessen Aufklärung erfährt. Das Gestaltwesen hierin erweist sich jedoch als ein beständiges Tauziehen zwischen diesen beiden Weltsichten, dessen Grundlage die Kontroversität von Wahrnehmung und Vorstellung repräsentiert, dem gegenüber man jedoch den Kern dessen durchweg nicht erkennt, daß es sich um verschiedene Weltsichten handelt, die nicht von der gleichen Warte ausgehen und somit des zu trennenden Nebeneinanders bedingen, dem gegenüber nämlich die bekämpfenden Erstrebungen der Vereinigung beständig wiederum zerstörend einher gehen. Sprache ist generell nur ein Hinweis auf das Sein und über die Bildnisse der geistigen Vorstellung, stellen sie beide sich dem Verhältnis der Wahrnehmung über das Sein dem gegenüber - sind nicht das Sein selbst - hingegen begründet sich über die sinnliche Wahrnehmung, über das Erlangen der Wirkungen aus dem Sein heraus, der direkte Draht zum Dasein des Seins. Die Grundlage basiert darauf fußend auf der funktionalen Unterscheidung des Wahrnehmungs- und Sinnlichkeitswesens gegenüber dem Vorstellungswesen, welches sich über das Bewußtseinswesen vereinigt, es jedoch der trennenden Erachtung bedingt, um dies aufeinander einzurichten und gemäß der funktionalen Erfordernis miteinander zu koordinieren. Wiedergebende Schriften des jeweiligen Daseins repräsentieren die Sammlung und Bewahrung von Erlebnissen und Erfahrungen. Hierin findet eine fortschreitende Entwicklung statt, dem gegenüber jedoch der Mensch sich im Verlaufe gar nicht verändert hat und dieser mit seiner Geburt ohne dies da stehend, sich jeweils wieder von Neuem erst einmal die Erfahrung aneignen muß, um darüber überhaupt zu verfügen. Das man dies hierin gar derart handhabt, daß das Alte etwas Unnützes sei, da man ja Neues habe, was dies ersetze, stellt sich als ein gravierendes Abstrusum, denn wie sich zeigt, entspricht das Neue, mit dem wir uns vor allem heute umgeben, in keiner Weise dem Alten und so ist darin auch nicht die Erfahrung enthalten, zu der man einst gelangte.

So ist es denn auch dergestalt, daß man in der Ergründung des Seins ein nachvollziehendes Verständnis überhaupt erst einmal ausbilden muß. Und insofern wer zu einem Solchen gelangt ist, bedingt es anderen, dies gemäß dem auch nachzuvollziehen. So ist Derjenige, welcher den speziellen Bezug zur Seele ergründete und darüber Bildnisse begründete, Aristoteles gewesen, sodaß sich hierüber ein spezifisches Maßwerk heraus ergibt, worüber man das Verhältnis der einstigen Anatomie dessen ermessen kann. Inwiefern hat jedoch überhaupt wer Aristoteles' Aufbringen überhaupt gemäß des Seinigen nachvollzogen? Über Salatowsky erfährt man eine spezielle Inbetrachtziehung dessen, worüber sich vor allem jedoch verdeutlicht, daß die Sache selbst rundum doch gar nicht die Grundlage bildet, sondern die Grundlage die Ersichtung der Sache vorgibt. So existieren auch dem gemäß unzählige Wiedergaben ein und desselben. Und doch läßt sich aus dem Ursprung das Aufgebrachte selbst ermitteln, indem man es dem Jeweiligen gegenüber stellt und sich gerade darüber jedoch auch wiederum das Selbst erhellt, was darüber seine Inbetrachtziehungen aus den diversen Warten heraus erlangt. Inwiefern können jedoch Worte das Sein selbst wiedergeben? Sie können es tatsächlich gar nicht, denn sie sind nicht das Sein selbst. Somit ist denn auch grundsätzlich in Augenschein zu nehmen, worauf die Worte hinweisen und darüber ergibt es sich - ansonsten eben nicht.


Die Rezeption der aristotelischen Psychologie
im 16. und 17. Jahrhundert

Verlag: B. R. Grüner

S. 99: Amberbachs Verständnis für des Entelechiebegriffs

Amerbach beginnt die Erörterung der Seelendefinition mit der gewichtigen Frage, ob Cicero mit seiner Deutung der έντελέχεια als ένδελέχεια den Aristoteles mißverstanden habe. Um diese Frage zu beantworten, versucht er die originäre Ansicht des Aristoteles über die Seele zu ermitteln, dessen Definition er unter Hinweis auf De An. II 1, 412a19-21 sowie 412a27f. wie folgt paraphrasiert: "Die Seele ist daher Substanz als Form, oder sie ist die erste Vollendung eines natürlichen, mit Organen versehenen Körpers, der in Möglichkeit Leben hat." Anders als Melanchthon nimmt Amerbach damit auf korrekte Weise Ausgang vom Begriff substantia (ούσία), die er unter Hinweis auf De An. II 1, 412a6-10 genauer als forma (είδοζ) bzw. als 'actus primus' (έντελέχεια) bestimmt. Dabei läßt er keinen Zweifel daran, daß das Wort έντελέχεια eine 'perfectio' bezeichnet und von Themistius (sic!) richtig von τέλοζ & έχειν hergeleitet worden ist.

Im Wissen um die vielfache Bedeutung des Begriffs ένέργεια fügt Amerbach sogleich hinzu, daß die Gleichsetzung mit dem Begriff έντελέχεια nur dann gerechtfertigt ist, wenn sie gerade 'nicht' als 'motio', sondern als 'perfectio' verstanden wird. Perfectio beschreibt nämlich einen Zustand, in dem ein Ding sein Ziel in sich enthält. So ist die Seele Vollendung eines Lebewesens, ohne der es ein solches gar nicht wäre, es sei denn auf bloß homonyme Weise. Denn als 'forma' beseelt sie das Lebewesen, gibt ihm sein Sein, das sich in seiner Gestalt (είδοζ) kundtut.

Diesen Prozeß, so Amerbach, nannte Aristoteles genauerhin 'actus primus', denn ein Lebewesen sei auch dann beseelt, wenn es nicht aktuell tätig sei im Sinne des 'actus secundus'. Amerbach erklärt diese Differenzierung zwischen den beiden unter Hinweis auf De An. Il 1, 412a22-27, wo Aristoteles die Entelechie zum einen mit der Wissenschaft (ωζ έπιστήμη) und zum andern mit dem aktuellen Vollzug von Wissen (ωζτό θεωρείν) vergleicht. Hieraus folgert er, daß die Seele offensichtlich eine έντελέχεια im Sinne der Wissenschaft als ein Habitus ist. Wie dies zu verstehen ist, verdeutlicht er mit einer zweiten Analogie: Mit dem Dasein der Seele gibt es auch Wachen und Schlafen. Dabei ist das Wachen dem Vollziehen von Wissen vergleichbar, der Schlaf der Wissenschaft als Hexis ohne Vollzug (μή ένεργείν, 412a26). Früher aber der Entstehung nach ist die Wissenschaft. Aus diesem Vergleich ergibt sich nun, daß die Seele eine έντελέχεια ή πρώτη ist, d. b. ein Zustand (habitus), in dem ein Lebewesen gleichsam untergründig sein Telos in sich enthält, ohne 'actualiter' tätig sein zu müssen. Die Seele ist dergestalt, so Amerbach, Quelle und Prinzip aller Tätigkeiten, eben 'actus primus'. Das bedeutet auch, daß die Seele Prinzip der Bewegung ist, nicht die Bewegung selbst, wie bereits Aristoteles gegen Plato betont habe (vgl. De An. I 3) und wie erneut gegen Cicero betont werden müsse. Vielmehr sei die Seele unbeweglich, wie aus De An. II 4, 415b9ff. ersichtlich sei. Folglich sei jener Starrsinn, der sich noch heutigentags auf die ciceronianische Schreibweise der ένδελέχεια berufe, obwohl die Codices allesamt έυτελέχεια überliefern, zu bekämpfen.


Transformationen zwischen Renaissance-Aristotelismus und Frühaufklärung
Verlag: frommann-holzboog

"Das bedeutet auch, daß die Seele Prinzip der Bewegung ist, nicht die Bewegung selbst"

Hierzu gilt es mir, meine unphilosophische und unwissenschaftliche Ergründung des Seins, auf den Punkt gebracht, an dieser Stelle wiederzugeben, dessen Umfänglichkeit ich über mein » 2.Buch « darlege und im » 1. Buch « den Kern des Ganzen veranschaulische. Ausgangspunkt der Ergründung war zum Einen die Präsenz der Auswirkungen meiner mentalen Veranlagungen, worüber sich die diversesten Widrigkeiten mit meiner personellen Umwelt ergaben, sowie auch maßgeblich die entstandenen Auswirkungen damit verbundener Lebensumstände, welche letztendlich mein über das Erleben erfahrenes Grundprinzip über das Sein - die Realität - gänzlich in Frage stellte. Als das, woraus dies resultierte, erwies sich der Umstand, daß man gar allgemein die Wahrnehmung aus der (von anderen übernommenen) Vorstellung heraus abbildet und nicht, wie es sich regulär ausbildet, aus der Wahrnehmung heraus die Vorstellung ausbildet. Speziell aus dem Grund stellte ich auch die Lehren grundsätzlich als solche zunächst außen vor. Und darin besteht auch der wesentliche Unterschied meines Aufbringens, zu dem ich heute Parallelen ergründe, die sich immer weiträumiger auch ergehen. Elementar war hierin, daß ich rein pragmatisch mein Selbst ergründete, wie dies in mir drinnen funktioniert und aufgrund welcher Umstände dessen Funktionsweise zu jener Zeit gestört wurde. Ausgangspunkt und auch im Verlaufe sich fixierende Grundlage, wurde spezifisch die Funktionalität, worüber sich 'ein Etwas' als solches darbietet (gemäß Werden, Sein und Vergehen nämlich). Jegliche Einheit des Seins, welche man antrifft, weist eine ganz spezifische Funktionalität auf, anhand dessen man dies auch generell unterscheidet, mit dem wesentlichen Unterschied, daß man dem dies als Eigenschaft zueignet, welche diesem hingegen gar nicht gegeben ist (was sich nämlich über Werden, Sein und Vergehen in aller Klarheit aufweist - im Gegenüber zur Funktionalität!). Zum Anderen sind jedoch die funktionalen 'Instrumente', welche man über das Innenerleben erfährt, gar nicht als solche ersichtlich, sondern einzig deren Wirken und deren Spezifikation ergibt sich über die Differenzierung der jeweiligen spezifischen Funktionsweise (Geist, Bewußtsinn, Erinnerung, Instinkt, mentale Veranlagungen). Und doch nennt man sie allgemein bei ihren bezeichnenden Namen 'gemäß' ihrer subtanziellen Präsenz! Beim Vergleich mit dem äußeren Sichten ergab sich mir Gleiches, denn auch bezüglich eines Steines, gelangt nicht dieser zur Wahrnehmung, sondern einzig dessen reflektierenden Wirkungen - dieser kann als solcher gar nicht in die Wahrnehmung gelangen, sodaß sich spezifisch aufgrund der Funktionalität der Wahrnehmung überhaupt das Ganze aufklärt. Hierüber sind nämlich einzig Wirkungen wahrnehmbar! Dahinter steht nämlich das Prinzip des Seins, worin der substanziell erfüllte Raum durch die Zeit mit Bewegung erfüllt ist und sich darin die Einheiten gemäß präsenter funktionaler Prinzipien erfüllen (erfüllter Raum ↔ Bewegung ↔ Funktionalität!). Das jeweilige Selbst der Konstanz einer Einheit ist ein Bündniswesen dessen, welches entsteht und vergeht, gemäß seiner Vereinigung dessen. Die als solche erfahrende Körperlichkeit indess, ist gegenüber den reinen Wirkwesen, welche auch unabhängig davon als Wirksubstanzen existieren, ein Verbund der Wirkungseinheit mit der raumausfüllenden Substanz (Seele & Körperlichkeit). Und so ist auch die Seele einzig lebendig und als solche präsent, insofern sie dem Funktionsprinzip entspricht, in seinem Verbund mit der Körperlichkeit, in dessen Verbund man deren Eigenschaftswesen bestimmt.

Die 'Seele' ist somit gemäß obiger Worte, die Entsprechung der funktionalen Erfüllung - einerseits in seiner funktionalen Voraussetzung und andererseits, gemäß dem sie es ausfüllt - das Prinzip dessen und die Erscheinung dessen repräsentierenden Seins, wird hierin unterschieden. Man verdeutliche sich dies anhand der Unkörperlichkeit der Liebe, welche aus der Resonanz der Wirkungen zweier sich Liebender heraus hervorgeht, wohingegen sich das Begehren aufgrund seiner einseitigen Unerfülltheit dessen, gemäß eines Bestrebens darin separiert. Die Liebe ist als solche nicht gegeben, sondern ihre Präsenz entsteht erst über die Erfüllung und vergeht auch mit dessen Auflösung der resonierenden Ausfüllung. So ist einzig der Funktionalität die unauslöschliche Kontinuität der Präsenz gegeben, hingegen beinhaltet diese nicht die funktionale Ausfüllung, sodaß dies ohne dies auch nicht in Erscheinung tritt. So ist aber auch das Fortleben der Organismen daran gebunden und kann aus keinem anderen entstehen, da nur darüber die Grundvoraussetzungen weitergegeben werden, worüber sich das Leben, gleich dem vormaligen fortpflanzt, da hierin der Verbund über die Kontinuität darin seine Fortsetzung erfährt. Man bedenke hierzu, daß in obiger Ausführung der stattfindende Kontrapunkt zwischen Aristoteles und Plato dahinter steckt und wie die vielfältigen Auseinandersetzungen darbieten, doch tatsächlich sich beide im Rechten befinden, doch beiden gleichermaßen das Puzzleteil fehlt, welches diesen Zwiespalt verschließt. Hätte man die Intensionen, statt in all der Zeit einzig dem Geist, hingegen der Wahrnehmung gewidmet und der Funktionalität, wie es leider nur einige Wenige taten, so wäre auch nicht eine solche Verwirrung entstanden, wie sie daraus hervorgegangen ist.

Für das weitere Aufzeigen gilt es sich vor allem diesen zentralen Aspekt der zwischenzeitlich einzig noch auf den wissenschaftlichen Fundierungen bestehenden Präsenzen sich zu verdeutlichen. Gerade dies stellt nämlich das Innenerleben, wie wir es in unserem persönlichen Selbst erfahren, darüber gänzlich außen vor, zumal dies generell als eine rein geistige Erscheinung erachtet wird, dem gegenüber jedoch unser Gefühlsleben gar keine geistige Erscheinung ist, sondern im Gegenteil, kann dies darin gar nicht in Erscheinung treten, außer als eine Versinnbildlichung, warum es auch einzig derart überhaupt seine Erachtung findet. Während jedoch in den philosophischen Verhältnissen die Ergründung aus dem Selbst heraus die Grundlage bildet, so ist dieses Selbst hingegen über die Augen gar nicht ersichtlich und somit auch nicht Bestandteil wissenschaftlicher Einsichten. So basiert auch die philosophische Eingrenzung auf den Geist vor allem auf der sich über den ganzen Körper ausbreitenden wissenschaftlichen Vereinnahmungen, wie man zwischenzeitlich auch generell sämtliche Erklärungen den wissenschaftlichen Grundlagenverhältnissen zuschreibt, jedoch generell sich dies auf die den Augen zugänglichen Äußerlichkeiten beschränkt. Die Entbehrung, mit welcher man aufgrund dessen konfrontiert ist, basiert somit vor allem darauf, das für die diversen Wirkwesen, welche unser Innenerleben aufweisen, nie spezifizierende Ergründungen stattfanden und vor allem auch nicht, worüber dies in seiner funktionalen differenzierenden Art hervortritt. Die Mentalität, welche das Kernwesen der sexuellen Differenzierungen ausmacht, unseren Charakter und auch unsere Begabungen repräsentiert, sind veranlagte Gegebenheiten, die nicht des Geistes Grundlage entspringen, sondern mit dem Instinktiven und Intuitiven einher gehen. So sind indess speziell die wissenschaftlichen Errungenschaften jedoch dem gegenüber darin förderlich, deren Präsenz zu spezifizieren, über deren hervorbringenden Eingrenzung des Körperlichen und Augensichtlichen, denn sie sind eindeutig nicht Bestandteil dessen, was diese auch nachweisen. Hingegen ergibt sich gerade über diese Negation ein klärendes Bildnis über unser inneren Auges Ersichtung dessen, was sich diesem über unser Sinnlichkeitswesen repräsentiert. Man bedenke hierzu nachfolgendes Bildnis, worüber es zu verdeutlichen gilt, wie es mit der Innerlichkeit verhält und einzig darüber in Erscheinung gelangen kann. Es ist nicht nur die Subjektivität, welche speziell von der Wissenschaft außen vor gestellt wird und sich deren Verhältnis dem gemäß als rein objektiv stellt, sondern dies basiert auf dem außen vor stellen des Subjekts selbst. Gerade darauf basiert jedoch das Kern der Wesensart der Lebewesen.

Würfel

Gemäß dem sprachtechnischen Mißverhältnis, welches damit einher geht, ergibt sich jedoch aufgrund der relativen Präsenzen des Jeweiligen dazu doch eine Spezifizierung, sodaß sich hierin die Physis, das Mentale und das Intelligible, in Relation seines Ursprunges 'Nous', voneinander separiert. Was dem hingegen zentral fehlt, ist die spezifische Unterscheidung der Eingrenzung dessen, was Letzteres, nämlich widerum spezifizierend auf den Geist, eigentlich repräsentiert. Nicht erst seit Descartes, jedoch vor allem durch diesen konkretisiert, wird nämlich dem Geist die Wahrnehmung zugeordnet, wobei gerade dessen Hervorhebung des Aktes der Bewußtwerdung, was jedoch nicht nur bei diesem, sondern generell einzig im Bezug auf das Bewußtsein seine Inbetrachtziehung erfährt, die Gegebenheit klärt, daß diese gar nicht vom Geist ausgeht, sondern, wie hingegen in aller Klarheit über Locke's Beschreibung der Entstehung des Geistigen, aus dem Erfahren durch die Sinne Eingehendes in die Erinnerung und erst aus diesem heraus gespeist wird. Was dem Ganzen fehlt ist, daß die Bewußtwerdung der Vorgang ist, welcher sich funktional von dem des geistigen Projizierens spezifisch separiert und sich gemäß der Eigenständigkeit der Funktionalität, der Hervorbringung der Bewußtwerdung, bezeichnend als Bewußsinn stellt, parallel dazu aber auch gemäß seines alles miteinander kombiniert miteinander Zusammenführenden des 'Ersehens', sich auch als Inneres Auge bezeichnet. Wer sich die diversen Inbetrachtziehungen verdeutlicht, wird hierüber erkennen, daß man einzig das 'Bewußtsein' in Betracht zog, zumal man diese elementare Relevanz gar regulär gänzlich außen vor stellt, jedoch in keiner Weise der spezifische Hervortretungsvorgang der Bewußtwerdung seine erforderliche Erachtung erfährt. Elementar ist, daß dies die Voraussetzung ist, um nicht nur die Unterscheidungen der Wirkungen, welche in diesem kombiniert miteinander hervortreten, aus dieser Warte heraus, voneinander sondieren zu können, sondern überhaupt das spezifizierende und darüber unterscheidende Erkennen der mentalen Organe und Sinne einzig darüber gegeben ist, so vor allem auch die zentrale Unterscheidung von Sinnesreizen/Gefühlen, Wahrnehmung, sowie Vorstellung/Denken. Hingegen verfügt man über die klare Unterscheidung auch darin nicht, da man aufgrund des Fehlens der Berücksichtigung des Bewußtsinnes es der Unterscheidungen der Wahrnehmungsverhältnisse entbehrt.

Bewußtsinn

Maßgeblich hierin ist die Zweiseitigkeit, welche sich hierin funktional ergibt, denn einzig in der regulären bewußten Wahrnehmung sind auch die Sinnlichkeiten mit enthalten, wohingegen in die Erinnerung einzig eine Versinnbildlichungen dessen gelangt und somit auch im Geiste als solche nicht in Erscheinung treten. Im Verbund mit der Sprache tritt hierüber ein gravierender Gegenseitigkeitseffekt auf, aufgrund dessen eine sich trennende Zweiseitigkeit dessen auftritt. Dies ist auch der Grund, warum man die Sinnlichkeitswesen als solche in Sprachverbundenheiten generell nicht antrifft, da sowohl der Geist, wie auch die Sprache ein solches nicht beinhalten und hervorbringen. Um somit speziell sein Selbst bezüglich der mentalen Veranlagungen über die Reflektionen der Wirkungen zu erfahren, bedingt es somit auch der speziellen wahrnehmungsgemäßen Ausrichtung darauf. Jegliche Wirkung, welche auf das Selbst trifft, wird von diesem reflektiert, sodaß man daraus auch in seiner Relation das Selbst daraus in Erfahrung bringen kann. Darauf basiert auch die grundsätzliche Individualität des Einzelnen, daß jegliche Einwirkung vom Selbst heraus reflektiert wird, sodaß bei Jedem aufgrund seiner individuellen, jedoch innerhalb dessen begrenzten Einrichtung und dem sich ausbildenden Leben, sich diese Unterschiede ergeben. Dies bedeutet auch, daß der Mensch in seinem regulären Dasein grundsätzlich subjektiv ist, dem gegenüber somit auch die Objektivitäten als solche sich separieren. Es gibt hierin kein entweder oder, denn es gibt grundsätzlich beides, da unser Lebensverhältnis auf dem der Wahrnehmung beruht und aufgrund dessen sich das wahrnehmende Subjekt gegenüber dem, was es wahrnimmt grundsätzlich separiert. Speziell jedoch die Vereinbarkeit ist es, was dies wiederum vereinigt, was von spezieller Tragweite ist, denn dies gilt auch gegenüber dem eigenen Selbst. Das Erfahren des eigenen Selbst ist somit auch abhängig, inwiefern man seine Aufmerksamkeit daraufhin einrichtet.

Gerade dieser Part des Mentalen des Selbst, ist wie sich aufweist, jedoch generell außen vor gestellt. Sowohl die Philosophie, wie die aus dieser hervorgegangenen Psychologie, vor allem die Naturwissenschaften unabdingbar, stellen als Grundsatz die sogenannte Introspektion außen vor, mit der zentralen Begründung, dies sei rein subjektiv, nicht objektiv erfaßbar und für die Ergründung der Objektivität somit nicht zu verwenden. Das diese damit allesamt eine Objektivität darüber abbilden, welche das Subjekt nicht beinhalten, ist eine Sache, denn auch der Objektivität bedingt es, zur Ergründung des Daseins. Das der Mensch jedoch nicht bemerkt, wie ihm darüber geschieht, ist ein ganz anderer Umstand, vor allem wenn dieser sich darüber seinem Selbst gegenüber distanziert und dies gar zur Ablehnung seines Selbst führt. Darauf basiert nämlich auch der Umstand, daß immer mehr Menschen ihr Selbst gar nicht mehr wahrnehmen, aufgrund der Nachahmung dessen, was darauf basiert, daß sich das Selbst aufgrund dieser Handhabe reflektiv dem verschließt. In der weiteren Ausführung geht es somit auch spezifisch darum aufzuzeigen, was man überhaupt in Betracht zieht und was nicht. So gilt es hierin auch auf das zuvor ausgeführte Prinzip zu achten, worüber sich das Naturwissenschaftliche spezifiziert, nämlich das sie das hervorbringen, was den Augen ersichtlich gemacht werden kann, separat zu den geistigen Erscheinungen. Und somit bezieht sich dies auch einzig auf das 'physische Geschlechts- und Fortpflanzungswesen' und somit auch die eigentliche Bewandtnis der sogenannten 'sexuellen Orientierung' einzig darauf. Es handelt sich dem entsprechend hierbei auch gar nicht um die eigentliche mentale Veranlagung und die Ergründung dessen 'kann auch nicht' von dieser vollzogen werden, aufgrund deren Prinzipialität. Gemäß dem erfährt dies auch in der weiteren Ausführung seine entsprechende Berücksichtigung und Darbietung, dem gegenüber es jedoch zur Einführung der Veranschaulichung des bestehenden aktuellen Verwirrungsverhältnisses bedingte. Die bestehenden Erkenntnisse als solche sind hingegen unerläßlich für die Klarheit der eigentliche Bewandtnis, welche darüber überhaupt erst seine Klarheit über diese Ausdifferenzierung erfährt, zumal eine jegliche Sichtweise auf seine Art das Bildnis erhellt. Es sind somit auch die mentalen Wirkwesen, welche es mir darüber hinaus darzulegen gilt, was sich entsprechend im Verbund daran anschließt.


im Spiegel der lateinischen Historiographie
des 12. und 13. Jahrhunderts

Verlag: Peter Lang
Hrsg: Peter Stotz

Divider

Die Geschlechtlichkeit

Divider

Der Wandel zur tatsächlichen Inbetrachtziehung der Geschlechtsorgane beim Menschen, fand zu jener Zeit somit auch abseits der regulären Anatomie anderweitig statt, nämlich im rechtsmedizinischen Bereich, worin das Augenscheinliche zum rechtsklärenden Ermessungsgegenstand wurde. Hierin war es Jacques Duval, welcher das Bezugswesen darin revolutionierte und somit nicht mehr nur oberflächliche Äußerlichkeiten, sondern das Detailwesen der Geschlechtsorgane Inbetrachtziehungsgegenstand wurde. Spezieller Kontext der Ärzteschaft war von je her das Bezugswesen zu Abnormitäten, worüber sich in besonderer Weise die Funktionsweisen und somit auch das des menschlichen Konstruktes über die Kontrastierungen darbieten. Und so gibt es im Äußerlichen der Geschlechtsorgane ein ganz Bestimmtes, worüber sich auch die Verhältnisse spezifisch darlegen und das ist vor allem die Beschäftigung mit den Detailwesen der Differenzierungen, die gar so eindeutig einher gehen und somit auch das Verhältnis der Klitoris, welche man dem gemäß auch als weiblichen Penis bezeichnet. Um dieses Detail des Verhältnisses dreht es sich auch, bezüglich Duval's Aufbringen der Einforderung des in Augenschein nehmens dessen und über dieses Detail zeigt sich auch über die Zeiten hinweg das Verhältnis des Menschen zum Speziellen des Geschlechtsorganwesens auf. Das Markante hierin ist vor allem, inwiefern dieses Detail sich überhaupt als präsent erweist. Man betrachte sich hierzu die Gegenwart und führe sich dies vor Augen. Wahrgenommen wird die Klitoris tatsächlich noch immer einzig von wenigen und existiert in den meisten Köpfen nicht. Die meisten sehen in dem weiblichen Geschlechtsorgan nach wie vor einzig eine Körperöffnung, als Passform, in welcher der Penis sich einfügt und dies sind keineswegs nur Menschen, welche keinen sexuellen Geschlechtsverkehr praktizieren, sondern auch die Praktizierenden erfahren es weitläufig als derartig Seiendes, da die weiblichen Geschlechsorgane in keiner Weise eine derartige Sichtung erfahren, wie der männliche Penis, gemäß seiner herausragenden Erscheinung. So ist es denn auch hierin generell derart, daß die Klitoris einzig gemäß deren herausragenden Präsenz, in Erscheinung tritt. Darin besteht auch das Grundprinzip, welches man im Bezug auf das Händling des Geschlechtswesen antrifft und genau auf diesem Prinzip basiert, nämlich auf der Ermessung des herausragend Ersichtlichen und umso herausragender es sich stellt, es sich auch als eine Vermessenheit sich erweist, es nicht als solches anzuerkennen. Die Reflektion bildet hierin den Kern dieser Wesensart und darauf begründet es sich.

https://commons.wikimedia.org/wiki/File:Female_Hermaphrodite_(George_Arnauld,_1750).jpg
Female Hermaphrodite
(George Arnauld 1750)


Mediziner in Basel um 1600
Campus Verlag
» «

Auszug aus der » Ausgabe von 2018 «

Um 1600 boomten Publikationen zu Hermaphroditen. In der berühmten Auseinandersetzung um den vermeintlichen Hermaphroditen Marie/Marin le Marcis zwischen den beiden Medizinern » Jean Riolan « und Jacques Duval wurde beispielsweise die Frage verhandelt, ob Marie/Marin als Tribade eine Frau geheiratet habe oder ob sie ein Hermaphrodit sei. Duval plädierte für Letzteres, womit er Marie/Marin vor der Todesstrafe bewahrte, während Riolan, der in seiner Anthropographica sogar für allgemeine Klitoridektiomen eintrat, Marie lediglich eine vergrößerte Klitoris zugestand.


Verlag: Routledge

Worum es sich jedoch tatsächlich dreht, beschreiben nur angeblich die darstellenden Worte, denn über das, was diese deklarieren, darüber besteht nämlich bis heute keinerlei Klarheit. Vor allem ist auch die Tribade in zweierlei Anwendung anzutreffen, nämlich einerseits im Bezug auf den gleichgeschlechtlichen Verkehr unter Frauen, wie jedoch auch gemäß seines 'tri' (drei) beinhaltenden, gleichermaßen in seinem Bezug einer Frau, zu beiden Geschlechtern den geschlechtlichen Verkehr zu unterhalten. Im Kern der Sache dreht es sich jedoch unabhängig davon um die Infragestellung, ob es sich um eine Frau handle und inwiefern somit die eheliche Handlung gesetzeswidrig sei. Und der Ermessungsgegenstand hierin ist die Erörterung, ob es sich bei dem in Betracht Ziehenden, um einen männlichen Penis handelt oder um eine vergrößerte weibliche Klitoris. Wie die Worte darüber beschreiben, wird hierin jedoch gar nicht eine Frau mit vergrößerter Klitoris darin gehandhabt, sondern ein anderes Wesen - ein Hermaphrodit. So zeigt sich auch hierüber das ausgehende Mißverhältnis des anwendenden Deklarationswesens auf, welches nämlich hierin gar nicht auf dem des beinhaltens des anderen Geschlechts Geschlechtsorgan beruht, sondern gar auf der Anomalie des eigenen, welches einzig größer ist, als es regulär der Fall ist. Dieses Mißverhältnis zieht sich durch den gesamten Geschichtsverlauf hindurch als ein alles durcheinander bringendes, bis im 19. Jh. die Zeugungsfähigkeit zum ermessenden Gegenstand wird. Das ist es auch, was sich über den Hermaphroditismus 'eigentlich' auch deklariert, was jedoch mit dem miseren Verhältnis konfrontiert ist, daß man davon ausging, daß regulär nur das jeweilige eine Geschlechtswesen als solches präsent wäre, sodaß man dem gemäß auch alles Abweichende davon trennte, was dem gegenüber Anomalien aufwies. So wird es denn auch erst aus heutiger Sicht klar, daß es sich tatsächlich um eine Frau handelte oder nicht?

Tatsächlich werden die Beschreibungen immer verworrener, umso mehr es sich bei dem Jeweiligen nicht um eine Norm handelt, was sich nämlich vor allem durch das Gesetzeswesen repräsentiert, welches die Norm bedingend erfordert, um als solches seine Funktion sich zu wahren. Es dreht sich somit auch nicht um das tatsächliche Geschlecht, sondern um dessen 'Einpassung' an die durch das Gesetz vorgegebene Norm. Und so gibt es auch eine rechtliche Norm, welche das Geschlecht bestimmt, jedoch beinhaltet diese nicht die Norm, die sich darauf bezieht, wie sich das Geschlecht bestimmt, sondern was das Geschlecht bestimmt. Und für Hermaphroditen bezieht es sich darauf, das sich als Hermaphrodit deklariert, was nicht der regulären Norm des Männlichen und Weiblichen entspricht und händelt somit auch diese Abweichung der Norm der Größe der Klitoris als nicht der Norm entsprechend weiblich seiend. Gemäß dem steht der Hermaphroditismus zwischen zwei Welten, in welchem zum Einen ein Sein, wie auch gleichzeitig das Nicht-Sein die Maßregelung ist. Und in dem Fall stellt sich dies als nicht-Frau-seiend und dem gemäß als Hermaphrodit. Ist sie jedoch ein Hermaphrodit oder nicht doch eine Frau mit übergroßer Klitoris?

Foucault hat den Fall » Barbin « und dessen Tagebücher aus dem 19. Jh. aufgearbeitet, worüber man einmal mustergültig einen konkreten Einblick erlangt, über die Gegenüberstellung der beiden Gegebenheiten. Hierüber zeigt sich auch, daß es sich im personellen Verhältnis tatsächlich um genau diesen Sachstand handelt und sich als ein anderes spezifiziert, nicht dem gleich seiend. Es entspricht jedoch in keiner Weise dem Bildnis des Hermaphroditen, welchen man über die beiden Geschlechter in Betracht zieht. Man erachtet nämlich einzig ein quantitatives Bildnis dessen, gemäß eines Zusammengesetzten, als während die einzelnen körplichen Bestandteile ein für sich wirkendes etwas und nicht das sich grundsätzlich davon unterscheidende Qualitative des damit einhergehenden Einheitswesens, dessen Wechselwirkung damit einher geht und sich nämlich aus dem Gesamtwirkungsverhältnis heraus ergibt, sodaß sich über ein veränderter Bestandteil alles ändert. So zeigt die Lebensgeschichte hierin auch in seiner Deutlichkeit auf, daß über die Einpassung in das derartig erachtende Geschlechtswesen, das Gesamtwesen gänzlich zerstört wird, da dies in keiner Weise mehr darin umsetzbar ist - dem in keiner Weies entspricht - und somit die Anpassung das Selbst zerstört. Gemäß dem nimmt sich Barbin auch das Leben, welches für diese(n) nicht weiter lebenswert ist. So ist das entstandene Recht auch kein Recht auf das Selbst, sondern einzig eine Bedingung, dieses Selbst aufzugeben, um Teil der Rechtmäßigkeit sein zu dürfen. In ursprünglicher Zeit, wo noch nicht sämtliche Gebiete per herrschaftlicher Gesetze eingenommen waren, was sich heute hingegen ganz anders stellt, da es kein Außerhalb mehr gibt, was sich tatsächlich auch die neue Deklaration der Intersexualität ausdrückt, was nämlich beinhaltet, daß man hierin zwangsläufig dazwischen steht, zwischen den zwei einzigen Varianten, welche diesen darin noch übrig bleibt.

Herculine Berbin (Original - frz. 1978)
» Michel Foucault «

Herculine Barbin (1980)
amerikanische Übersetzung


Der Fall Barbin
Suhrkamp Verlag
Übersetzung von

Es dauerte sehr lange, bis man einklagte, daß ein Hermaphrodit ein einziges, ein wahres Geschlecht haben sollte. Jahrhundertelang gestand man ihm einfach zwei zu. Eine Mißbildung, die Schrecken auslöste und peinliche Strafen erforderlich machte. Tatsächlich lagen die Dinge sehr viel komplizierter. Zwar gibt es sowohl in der Antike als auch im Mittelalter mehrere Zeugnisse von Hinrichtungen. Aber es gibt auch eine umfangreiche Rechtsprechung ganz anderer Art. Im Mittelalter waren die Vorschriften des Rechts - des kanonischen und zivilen - in diesem Punkt äußerst klar: Hermaphroditen wurden diejenigen genannt, in denen die beiden Geschlechter variablen Anteilen nebeneinanderlagen. In diesem Fall hatte der Vater oder Pate (diejeningen also, die dem Kind 'den Namen geben') die Aufgabe, zum Zeitpunkt der Taufe das Geschlecht festzulegen, das beibehalten werden sollte. Gegebenenfalls riet man dazu, sich für dasjenige Geschlecht zu entscheiden, das zu überwiegen schien, das 'die größte Stärke oder 'die größte Hitze' hatte. Später aber, an der Schwelle zum Erwachsenenalter, wenn für ihn der Moment gekommen war, sich zu verheiraten, stand es dem Hermaphroditen frei, selbst zu entscheiden ob er noch immer zu dem Geschlecht gehören wollte, das man ihm gegeben hatte, oder ob er das andere vorzog. Einzige Vorschrift: es nicht mehr zu wechseln, dasjenige bis zum Ende seiner Tage zu behalten, das er jetzt anbag; sonst lief er Gefahr, als Sodomit zu gelten.

Betrachtet man die Gegebenheiten im Bezug auf den Gesetzesverlauf, so tritt hierin die Markanz der Unterschiede von Mann und Frau in seinem öffentlichen Regulierungswesen hervor, dem gegenüber jedoch das Erberfüllungswesen dem gegenüber gar noch weit darüber hinaus reicht, zumal dies vor allem auch über das Gewohnheitsrecht seine Grundlagen erfährt. Hierin hat man es jedoch mit dem ursprünglich römischen Recht mit einer relativen Rechtlosigkeit der Frau zu tun, dessen Systematik man mit den Übernahmen von Gesetzesordnungen auch in unsere Kultur übernahm, sodaß sich hierüber noch einmal ein ganz eigene Geschichte über das Geschlecht wiederum darlegt und damit eine weitere Facette dessen Verhältniswesens sich aufzeigt, nämlich das Rechstregularium der Unterscheidung von Mann und Frau. Was den Hermaphroditismus betrifft, so verdeutlicht sich hierüber jedoch, daß die Eigeninitiativen, welche man in den Ländern anstrebte, um eine eigenständige regulierende Ordnung einzuführen, keinerlei Achtung fanden, denn wie sich zeigt, wurde die römische Gesetzgebung hierin eins-zu-eins übernommen. Elementar ist hierbei jedoch die gänzliche Auflösung der bestandenen Rechtsordnung für 'Zwitter'. Und wie ausgeführt, hat man es hierin mit einer neuen Situation zu tun, welche sich als gänzlich anders stellt, worin diese besagt, daß es gar keine Zwitter gäbe und aus dem Grunde dies auch nicht in das neue Rechtswesen aufgenommen würde.

Hierzu gilt zu bedenken, daß man allgemein davon ausgeht, daß über die Revolution eine ganz neues Rechtswesen gegenüber dem Alten seine Anwendung findet, dem gegenüber jedoch genau das Gegenteilige die Gegebenheit ist. Man hat einzig die bestandenen Rechtswesen geändert, jedoch statt wie zuvor, wo das römische Recht anteiliger Begleit- und auch Begründungsbestandteil war, dem gegenüber man jedoch eigene Formen entwickelte, wurde indess daraufhin folgend, das römische Rechtssystem als solches übernommen und bildete auch die Grundlage des BGB. Die Grundlage dazu sind seit dem Mittelalter die » Pandekten «, eine kumulierte Sammlung der Schriften römischer Rechtsgelehrter, welche unter Kaiser Justinian um 530 entstand. Darauf beruhte auch das ursprüngliche Rechtsverhältnis bezüglich der Hermaphroditen, sodaß gerade dies sich als Widerspruch dem gegenüber stellt. Es ist jedoch, wie die Worte besagen, nicht die Gesetzmäßigkeit, worüber dies zustande kommt, sondern wie diese verdeutlichen, handelt es sich um eine 'neue Ärzteschaft', was elementar ist. Zu jener Zeit wandte man sich nämlich grundlegend von den althergebrachten Naturheilmethoden ab und somit auch von dieser damit verbundenen Ärzteschaft, sowie deren Kenntnissen, dem gegenüber ein ganz Neues auf den Plan tritt, in Verbindung neuer Mediziner, wie sich dies, gemäß seiner Unterscheidung nennt. Sie haben über den Menschen, wie es sich in aller Deutlichkeit über dieses Verhältnis zu den Hermaphroditen zeigt, ein ganz neues Bildnis und damit verbunden auch ein ganz anderes Verhältnis. Vor allem sind jedoch in den neuen Lehren die Hermaphroditen noch gar nicht enthalten. Darauf basieren auch die zunächst völlig verwirrenden Entwicklungen, welche im 19. Jh. als Neues auf den Plan treten, in Verbindung mit Homosexualität und Co., in welchem sich somit zunächst auch erst einmal alles miteinander vermischt.

Memoires de Chirugie (Original - frz. 1768)
de Ronsil

über die Hermaphroditen
Verlag: Amand König
deutsche Übersetzung
Neuauflage: Nabu Press (2011)

Man versteht unter Hermaphrodit eine Person, deren Theile, die den Unterschied des Geschlechts bestimmen, entweder vollkommen oder unvollkommen mit einander vereinigt sind.

Das Wort Hermaphrodit kommt vom griechischen Wort Ἐρμῆς Mercurius, und Ἀφροδίτη, Venus, woraus ἑρμαφροδῖται entstanden. Beym Ovidion findet man die fabelhafte Geschichte, welche Gelegenheit zu dieser Bedeutung gegeben: er mache den Hermaphrodites zu einem Sohn der Venus und des Mercurs; er war nach ihm, von einer so vollkommenen Schönheit, daß die Nymphe Salmacis zum Sterben in ihn sich verliebte, da sie ihn in der Quelle, der sie vorgesetzt war, sich baden sahe: aufgebracht, daß sie ihn nicht gegen ihre Liebe empfindlich machen konnte, bat sie die Götter sie beyde zu vereinigen, so daß ihre Körper nur einen ausmachten, in dem beyde Geschlechter deutlich verschieden waren. Dieses wurde ihr gewährt.

Spon hat in seinen Untersuchungen der Merkwürdigkeiten des Altherthums, zwey kostbare Steine angeführt, auf welche die Fabel vom Hermaphroditen gegraben ist. Der eine, ein Carniol, stellt ihn im Bade vor, im Begriff die Nymphe Salmacis zu um armen, mit welcher er ein Körper zu werden anfängt, der doch die Kennzeichen beyder Geschlechter behält. Der zweyte zeigt ihn schon verändert, auf die Art wie man ihn zu Rom in Bildsäulen von Marmor und Erz antrifft.

Die alten, an Fabeln so fruchtbaren Dicher, verschleyerten mit ihnen die Wahrheit, die glückliche Genies aber wusten sie zu enthüllen, un moralisch oder politisch zu erklären. Die Folge dieser Abhandlung wird vieleicht die Nennung derer begünstigen, welche den Sinn dieser Fabel nicht schwer zu erklären glauben; denn läßt sie uns nicht vermuthen, wie Mertru (a) behauptet, der darin mit dem Abt Bellegarde (b) einstimmig ist, daß "die Alten Kenntniss von der Vereinigung beyder Geschlechter in einer Person gehabt haben, und daß diese Grille der Natur der Ursprung dieser vom Ovid in seinen Verwandlungen erzählten Fabel sey. Ovid dichtete, sagt der Abt von Bellegarde, daß Hermaphrodites ein Sohn des Mercurs und der Venus gewesen sey, und gründete sich auf die Beobachtung einiger Naturforscher die bemerkt haben, daß Kinder, während der Vereinigung dieser beyden Planeten gebohren, öfters Hermaphroditen sind und sich beyde Geschlechter vereinigen".

Sonst haben noch die Griechen diese Geschöpfe Androgyni und Gyantropi genannt, welche Benennungen charakteristischer scheinen, da die erste einen Mann und eine Frau, und die andere eine Frau und Mann bedeutet. Inzwischen bedient man sich des Wortes Hermaphrodit, welches am gebräuchlichsten ist.

Ich will mich nicht in die Streitigkeiten einiger Rabinen einlassen, welche behaupten, Adam wäre vor dem Fall ein Hermaphrodit, und dazu bestimmt gewesen in diesem Zustande zu bleiben : man kann hierüber Casp. Bauhin nachlesen, er widerlegt sie mit der tiefsten Gelehrsamkeit.

Die Hermaphroditen sind durch eine so große Menge Schriftsteller bezeugt, daß ihre Wirklichkeit bey sehr vielen Leuten außer Verdacht zu seyn schein. Aristoteles zweifelt nicht daran ; er führt Nachrichten darüber an, die von einigen bewundert, und von andern lächerlich gemacht sind. Ich unternehme hier nicht diese Nennungen zu entscheiden ; jeder hat das Recht seine Begriffe nach dem Maße seiner Erkenntnis zu entwickeln : mein Zweck ist bloß das Ansehn der Schriftsteller anzuführen, die gehört werden verdienen. Ich werde nicht darthun, ob dieser Weltweise träumte oder ob er Recht hatte, wenn er sagte, daß einige Hermaphroditen die recht Brust wie ein Mann hätten, und die linke wie ein Frauenzimmer, und daß sie sich wechselweise änderten ; es kann seyn, oder es kann nicht seyn, ich weis es nicht : die Natur stellet uns täglich die sonderbarsten Abweichungen vor, so daß man sich nicht unterstehen darf, Aristoteles zu widersprechen.

Ambrosius Pareus, der die Natur als wahrer Wundarzt studierte, hatte deutlichere und bestimtere Begriffe von Hermaphroditen als Aristoteles wegen seines angegebenen Unterschiedes, der beym ersten Anblick alles erkennen läßt ; er hat Abbildungen davon hinterlassen, unter denen eine hermaphroditische Zwillinge vorstellet, die mit dem Rücken zusammengewachesen, gebohren sind.

Die besten Schriftsteller, welche diese Materie abgehandelt haben, sind dieser Eintheilung gefolgt, wie Casp. Bauhin ; er hat darüber ein weitläufige und sehr gelehrte Abhandlung geschrieben, Nicol. Venette Verfasser vom Tableau de l'amour confideré dans l'état du mariage, handelt gleichfalls davon in einem eignen beträchtlichen Capitel ; er folgt ohngefehr derselben Eintheilung, aber seine Erklärungen sind ganz dunkel. Martin Schurig in seiner Spermatologia historico - medica, giebt die sonderbarsten Beyspiele ; er folgt derselben Eintheilung.

Diese Schriftsteller, und viele andere vor ihnen, als Hippocrates, Galenus, Realdus, Columbus, Paul Aegineta, Fortunius Licetus, und andere haben sich bemühet zu erklären was sie als die Ursache der Erzeugung der Hermaphroditen glaubten, von der Art die ihnen bekandt war ; aber was sie hierüber geschrieben haben ist nicht hinreichend genug, um sich dabey aufzuhalten ; um wie alles, was ich selbst davon sagen könnte, nicht so sehr unterhalten würde, als die Erklärung dessen, was uns die Natur für Augen legt.


Nomos Verlag

Hermaphroditen im römischen Recht

Im römischen Recht waren Frauen deutlich schlechter gestellt als Männer. Sie konnten zum Beispiel nicht die Position des pater familias, also des Familienoberhaupts, bekleiden und waren somit von der gesetzlichen Vertretung ihrer eigenen Kinder (selbst der unehelichen) ausgeschlossen. Außerdem waren sie nicht als Zeuginnen bei förmlichen Rechtsgeschäften zugelassen, wozu etwa die Errichtung eines Testaments zählte. Ob eine Person als Frau oder als Mann galt, hatte folglich erheblichen Einfluss auf die jeweilige Rechtsposition. Römische Juristen setzten sich daher auch mit der Rechtsstellung intergeschlechtlicher Menschen auseinander, die sie mit dem aus dem Griechischen entlehnten Begriff hermaphroditus bezeichneten. Hermaphroditos war in der griechischen Mythologie das Kind des Götterboten Hermes und der Liebesgöttin Aphrodite, ein zweigeschlechtliches Wesen, das als Jüngling mit langem Haar und weiblichen Brüsten dargestellt wurde. Die klassischen römischen Juristen entwickelten verschiedene Zuordnungsregelungen: Ein Hermaphrodit sollte jenem Geschlecht gleichgestellt werden, "das bei ihm überwiegt" (Dig. 1, 5, 10 Ulpianus libro 1. ad Sabinum) oder "dessen Begierden sich ihn ihm regen" (Dig. 22, 5, 15, 1 Paulus libro 3. sententiarium).

Älteres deutsches Recht

Umstritten ist, ob auch die mittelalterlichen Rechtsquellen des deutschen Sprachraums Regelungen zur Rechtsstellung von intergeschlechtlichen Menschen kannten. Als wichtigstes deutsches Rechtsbuch des späteren Mittelalters gilt der Sachsenspiegel, in dem um 1220 Eike von Repgow das überlieferte Recht niederschrieb und der in Teilen bis ins 19. Jahrhundert in Geltung blieb. In seinem Landrechtsteil widmete sich der Sachsenspiegel vor allem den bäuerlichen Rechtsverhältnissen, der Lehnrechtsteil gab die Rechtsgewohnheiten hinsichtlich der Verhältnisse der Feudalherren untereinander wieder. Einige Handschriften des Sachsenspiegels enthielten eine Passage, deren Bedeutung nicht ganz geklärt ist und die sogenannte "altvile" vom Lehensrecht wie auch vom Erbrecht ausschloss. Einige Rechtshistoriker übersetzten "altvil" mit "allzuviel": Die Rechtsstelle bezöge sich folglich auf jene, die "zuviel" an menschlichen Gliedern hätten - nämlich weibliche und männliche. Die Vorschrift wurde als Aussage über die Rechtsstellung von intergeschlechtlichen Menschen verstanden. Seit dem Ende des 19. Jahrhunderts gilt diese Vorstellung als überholt. "altvile" bezeichne nicht Intergeschlechtliche, sondern Menschen mit psychischer Beeinträchtigung.

Erst durch den zunehmenden römischrechtlichen Einfluss gelangten Rechtsvorschriften in die heimische Rechtspraxis, die sich unzweifelhaft auf Intergeschlechtliche bezogen. Die Gründung von Universitäten - vor allem im italienischen Raum - bewirkte eine wissenschaftliche Auseinandersetzung mit dem römischen Recht. Glossatoren und Kommentatoren versahen die Schriften der klassischen römischen Juristen mit Erklärungen und passten das römische Recht an die Bedürfnisse der mittelalterlichen Lebenswelt an. Es entstanden zahlreiche Kommentare, Lehrbücher und Abhandlungen zu einzelnen juristischen Sachthemen. Große Bedeutung erlangte die Summa legum brevis levis et utilis aus dem 14. Jahrhundert. Dabei handelte es sich um ein von Raymundus Partenopensis verfasstes Lehrbuch zum weltlichen Recht, das vor allem in Österreich, Böhmen, Polen und Ungarn Verbreitung fand. Die Summa legum war nicht nur auf Latein, sondern auch auf Frühneuhochdeutsch verfasst. Das bedeutete, dass auch weniger gelehrte Praktiker darin lesen konnten. Hinsichtlich des "Standes der Menschen" unterschied die Summa legum drei Kategorien:

"Allen menschen sein entweders man oder frawen oder ermofrodite, (verstee ains teils man, eins tails weib.)" (Cap. 1.21)

Mit dieser Aufzählung war allerdings keine Anerkennung von Intergeschlechtlichen als eigenem Geschlecht mit entsprechender Rechtsstellung verbunden. Wie die Rechtsposition intergeschlechtlicher Menschen zu beurteilen war, klärte die Summa legum unter Rückgriff auf jene Kriterien, die bereits das römische Recht entwickelt hatte:

"Die hermofrodite in irem geschlecht, in welchen sie mehr taugent (oder vermugent), nach dem wirt er geacht." (ebd.)

Eine eigenständige Lösung hatte das kanonische Recht entwickelt: Wenn bei intergeschlechtlichen Menschen kein Geschlecht "überwog", konnten sie ihre Geschlechtszugehörigkeit frei wählen. Hier zeigte sich erstmalig eine Anerkennung des subjektiven Empfindens. Gleichzeitig mit der Wahl mussten intergeschlechtliche Menschen allerdings der jeweils anderen Geschlechtsrolle durch Eidleistung abschwören. Ganz ähnlich regelte der Codex Maximilianeus bavaricus civilis den Umgang mit intergeschlechtlichen Menschen. Der Codex Maximilianeus stammt aus dem Jahr 1756. Er steht ideengeschichtlich zwar an der Schwelle zu den großen Naturrechtskodifikationen, wie etwa dem französischen Code civil oder dem österreichischen Allgemeinen bürgerlichen Gesetzbuch, gehört selbst jedoch noch einer früheren Periode der Rechtsentwicklung an. Der Codex Maximilianeaus wollte weniger neues Recht schaffen, als vielmehr das gültige Recht sammeln. Subsidiär galt weiterhin das "gemeine Recht" (also das römisch-kanonische Recht des Mittelalters und der Frühen Neuzeit).

Für intergeschlechtliche Menschen traf der Codex Maximilianeus recht detaillierte Regelungen: Primär sollten Sachverständige die Geschlechtszugehörigkeit beurteilen. Kamen sie zu keinem Ergebnis, dann konnten Intergeschlechtliche selbst wählen, durften allerdings von der einmal getroffenen Wahl nicht abweichen. Taten sie dies doch, drohte dieselbe Strafe wie bei einem crimen falsi. Als crimen falsi fasste das gemeine Strafrecht eine Reihe von Delikten zusammen, denen eine Täuschungsabsicht zugrunde lag und die schwer - häufig mit dem Tod - bestraft wurden.

Mit dem Preußischen Allgemeinen Landrecht aus 1794 trat nicht nur das Selbstwahlrecht für intergeschlechtliche Menschen deutlich in den Vordergrund, es brachte auch eine stärkere Berücksichtigung der sozialen Dimension des Geschlechts mit sich: Kam ein intergeschlechtliches Kind zur Welt, hatten zunächst die Eltern zu entscheiden, ob es als Mädchen oder als Bub erzogen werden sollte. Nach Vollendung des achtzehnten Lebensjahres konnten Intergeschlechtliche selbst ihre Geschlechtszugehörigkeit wählen:

"Nach dieser Wahl werden seine Rechte künftig beurteilt." (Paragraf 20 PrALR)

Nur dort, wo die Geschlechtszugehörigkeit Auswirkungen auf die Rechte Dritter hatte, überwog das Urteil von Sachverständigen.

Eindeutigkeit im Recht

Den dargestellten Rechtsvorschriften ist eines gemein: Sie hielten die Existenz von Menschen, die weder weiblich noch männlich waren, zwar nicht für alltäglich, aber doch immerhin für möglich. Bis wann und in welchem Umfang in der Rechtspraxis Geschlechtseide und Wahlrechte tatsächlich vorkamen, geht aus den einzelnen Kodifikationen freilich nicht hervor. Im 19. Jahrhundert verschwinden die Bezugnahmen auf intergeschlechtliche Menschen aus den Gesetzeswerken. Im französischen Code civil, dem österreichischen Allgemeinen bürgerlichen Gesetzbuch oder dem deutschen Bürgerlichen Gesetzbuch sucht man sie vergeblich. Franz von Zeiller, der die Endredaktion des Allgemeinen bürgerlichen Gesetzbuches besorgte und als "Vater" des heute noch geltenden Gesetzes gilt, hielt in seinem "Commentar zum allgemeinen bürgerlichen Gesetzbuch" fest: Die Existenz von "Zwittern" werde "von neueren Aerzten bestritten". (zu Pragraf 21 ABGB)

Entscheidenden Einfluss auf die österreichische Rechtswissenschaft übte ab Mitte des 19. Jahrhunderts Joseph Unger aus. Er bereitete den Weg für eine vornehmlich an der deutschen Pandektenwissenschaft orientierte Privatrechtsdogmatik. Unger war mit dem klassischen römischen Recht und mit den deutschen Partikularrechten vertraut und kannte die darin enthaltenen Vorschriften zur Rechtsstellung von Intergeschlechtlichen. Mit Blick auf die österreichische Rechtslage schrieb Unger:

"Zwitter, bei denen eine gleiche Mischung der Geschlechter stattfinden soll und welche daher in juristischer Beziehung weder als Mann noch als Weib anzusehen wären, werden vom Recht als nicht vorhanden angenommen." (System des österreichischen allgemeinen Privatrechts, Band I, 1856, Seite 279)


Zweiter Teil
Palm'sche Verlagsbuchhandlung

§ 117 a - II. Eintheilung der Menschen in Rücksicht auf das Geschlecht.

II. In Rücksicht auf das Geschlecht sind die Menschen entweder männlichen oder weiblichen Geschlechts. Ob es nicht noch eine dritte Menschengattung gebe, nämlich solche, welche beyderley Geschlechts zugleich sind, ist noch nicht entschieden. Man pflegt sie Zwitter oder Hermaphroditen zu nennen. Die Gesetze unserer Pandecten gedenken ihrer an verschiedenen Orten. Sie stellen den Grundsatz fest, daß man die Hermaphroditen zu demjenigen Geschlecht zählen müsse, dem sie am ähnlichsten sind (Nach dem allgemeinen Preuß. Staaten 1. Th. 1. tit. § 19. ff. bestimmen die Eltern, zu welchem Geschlecht sie erzogen werden sollen. Jedoch steht einem solchen Menschen, nach zurückgelegtem achtzehnten Jahre, die Wahl frey, zu welchem Geschlecht er sich halten wolle. Nach dieser Wahl werden seine Rechte künftig beurtheilt.). Während sie also dem überlegenen Geschlecht nach männlich, so würden sie als Mannspersonen anzusehen seyn. Prävalierten aber bey ihnen die Kennzeichen des weiblichen Geschlechts, nämlich Geburtstheile, Stimme, Brüste, und übriger körperlicher Bau, so würde man sie zu diesem Geschlechte rechnen müssen. Zu Folge dieses Grundsatzes entscheiden nun die Gesetze all die sie betreffenden Rechtsfragen, wobey es auf den Unterschied des Geschlechts ankommt. Z. B. ob ein Hermaphrodit als Testaments-Zeuge gebraucht werden könne. Allein die neuern Aerzte *) wollen es gänzlich läugnen, daß es wahre Zwitter gebe. Die weitere Untersuchung liegt ausser meiner Spähre.

*) » G. Duverney « » Oeuvres anatomique [1761] « T. II. p 369.
» Valmont « de Bomare Dictionn. d' Historie natur. art. Hermaphrod [1764-1800].
» Teichmeyer « » medicin. legal. [1723] « p. 99.
» Faselius « » elem. medicin. legal. [1741-1772] « § 40.
Arnaud » über die Hermaphroditen [übers. 1777] «. Tab. I-IV.
» Metzgers « » kurzgef. System der gerichtlichen Arzneywisschenschaft [1793] « § 496. u. 497.
und » Ploucquet « » über die physischen Erfordernisse der Erbfähigkeit [1779] «

In Absicht auf die Eintheilung der Menschen in Manns- und Weibspersonen ist nun noch zu bemerken

1) daß die Namen Weib oder Frau und Mann überhaupt die ganze Geschlechtsgattung bezeichnen, ohne Unterschied, ob eine Person verheyrathet, oder ledig ist. Eben so werden auch die lateinischen Benennungen mulier und femina in unseren Gesetzen von allen Personen weiblichen Geschlechts gebraucht, ohne Unterschied, sie mögen Jungfern, Eheweiber oder Witwen seyn; so wie in einer eben so weitläufigen Bedeutung das Wort vir all Perseonen männlichen Geschlechts, sie seyen Männer oder Knaben, bezeichnet.

2) Zwischen beyden Geschlechtern findet zwar ein merklicher Unterschied der Rechte statt, doch gilt im allgemeinen die Regele, daß ordentlicher Weise Manns- und Weibspersonen gleiche Recht zu genießen haben, in sofern nicht die Gesetze in einzelnen Fällen einen Unterschied in Ansehung des Geschlechts machen. Hieraus folt, daß wenn ein Gesetz überhaupt etwas verordnet, ohne die Weibspersonen aufzunehmen, solches auch mit auf dieselben zu erstrecken sey. So z.B. kommen die dem Erben zu Gunsten verordnete Rechtswohlthaten allerdings den weiblichen Erben so gut als den männlichen zu statten. Ja, wenn auch in einem Gesetz nur des männlichen Geschlechts vorzüglich wäre gedacht worden, so ist deswegen das weibliche nicht gleich für ausgeschlossen anzusehen, wenn nicht das Gegentheil entweder aus dem Geist und dem Gegenstande des Gesetzes, oder aus andern Gesetzen deutlich erhellet. Es ist also immer nur Ausnahme von der Regel, wenn die Gesetze in manchen Stücken dem männlichen Geschlecht Vorzüge vor dem weiblichen geben, in andern Fällen aber dem weiblichen Geschlecht wieder Vortheile zugestehen, an welchen das männliche keinen Antheil nimmt. Diese Ausnahmen sind nun aber freylich sehr erheblich, und beruhen auch nicht auf einem und demselben Grunde, sondern sind aus verschiedenen Quellen herzuleiten. Die Gesetzgeber selbst haben bey Bestimmung der besondern weiblichen Rechte verschiedene Gründe ihrer Legislation angegeben.

1) Die erste und vorzüglichste Quelle ist unstreitig in dem eigenthümlichen Charakter des weiblichen Geschlechts, in ihrer körperlichen Beschaffenheit, und der Hauptbestimmung derselben zum Kindergebähren, und zur Versorgung des Hauswesens, zu finden. In dieser Rücksicht wird

a) den Frauenspersonen eine gewisse Schwäche des Geschlechts zugeschrieben, welche in unsern Gesetzen nicht nur als die Ursache angegeben wird, warum Frauenspersonen keine Bürgschaft gültig übernehmen können, sondern warum sie auch überhaupt von öffentlichen Aemtern ausgeschlossen sind.

Unter jene Schwäche des Geschlechts, oder wie sich die Gesetze eigentlich ausdrücken, sexus imbecillitas, infirmitas fueminarum, ist jedoch nicht sowohl Mangel des Verstandes, als welcher ihnen von den Gesetzen keineswegs abgesprochen wird, auch nicht natürliche Schwachheit des Körpers zu verstehen, sondern vielmehr

1) eine gewisse gutmüthige, dem weiblichen Geschlecht, natürliche Neigung, sich andern gefällig zu beweisen, vermöge welcher sich Frauenspersonen, im Vertrauen auf die Redlichkeit Anderer, nur gar zu leicht pflegen zu Handlungen bewegen zu lassen, die ihnen zu großem Nachtheil gereichen können. Aus diesem Grunde will daher der Vellejanische Rathschluß die Frauenspersonen auch nur in den Fällen schützen, wo sie eine fremde Verbindlichkeit aus bloßer Gefälligkeit übernommen hatten, ihr Vermögen zu des Schuldners Besten aufzuopfern. Wegen eben dieser dem weiblichen Charakter eigenen Gutmüthigkeit sind ferner Frauenspersonen an vielen Orten einer beständigen Curatel untergeordnet.

2) Heißt auch Schwäche des weiblichen Geschlechts eine von der Erziehung sowohl als der diesem Geschlecht wesentlichen Bestimmung zum Kindergebähren herrührende Unfähigkeit, männliche Arbeiten, welche eine ausdauernde Anstrengung des Körpers, und öffentlichen Aemter, welche Einsichten und Gelehrsamkeit erfordern, zu versehen. Deswegen sind zwar Frauenspersonen in der Regel von allen öffentlichen Aemtern ausgeschlossen, doch mache die Regentinen hiervon eine sehr bedeutsame Ausnahme; so wie auch bey Vormundschaften die Mütter und Großmütter, als welche Vormünderinnen ihrer Kinder werden können, bekannten Rechten nach ausgenommen sind.

Dem weiblichen Charakter wird

b) eine vorzügliche Sittsamkeit und Schamhaftigkeit (pudicitia sexui congruens) zugeeignet. Deswegen dürfen Frauenspersonen

1) überhaupt keine negotia virilia d.i. keine solche Geschäfte vornehmen, wobey die Gesetze nur Mannspersonen zulassen. So z.B. verbieten ihnen die Gesetze, für andere vor Gericht zu postulieren, sie können ferner bey solchen Geschäften nicht Zeugen seyn, wo mehr als zwey Zeugen Feyerlichkeit wegen erforderlich sind, z.B. bey Testamenten und Codicillen. Wo es hingegen blos auf Wahrheit ankommt, da ist das Zeugniß der Frauenspersonen eben so vollgültig, als das Zeugniß der Männer. Nach teutschen Rechten machen auch Handelsgeschäfte eine Ausnahme von jener Regel, als von welchen die Frauenspersonen nicht ausgeschlossen sind. Es ist vielmehr zur Sicherheit und Begünstigung des Handels heutiges Tages der Grundsatz angenommen, daß alle diejenigen Rechtswohlthaten, die sonst den Weibern, wegen der Schwäche ihres Geschlechts, in Ansehung ihrer bürgerlichen Rechstgeschäfte verliehen sind, solche Frauenspersonen nicht zu statten kommen, welche entweder auf eigenen Gewinn und Verlust, oder gemeinschaftlich mit ihrem Manne, vermöge einer zu dem Zweck eingegangenen besondern Gesellschaft, Handlung treiben, und welche daher im eigentlichen Verstande Kauffrauen (feminae mercatrices) genennt werden. Eine Kauffrau kann sich daher in den Handelsgeschäften nach Wechselrecht verbinden, und hat sie Beziehung auf ihren Handel ein Bürgschaft übernommen, so kann sie sich auf den Vellejanischen Rathsschluß nicht berufen.

2) Aus eben dem Grunde der weiblichen Schamhaftigkeit verordnen ferner die römischen Gesetze, daß keine Frauensperson, wenn sie auch des schwersten Verbrechens schuldig wäre, ins Gefängnis gesetzt, sondern dieselbe entweder in einem Kloster verwahrt, oder andern sichern Weibern zur Aufsicht übergeben werden solle, damit ihre Keuchheit durch Inhaftierung nicht in Gefahr gesetzt werde. Jedoch findet dieses Vorrecht des weiblichen Geschlechts nach der gegründeten Bemerkung practischer Rechtsgelehrten heutiges Tages nicht mehr statt.

Zu dem eigenthümlichen weiblichen Charakter gehört endlich

c) die frühere Mannbarkeit und Reise des weiblichen Geschlechts zur Kinderzeugung. Wie werden daher um zwey Jahre eher mündig als Mannspersonen, können früher testiren, früher heyrathen u.d.

II) Eine andere Hauptquelle besonderer weiblicher Rechte ist die gesetzliche Oberherrschaft des Ehemannes über die Frau, und die überhaupt durch die Ehe entstehende genaueste und innigste Vereinigung zwischen Eheleuen. Denn so wie deshalb zwar die Frau an der Würde und dem Stande des Mannes Antheil nimmt, dessen Namen führt, und den nämlichen Gerichtstand hat; so entstehen daraus auch wieder auf der andern Seite manche unangenehme Folgen. Denn da die Frau selbst der Gewalt des Mannes unterworfen ist, so kann sie keine solche Gewalt über ihre Kinder haben, dergleichen die Gesetze nur dem Vater geben. Eine wichtige Folge davon ist, daß Frauenspersonen keine suos heredes haben können, qui foeminae in potestate liberos non habent, wie Justinian sagt. Da ferner die Ehefrau durch ihre Verheyrathung den Namen ihrer Familie mit dem Namen, Stand und Würde ihres Mannes vertauscht, und die Kinder, welche die Hausmutter während der Ehe zur Welt bringt, nicht zu ihrer, sondern allemal zur Familie des Vaters gerechnet werden, so erhält hieraus der Ausspruch Ulpians sein Licht, mulier familiae suac finia est; und eben dies ist auch der Grund, warum Frauenspersonen in Familien Fideicommisse und solche Güter, welche nach der Absicht des Erwerbers bey seiner Familie, das heißt, sinen männlichen Nachkommen unversehrt verbleiben sollen, so lang ein männlicher Seccessor vorhanden ist, weder succediren, noch solche Güter, wenn sie außer der Familie veräußert worden sind, retrahiren können. Denn durch sie wird die Familie nicht erhalten.

III) Daß endlich manche besondere weiblichen Rechte nur Billigkeit zum Grunde haben, beweisen die Worte des R. Justinians: Quis mulinerum non misereatur propter obsequia, quae maritis praestant, propter partus periculum et ipsam liberorum procreationem, pro quibus multa in legibus nostris inventa sunt privilegia, ich will auch nicht gerade läugnen, daß Zärtlichkeit und Eifersucht, vielleicht auch Justinians Gemahlin die Theodora an einigen Vorzügen und Rechten des schönen Geschlechts Antheil haben könne.

Der Fall, welcher zu den Analen der Geschichte beigetragen hat und die Gegenständlichkeit überhaupt einmal demonstrativ aus dem Selbst heraus darlegt, ist von » Foucault « aufgearbeitet worden, um die Gegebenheiten demonstrativ vor Augen zu führen. Gerade hierüber zeigt sich, daß die Inbetrachtziehung des Selbst der Person gar nicht Inbetrachtziehungsgegenstand ist.

Dahinter steckt etwas wesentliches, nämlich das aufeinander wirkende resonierende Verhältnis von Wahrnehmung und Vorstellung, sodaß insofern einerseits noch keine Vorstellung über etwas ausgebildet wurde, die Wahrnehmung dessen auch relativ unscheinbar, grob und verschwommen einhergeht. Lernt man die Gegebenheit längere Zeit kennen, bildet sich damit verbunden darüber auch, gemäß der Ausgiebigkeit der Wirkungen, ein dem gemäßes sich ausbildendes Abbild in der Erinnerung, welches über die geistigen Projizierungen hervortritt und generell zu der Wahrnehmung hinzutritt. Ist jedoch die Vorstellung, welche man gebildet hat, nicht von einem selbst, sondern stammt von Abbildnissen anderer und man erfährt über die Wahrnehmung Abweichungen dem gegenüber, so stellt sich dies als regelrechter Kontrapunkt der Vorstellung gegenüber und gelangt darüber zur Infragestellung und Beschäftigung damit. Wie sich zeigt, so stellt sich gerade dies jedoch ebenfalls als relativ, was sich über das Verhältnis zur Klitoris mustergültig aufweist und darüber verdeutlicht, wie es sich mit dem Regulierungsgegenstand von Wahrnehmung und Vorstellung stellt. Hierin zeigen sich drei Varianten: den Einen ist die Wahrnehmung das Maß, Anderen die Vorstellung und nur wenigen bildet es sich über das kombinierte Koordinieren, im Verhältnis des Verstandeswesens, als solches aus. Über die Auseinandersetzungen der Ärzte zeigt sich diese Differenzierung in aller Deutlichkeit, dessen Disput gar über die nächsten Jahrhunderte sich fortsetzt und parallel verläuft mit den hervorbringenden Details der anatomischen Kenntnisse, zu dem zu jener Zeit einzig das Äußerliche einzig bekannt war, dem gegenüber jedoch trotz der Klarheit auch in diesem gegenüber bestehend, gar einzig die Größe als Ermessungsgegenstand im Raume stand. Überhaupt bildet dies jedoch die eigentliche Kontroversität, überhaupt zu einem solchen Vergleich zu gelangen, wenn man bedenkt, welche Bildnisse über das weibliche Geschlechtswesen zu jeder Zeit, so auch noch heute bestehen, die einzig aus der Vorstellung heraus begründet sind und nur Vereinzelte überhaupt sich der Ersichtung dessen zuwenden, was sich über die Kenntnisse oder nicht über die Klitoris darlegt. Dem entsprechend stellt es sich auch als revolutionierend, zur tatsächlichen Ersichtung der Geschlechtsorgane überhaupt zu gelangen. Dem gegenüber stellt es sich jedoch selbst in der Gegenwart noch gleichermaßen als revolutionär, deren Sichtung zu erlangen. Eine Absonderlichkeit, welche sich als besondere Außergewöhnlichkeit stellt, gegenüber dem, wie sich die Wissensgemeinschaft derartig ausgebreitet hat.

So ist es denn auch das Hermaphroditenwesen, worüber die Aufklärung über das körperliche Geschlecht seine Ausbildung erfährt, denn deren Präsenzen zu erklären erforderte zwangsläufig einer Ausdifferenzierung der männlichen Geschlechtsorgane gegenüber den Weiblichen, was der Fall Barbin mustergültig vor Augen führt. Der wesentliche Punkt hierin ist, daß sich dies bis zur Gegenwart fortsetzt, denn hierin findet nicht das Männliche und Weibliche als solches sein Ermessungswesen, denn dies ist dem gegenüber das Erscheinungsbildnis der Gesamtheit, welche sich nicht nur über den gesamte Körperlichkeit in umfangreicher Weise äußert, sondern gerade darüber auch das Innen(er)leben sich darüber darlegt. Hierin findet jedoch ein Spezifikum statt, welches die Bestimmung dessen gar bedingt, um darüber das Gesamtwesen in Erscheinung zu bringen. Aus diesem begründenden Verhältnis heraus, ergibt sich jedoch erst Jahrhunderte später, das Verhältnis, daß die äußeren Geschlechtsorgane, die man aus dem Grund auch als Sekundäre bezeichnet, gar keine solche Unterscheidung aufweisen, welche man nämlich in einem Verhältnis von rechts und links zu trennen sucht, jedoch sich über die spezialisierende Ergründung herausstellt, daß es sich darin als ein Mittiges verhält, worin das Eine regelrecht einzig rechts herum und das Andere links herum, eben nur anders präsent ist. Und somit gelangt man darin gar nicht zu einem Anderen, als zuvor, sondern eben genau zu dem Gleichen. Somit wird auch dies jedoch auch fortan nicht mehr der Ermessungsgegenstand, sondern die Unterscheidung der primären Organe, worüber die eigentliche Fortpflanzung stattfindet. Gerade auch darin zeigt sich jedoch, daß nicht nur das Eine, sondern, zwar nicht ausgebildet, aber doch auch das Andere in dem Jeweiligen präsent ist. Und so bildet sich dann auch daraus das Bildnis, daß alle Menschen beiderlei Geschlechts sind, dem gegenüber man über die Gentechniken ein weiteres mal darin fortschreitet, eine eindeutige Trennung zu erlangen, bis auch diesen wiederum das Gleiche wiederfährt. Maßgeblich hierin: man betrachtet gar nicht Mann und Frau, sondern ersucht die Prinzipialität dessen über des Menschen Präsenz seines Geschlechtswesens gemäß dem zu statuieren, gemäß dem es als solches kulturell statuiert ist. Nur besagt eben auch das Geschlecht etwas anderes, über die Art und Weise seiner Ausbildung. Und so trifft man hierin auf die Gegebenheit, daß das Geschlecht hierin für sich selbst spricht und es gar keines Einwandes bedingt, außer daß es gemäß seines Seins in Erscheinung tritt.

Darin steckt jedoch auch das Kernwesen dessen, warum eine solche Inbetrachtziehung ursprünglich gar nicht erst in Erwägung gezogen wurde, da jegliches Sein nicht rein aus sich selbst heraus ist, sondern im Gegenteil, das jeweilige Sein sich durch das auf dies Einwirkende und das Resonanzwesen gestaltet. Gerade dieser Aspekt ist hierin wesentlich und verdeutlicht, daß das Geschlecht als solches gar keine Auskunft darüber gibt, wie es sich als solches damit verhält, in dem Ursprung seines Entwicklungswesens der Ausgestaltung und es im ausgebildeten Verhältnis es darin maßgeblich ist, inwiefern es seine Eigenständigkeit an Ausbildung erfährt. So ist man zwischenzeitlich zumindest dazu gelangt, zu erkennen, daß es sich bei der Ausbildung des Geschlechtswesens selbst um eine Prägung handelt, gemäß dem es sich umsetzt, jedoch in der Umsetzung diverse Wirkungsfaktoren die Grundlage dafür begründen, inwiefern, wie und was sich umsetzt. Es ist eine Auseinandersetzung, welche aufzeigt, daß gerade hierin die Theorien über die Gegebenheiten nicht das Geleitwerk, sondern nach wie vor das Leitwerk sind der Inbetrachtziehungen und sich darüber nämlich fortsetzt, was zuvor über die Organe selbst stattfand, daß man nämlich darin weiterhin nicht sichtet, was doch ersichtlich ist und sich somit auch das beständige Drehen um die eigene Achse sich fortsetzt. Man hat den Kern der Sache noch immer nicht im Blick, daß die evolutionäre Geschlechtertrennung gar keine solche ist, wie man sie als Trennung von Links und Rechts in Betracht zieht. Man ersieht hierin einzig die Befruchtung des Anderen durch das Selbst und die Befruchtung durch das Andere im Selbst, jedoch ersieht man nicht die stattfindende Selbstbefruchtung. Die getrenntgeschlechtliche Fortpflanzung ist nichts anderes, als die der ohne dies stattfindenden Vermehrung, mit dem Unterschied, daß hierin die Bedingung besteht, daß sich der Organismus mit einem anderen Organismus seiner Art fortpflanzt, dem gegenüber die Scheidung von Männlichem und Weiblichen einzig darauf beruht, daß es hierin ein Einbringendes und ein Austragendes bedingt. Daraus ergeben sich die Unterscheidungen des Einen seiner Art. Gemäß dem ist jedoch in dem Bezug die Fortpflanzung und dessen Befähigung ein eigenständiger Bestandteil darin, welcher zwar über die Geschlechtsorgane seinen Vollzug erfährt, jedoch die Funktionalität diesen nur gemäß der Einrichtung gegeben ist, sie selbst es jedoch nicht sind, welche diese Einrichtung erwirkten. Man nennt es Evolution und darauf beruht dessen funktionale Präsenz und nicht aufgrund des Einzelnen personeller Präsenzen. So ist denn auch hierin, gemäß dem, zwischen dem Geschlechtswesen und dem Fortpflanzungswesen zu unterscheiden, gemäß dem es auch die Sprache besagt, indem sich hierin nämlich nicht die Geschlechtsorgane, sondern die Geschlechtlichkeit sich fortpflanzt, im Verbund des Gesamtwesens des sich fortpflanzenden Individuums.

Traité des hermaphrodits (1612)
» Traité des hermaphrodits (1612) «


Eine Genealogie des Geschlechtsbegriffs
Akademie Verlag GmbH

Mit Duvals Technik der Vivisektion korrespondiert die Erfindung eines neuen Gegenstandes: Innerhalb der Klinik der Sexualität erscheint die Organisation, das Zusammenspiel, das Tableau der Zeugungsglieder. Es tauchen die ersten Konturen dessen auf, was in Scultets Vivisektionsbericht des Zwitters Marta/Caspar Lechna Geschlecht genannt werden wird. Und noch eine Parallele zu Scultets Bericht wird offenbar: Scultet sagt, dass die alten Mediziner nichts als die Haare, die Stimme oder den Leib der Martha/Casper Lechna untersuchten. Ihm hingegen ginge es um das wahre Geschlecht. Und seine Ausführungen werden sich ausschließlich auf die Untersuchung der Zeugungsglieder des Zwitters Lechna beziehen. Hier wie dort betreten neue Fragmente dessen, was das Geschlecht sein wird, die Bühne des Wissens. Nicht mehr die Menschen-, Tier- oder Pflanzengeschlechter werden fortan die Folianten füllen, sondern die Tableaus der Zeugungsglieder. Die Frage nach den Geschlechtern wird sich auf einer vollkommen anderen Grundlage, als Frage nach dem Geschlecht, radikal neu stellen.

Dem gegenüber ist jedoch ein weiterer künstlich gebildeter Aspekt ein wesentlicher, nämlich das ideologiengeprägte Verhältnis der Reglements der Gemeinschaften, welches gerade in dem Alten der Anwendung der Geschlechtsverhältnisse die Grundlage bildete, nämlich in der Anwendung, gemäß der reglementierenden Ordnungen, sodaß gerade darüber nicht die Gegebenheit selbst, sondern letztendlich einzig noch das Aushängeschild dessen in Erscheinung trat und der Schein über das Sein seine Herrschaft darüber erlangte. Dem gemäß war zwar der Ausgangspunkt der Ergründung der Hermaphroditen, die Ausdifferenzierung der körperlichen Geschlechtlichkeit und die Verallgemeinerung der Kenntnisse darüber, vor allem zur Abrenzung gegenüber den strafrechtlich verfolgten sodomistischen gleichgeschechtlichen Handlungen von Männern, jedoch wurde diesem gleichzeitig daraus erfolgend eine Rechtlichkeit darüber eingerichtet, sodaß diese folglich darüber auch den Reglements unterworfen wurden. Im weiteren Verlauf der nächsten Jahrhunderte, entwickelte sich daraufhin ein Rechtswesen, worin dies seine spezielle Ermessung fand und fortan den Betroffenen auferlegte, sich für ein Geschlecht zu entscheiden. Der Fall, welcher zu den Analen der Geschichte beigetragen hat und die Gegenständlichkeit überhaupt einmal demonstrativ aus dem Selbst heraus darlegt, ist von » Foucault « aufgearbeitet worden, um die Gegebenheiten demonstrativ vor Augen zu führen. Gerade hierüber zeigt sich, daß die Inbetrachtziehung des Selbst der Person gar nicht Inbetrachtziehungsgegenstand ist. Darin besteht auch der Fortgang darin, daß nämlich nicht mehr nur die sachliche Geschlechtszugehörigkeit Händlingsgegenstand ist, sondern gleichzeitig auch das der körperlichen Geschlechtlichkeit einer Ordnung unterworfen wurde - einer zwangsweisen Zuordnung, welche als solche gar nicht gegeben ist, denn was die Geschlechtsorgane besagen, entspricht dem nicht. Gerade hierüber zeigt sich jedoch auch das Kernwesen, was es mit der Anwendung von Geschlecht auf sich hat. Es geht nämlich nach wie vor um nichts anderes hierin, als um die Statuierung des Prinzips der Zugehörigkeit, welches sich nicht durch das Selbst bestimmt, sondern über das Urteil darüber bestimmt wird.

Genau dies ist auch das Verhältnis des Ursprünglichen, worin es nie anders war und auch nie eine Varianz darin bestand, sich seine Geschlechtszugehörigkeit auszusuchen, was nämlich primär durch das hineingeboren werden sich ausbildet. Der entscheidende Aspekt hierin ist, daß das Geschlecht nicht nur in Abgrenzung zum und im Bezug mit dem Gesinde im Verbund einher ging, sondern vor allem sich aus dem Erbwesen und dem darüber bestimmenden Gemeinwesen fundiert. Über die diversen Geschlechtszugehörigkeiten, die an sich rein sachliche Zugehörigkeiten sind, bestimmt sich der Grundstock des Seins. Hierin vollzog sich eine generelle Veränderung hin zu einer begründenden Bürgerlichkeit, worin es sich gar nicht anders verhält. Was man nämlich in der gesamten Umgestaltung nicht umgestaltete, war das Erbwesen, welches weiter besteht und noch heute die Grundlagen menschlichen Seins begründet. Dies ist auch gar nicht änderbar, denn darauf beruht das Existenzwesen und sein untrennbarer Verbund mit dem Fortpflanzungswesen. Darüber hinaus bedingt dies des Menschen Kultur, denn darauf begründet sich sein Gemeinschaftswesen. Die Gegenwart scheint gegenwärtig ein anderes zu demonstrieren, jedoch zeigt sich bereits die Gegenwart als ein Vergangenes, worin die eigene Substanz wieder seine Stellung erlangt, dem gegenüber einzig noch das Fremde dies inne hatte und das zu Erlangende, nicht das Sein darin den Handlungsgrund bestimmte.

» Die Ordnung des Diskurses (2007) «
Fischer Verlag
» Michel Foucault «

Hermaphroditen - Medizinische, juristische und theologische Texte aus dem 18. Jahrhundert


Medizinische, juristische und theologische
Texte aus dem 18. Jahrhundert

Psychosozial-Verlag
Maximilian Schochow, Florian Steger

Im Jahr 2012 veröffentlichte der Deutsche Ethikrat seine Stellungnahme In­tersexualität. Diese Stellungnahme, die vielfältig und kontrovers diskutiert wurde, enthielt unter anderem Vorschläge zur Stärkung der Selbstbestimmung intersexueller Menschen, zum Abbau bürokratischer Hürden sowie zur Änderung des Personenstandrechts. Vor allem der letztgenannte Vorschlag, ein drittes Geschlecht einzuführen und damit die binäre Geschlechterordnung aufzuheben, wurde als ein längst überfälliger Schritt hervorgehoben und begrüßt. Aus der Perspektive des 17. und 18. Jahrhunderts scheinen diese gegenwärtigen Diskussionen in gewisser Weise anachronistisch. Bereits 1794 wird mit dem Allgemeinen Landrecht für die Preußischen Staaten reflektiert, dass nicht alle Neugeborenen geschlechtlich eindeutig männlich oder eindeutig weiblich sind. Diese Tatsache ist mit den sogenannten »Zwitter«-Paragraphen des Allgemeinen Landrechts für die Preußischen Staaten insofern rechtlich anerkannt, als die Eltern bestimmen können, zu welchem Geschlecht sie ihr Kind erziehen. Darüber hinaus hat ein Zwitter nach dem 18. Lebensjahr die freie Wahl, in welchem Geschlecht er künftig leben wolle und genießt die entsprechenden Rechte.

Hermaphroditen oder Zwitter sind im 17. und 18. Jahrhundert nicht nur ein Gegenstand des Rechts. Vielmehr werden sie in dieser Zeit in sehr unterschiedlichen Kontexten thematisiert. Gleich zu Beginn des 17. Jahrhunderts erscheint ein Kompendium des Schweizer Anatomen und Botanikers Caspar Bauhin (1560-1624), in dem eine Vielzahl von Berichten, Erzählungen und Geschichten über Hermaphroditen seit der Antike zusammengefasst ist. Kurz darauf wird in Frankreich der Gerichtsprozess gegen Marie/Marin le Marcis veröffentlicht, in dem die Ärzte Jacques Duval (1555-1620) und Jean Riolan (1577-1657) als Gutachter auftreten, um das »wahre« Geschlecht von Marie/Marin le Marcis zu bestimmen. Mitte des 17. Jahrhunderts erscheinen zahlreiche literarische Verarbeitungen - beispielsweise die anonyme Sammlung französischer Liebesgeschichten, in denen unter anderem die Verwechslungskomödie 'Die schöne Hermaphroditin' enthalten ist. Schließlich folgen in der zweiten Hälfte des 17.Jahrhunderts unzählige Berichte bzw. Protokolle über Untersuchungen von Hermaphroditen, die von Naturforschern und Ärzten durchgeführt wurden, etwa 1684 vom Ulmer Arzt Johann Scultetus (1595-1645). Diese meist mit Abbildungen versehenen Abhandlungen bilden noch Ende des 17. Jahrhunderts die Grundlage für Nicolas Venettes (1633-1698) Tableau der Hermaphroditen oder Zwitter. Darin fasst Venette Hermaphroditen zu fünf Arten zusammen: drei männliche Arten, eine weibliche Art und eine Art, bei der kein Geschlecht dominant ausgeprägt ist. Dieses Tableau bildet im 18. Jahrhundert die Vorlage für viele Klassifizierungen von Hermaphroditen und fließt in Standardwerke des 18. Jahrhunderts ein. Auch Denis Diderot (1713-1784) bezieht sich in der Encyclopédie auf Venette und fügt im Supplementband eine Kupfertafel mit vier Darstellungen von Hermaphroditen an, von denen zwei auf dem Cover abgebildet sind. In dieser Darstellung werden sie nicht über das gonadale Geschlecht, welches die inneren Genitalien bestimmt, sondern ausschließlich über die Stellung des genitalen Geschlechts, den äußeren Genitalien, definiert. So stehen beim weiblichen Hermaphroditen die weiblichen über den männlichen äußeren Genitalien.

Jenseits der vielen einzelnen Beschreibungen von Hermaphroditen, die seit der zweiten Hälfte des 17. Jahrhunderts veröffentlicht werden, sind eine Reihe von Texten zu finden, in denen sich Ärzte, Naturforscher und Juristen jeweils zu einem Hermaphroditen äußern. Beispielsweise diskutieren Anfang des 18. Jahrhunderts Ärzte, Naturforscher und Juristen aus England und Frankreich über den Hermaphrodit Marguerite/Arnaud Malaure und besprechen in Form von Briefen, Einzelblattveröffentlichungen oder mehrseitigen Abhandlungen, welches Geschlecht bei Malaure dominiere oder ob es wahre Hermaphroditen gebe. So entwickeln sich internationale und interdisziplinäre Netzwerke des Wissens um Hermaphroditen. Solche Netzwerke aus medizinischen, juristischen und theologischen Diskursen um Hermaphroditen sind in der bisherigen Forschung kaum berücksichtigt worden. Dies ist insofern erstaunlich, als Hermaphroditen vor allem im 17. und 18. Jahrhundert sehr mobil waren und durch Europa fuhren, um sich Interessierten aller Fachgebiete gegen eine finanzielle Entschädigung zu präsentieren. Unter anderem zeigte sich der Hermaphrodit Michel Anne Drouart 1750 in London, reiste 1753 nach Kopenhagen und 1755 nach Genf, ließ sich 1762 in Dijon, 1763 in Brieg oder 1765 in Nürnberg und 1767 in Paris von Ärzten untersuchen. So vielfältig die Reiseziele waren, so unterschiedlich wurde sie klassifiziert; beispielsweise als männlicher Hermaphrodit, als weiblicher Hermaphrodit und sogar als vollkommener Hermaphrodit. Während ihrer Reisen führte Drouart die Protokolle der vorangegangenen Untersuchungen mit sich, sodass die Anatomen und Chirurgen jeweils auf die vorherigen Klassifizierungen reagieren konnten.

Interdisziplinäre Netzwerke aus Ärzten, Juristen oder Theologen werden auch im vorliegenden Band anhand edierter Originaltexte aus dem beginnenden 18. Jahrhundert sichtbar. Im Mittelpunkt der Edition stehen zwei Hermaphroditen: Zum einen der Hermaphrodit M. W., dessen »wahres« Geschlecht im Verlauf eines Scheidungsprozesses bestimmt wurde, und zum anderen der weibliche Hermaphrodit Sempronia, welcher der Sodomie verdächtigt wurde. Bei den hier zum ersten Mal zusammengestellten sieben Originaltexten und zwei deutschen Übersetzungen aus dem Lateinischen handelt es sich um Beiträge von Ärzten, Juristen und Theologen. Die Originaltexte sind nicht nur medizinische Gutachten und Abhandlungen, sondern juristische Beurteilungen und Traktate zu den beiden Hermaphroditen sowie eine theologische Abhandlung zu einer der beiden Personen. Die Autoren der Originaltexte nehmen jeweils Bezug auf die Positionen der anderen Autoren und diskutieren die Perspektive vor dem Hintergrund ihrer fachlichen Herkunft.

Die Auseinandersetzungen um den Hermaphroditen M. W. werden von dem Arzt Johann Krus aus Schleswig sowie Carl Friedrich Luther (1663-1744), Arzt und Hochschullehrer aus Kiel, geführt. Ergänzt wird diese Debatte um Ausführungen des Theologen Christian Gottlieb Koch (? 1736). Im Mittelpunkt der Auseinandersetzung steht der Hermaphrodit M. W. und die Frage, ob und auf Grundlage welcher Voraussetzungen dieser zur Ehe befähigt ist. Die Frage, ob grundsätzlich Hermaphroditen zur Ehe fähig sind, war im 16. und 17. Jahrhundert sehr strittig. Der Arzt und Naturforscher Ulisse Aldrovandi (1552-1605) vertrat beispielsweise die Position, dass Hermaphroditen generell entsprechend ihres dominierenden Geschlechts heiraten können. Dahingegen schränkte der Jurist Jacob Möller (? 1693) diese generelle Erlaubnis ein, indem er die Ehefähigkeit an die Reproduktionsfähigkeit eines Hermaphroditen knüpfte. Jeder Hermaphrodit müsse sich vor der Heirat einer medizinischen Untersuchung unterziehen, in deren Rahmen die Funktionsfähigkeit des dominierenden Geschlechts nachzuweisen sei. Diese Meinung vertrat auch Nicolas Venette, wenn er die Ehefähigkeit an die Voraussetzung band, dass Hermaphroditen die Ehe mit einem der beiden Geschlechter vollziehen können müssen.

Vor dem Hintergrund dieser sehr unterschiedlichen Positionen wird der Hermaphrodit M. W. am 3. November 1703 auf Order der »Hohen Landes Obrigkeit« sowie des »Ober-Consistorial-Gerichts« und in Gegenwart von zwei Chirurgen sowie von Johann Krus untersucht. Im Ergebnis kommt Krus zu dem Schluss, dass bei M. W. das männliche Geschlecht dominiert, er aber impotent und demzufolge zur Ehe nicht fähig sei. Carl Friedrich Luther, der 1704 eine Dissertation über die Anomalien des Herzbeutels, der Lunge und der Genitalien in lateinischer Sprache verfasst, greift die Untersuchungsergebnisse von Johann Krus in seiner Dissertation auf und kritisiert diese scharf. Krus habe ausschließlich die äußerlich sichtbaren phänotypischen Geschlechtsteile untersucht und auf dieser Grundlage den Hermaphrodit M. W. für impotent erklärt. Luther verweist auf die Bedeutung der innenliegenden Geschlechtsorgane und deren Funktionsfähigkeit. Vor allem diese Geschlechtsorgane hätten für die Entscheidung über die Reproduktionsfähigkeit eines Menschen große Bedeutung und seien wesentliche Kriterien für die Bestimmung der Ehefähigkeit.

Die Gültigkeit dieser beiden Kriterien - phänotypische Geschlechtsteile einerseits oder innenliegende Geschlechtsorgane andererseits - wird im 16. und 17. Jahrhundert kontrovers diskutiert. Für eine ausschließliche Begutachtung der äußeren Geschlechtsteile sprechen sich unter anderem der Chirurg Ambroise Paré (1510-1590) oder Johann Scultetus aus. Die Größe der Genitalien, ihr Umfang oder die Beschaffenheit der äußeren Geschlechtsteile würden Auskunft geben, welches Geschlecht bei einem Hermaphroditen dominiert. Diese Merkmale müssten observiert und getastet werden, um eine Bestimmung des Hermaphroditen durchführen zu können. Der Arzt und Mitbegründer der Rechtsmedizin Paul Zacchia (1584-1659) stimmt diesen Kriterien und diesem Vorgehen grundsätzlich zu. Er erweitert aber die Kriterien, indem er auf die Repräsentation von innenliegenden Geschlechtsorganen abhebt. So sei eine Person mit Menstruation als weiblicher Hermaphrodit anzusehen, selbst wenn der Hermaphrodit männliche Insignien trage - beispielsweise kurze borstige Haare am Anus oder einen Penis in angenehmer Größe. Ähnlich argumentiert auch Jacques Duval im Prozess um das »wahre« Geschlecht von Marie/Marin le Marcis, wenn er auf die Funktion der im Inneren des Körpers liegenden Geschlechtsorgane hinweist.


Ashgate Publishing Limited

Kathleen Long explores the use of the hermaphrodite in early modern culture wars, both to question traditional theorizations of gender roles and to reaffirm those views. These cultural conflicts were fueled by the discovery of a new world, by the Reformation and the backlash against it, by nascent republicanism directed against dissolute kings, and by the rise of empirical science and its subsequent confrontation with the traditional university system. For the Renaissance imagination, the hermaphrodite came to symbolize these profound and intense changes that swept across Europe, literally embodying these conflicts. Focusing on early modern France, with references to Switzerland and Germany, this work traces the symbolic use of the hermaphrodite across a range of disciplines and domains - medical, alchemical, philosophical, poetic, fictional, and political - and demonstrates how these seemingly disparate realms interacted extensively with each other in this period, also across national boundaries. This widespread use and representation of the hermaphrodite established a ground on which new ideas concerning sex and gender could be elaborated by subsequent generations, and on which a wide range of thought concerning identity, racial, religious, and national as well as gender, could be deployed.

Kobelt_Tafel-1.jpg
» Erste Tafel «

Kobelt_Tafel-3.jpg
» Dritte Tafel «


des Menschen und einiger Säugethiere
in anatomisch-physiologischer Beziehung

Verlag: Emmerling
» «

» Erste Tafel «
Figur 1: Die männlich Ruthe von unten
Figur 2: Vorderer Theil des Gliedes eines Hypospadiaeus von unten
Figur 3: Verbreitung der Nerven in der Eichelsubstanz und Eichelhaut
Figur 4: Die Clitoris in natürlicher Größe von unten
Figur 5: Der penis von mus decumanus von unten
Figur 6: Ruthe von mus decumanus von unten

» Dritte Tafel «
Figur 1: Die menschliche clitoris vergrössert
Figur 2: Das passive weibliche Wollustorgan in seiner Lage und Verbindung von der Seite
Figur 3: Das weibliche Wollustorgan in seiner Lage von vorn
Figur 4: Die beiden Vorhofzwiebeln gegen die Mittellinie zusammengedrängt
Figur 5: Die linke Vorhofzwiebel von der convexen Seite

» Transitives weibliches Wollustorgan (S. 53) «
(Corpus cavernosum clitoridis, musculus ischio-cavernosus und vagina)

Der Ruthenschaft, beim Manne gross und gewaltig, hat beim Weibe nur eine dürftige körperliche Ausbildung erhalten. Das Geschäft, dem er dort vorstand, ist ihm hier grossentheils entzogen und hier an eine, jener Hervorragung entsprechende Einstülpung, an die Mutterscheide übergegangen.

So unendlich oft das corpus cavernosum clitoridis anatomisch untersucht worden, so ist doch in unseren Hand- und Lehrbüchern nicht einmal seine Stellung und äussere Gestalt der Natur gemäss angegeben, Und doch zeigt die clitoris gerade in dieser Beziehung die auffallendste Abweichung vom männlichen Gliede. Untersucht man, wie gewöhnlich, die clitoris im nicht injicirten Zustande, so sieht man sie, wie das männliche Glied, vom Scheitel des Schoosbogens schlaff herabhängen. Man versuche nun einmal, sie ohne vorgäingige Durchschneidung der unter ihr liegenden Theile, nach oben aufzurichten, so wird man finden, dass dies ohne gewaltsame Zerrung des Bändchens und des praeputium nicht angeht. Sind nun aber vollends die clitoris, die pars intermedia und ihre Gefässverbindungen mit dem frenulum, den Nymphen und den grossen Schaamlefzen mit erstarrter lnjectionsmasse angefüllt (1), das Ganze also in künstlicher Turgescenz begriffen, so ist eine solche Aufrichtung der clitoris ohne Zerreissung dieser Gefässe gar nicht möglich. Die injicirte clitoris hat nämlich folgende Stellung und Gestalt angenommen. Die crura clitoridis und das hintere Dritttheil ihres Körpers richten sich unter demselben spitzen Winkel wie der erigirte penis nach oben und vorn gegen die Schoosfuge auf (Taf. Ill. Fig. 2. l.); plötzlich aber wendet sich der vordere Theil des corpus clitoridis mit einer knieförmigen Biegung (Taf. Ill. Fig. 2. k. Fig. 1. b) gerade nach abwärts, so dass er gegen die aufsteigenden crura einen spitzen Winkel bildet (Taf. Ill. Eig. 2. i. k. l.), wodurch die glans clitoridis vor den oberen Rand des Scheideneinganges zu stehen kommt (Taf. Ill. Fig. 2. e. Fig. 3. f.) (2). Dies finde ich bei Lieutaud wenigstens theilweise, bestätigt: "Le clitoris n'a point la direction de la verge; il se port dans un sous contraire, c'est-à-dire, de haut en bas, sans qu'il puisse se relever dans son action"(3). Bei der Stute, Ratte, Katze, beim Hunde und Schweine ist diese Kniebiegung des Kitzlers noch viel auffallender, als beim Menschen. Die Scheidewand des corpus clitoridis ist weniger durchbrochen, als beim penis, und erstreckt sich bis in die vorderste Spitze. Die crura clitoridis sind im Verhältniss zum Umfange des Clitorisschaftes von sehr bedeutender Grösse (Taf. IV. Fig. 1.) (4), zeigen (bei b. b.) eine analoge, zwiebelartige Anschwellung (bulbus corporis cav. clitoridis), gehen in eine frei liegende, ahgerundete Spitze aus (e) und sind nur mit einer schmalen Längslinie ihrer hinteren Fläche an den vorderen, umgeworfenen Rand des Schoosbogens befestigt, so dass sie nicht sowohl unter, als vor denselben zu liegen kommen. Das Parenchym des Zellkörpers der clitoris ist ganz dasselbe, wie das des penis (5); nur sind die einzelnen Maschen und Gefässchen seines venösen Wundernetzes noch ungleich zarter und feiner als dort (Taf. IV. Fig. I. e.). Das Ganze ist von einer dünnen fibrösen Scheide umgeben. Seine Gefässe sind denen des corpus cav. penis vollkommen entsprechend (cfr. oben pag. 27 und Fig. 1 der Taf. III. u. IV.). Die Nerven werden zum Theil von Müller und Valentin heschrieben, stehen aber zum sensibeln Nervenreichthume der Clitoriseichel in keinem Verhältnisse.

1) In den zahlreichen anatomischen Sammlungen, die ich bis jetzt, mit besonderer Aufmerksamkeit auf die injicirten Präparate perlustrirte, habe ich auch nicht eine einzig gelungene Injection der clitoris gefunden.
2) Zur weiteren Veranschaulichung dieser eigenthümlichen Stellung des Kitzlers vergleiche man z.B. auch die Wachsabgüsse der verschiedenen Hermaphroditen, die fast in allen anatomischen Museen aufgestellt sind, und dazu ferner J.F. Meckel Handbuch der pathologischen Anatomie. II. 1. pag. 209. Somit wäre also die Clitoriseichel in ihrem Blüthezustande gleich einem Sinnesorgane am Eingang des allgemeinen Begattungscanales aufgestellt und Burdach's Bezeichnung derselben als "Tastorgan des Zeugungssystemes" gerechtfertigt.
3) Lieutaud, I. c. II. pag. 310
4) Ich habe auf der angeführten Tafel die Wurzel und Schenkel des Kitzlers, in dem Maasse vergrössert dargestellt, dass der Clitoriskörper (a) dem penis an Umfang gleich kommt, und man bemerkt nun das sehr beträchtliche Vorwiegen der crura clitoridis (b) vor den Schenkeln des penis (Taf. II. Fig. 5. d. d.). Auf diesen Unterschied zwischen dem corpus cavernosum des Kitzlers und der männlichen Ruthe hat schon Graaf aufmerksam gemacht; "Primo quod partes ejus bifurcatae duplo longiores sint, quam conunctae; in pene vero partes conjunctae quadruplo longiores sint bifurcatis".
5) J. Müller, der dem Kitzler überhaupt nur eine ganz untergeordnete Bedeutung zugesteht, stützt sich hierin unter anderem auch darauf, dass er im Körper des 3 1/2'' langen Kitzlers von Ateles-Weibchen gar kein erectiles Gefüge, sondern nur dichtes Fett gefunden habe (cfr. Müller über zwei verschiedene Typen in dem Bau der erectilen männlichen Geschlechtsorgane bei den straussartigen Vögeln etc. pag. 22). Allein ich befürchte sehr, es möchte hier ein kleine Präoccupation unterlaufen sein. Ohne vorgängie Ausspritzung lässt sich über dieses Organ kein vollständiges Urtheil fällen. Wer sich viel mit Injectionen beschäftigt, der weiss, dass die Substanz vieler Gebilde, in denen das Auge zuvor kaum Gefässe bemerken konnte, nach der Injection ganz und gar aus solchen zu bestehen scheint, wie man sich z.B. an den Knochen, zumal des Kinderschädels, an der vagina, an der pars membranacea urethrae, am Blasenhalse etc. zur Genüge überzeugen kann. Das Innere des corpus cavernosum clitoridis der Stute scheint ohne Einspritzung gleichfalls nur aus einer derben Fasermasse gebildet zu sein, nach der Injection bewährt es sich aber als ein wahres rete mirabile venosum.

Nun einige Worte über die Function der eben beschriebenen Theile. Schon beim Manne, wo der Ruthenschaft als Hauptorgan der transitven Wollusterregung auftrat, mussten wir demselben auch an der Erzeugung des Wollnstgefühles im eigenen Körper einigen indirecten Antheil einräumen. Beim Weibe zieht sich dessen anatomischer Repräsentant , das corpus cavernosum clitoridis, hinsichtlich seiner Einwirkung auf das andere Geschlecht, fast ganz in den Hintergrund zurück und seine physiologische Bedeutung beschränkt sich fast nur auf jene entfernte Theilnahme an der subjectiven und eine geringe Mitwirkung zur transitiven Wollusterzeugung. Für sich aber ist der Zellkörper der clitoris wegen seines geringen Nervengehaltes und seiner fibrösen Umhüllung einer specifischen Empfindung und Anregung dazu von aussen her ebenso wenig fähig, als der Zellkörper der männlichen Ruthe.

Was oben pag. 31 über die Leistungen des Ruthenschaftes als Träger und Widerlage des passiven Wollustorganes und ferner in Beziehung auf seine Füllung und Feststellung angeführt wurde, das gilt mit wenigen Einschränkungen auch vom Clitorisschafte.

Wir begegnen hier der Frage: Erfährt die clitoris, oder vielmehr das corpus cavernosum clitoridis bei der gesehlechtlichen Aufregung des Weibes eine Erhärtnng und Aufrichtung, ist sie überhaupt einer Erectien fähig oder nicht?

Die clitoris spielt in unserer Kenntniss vom Begattungsgeschäfte eine so untergeordnete Rolle, dass R. de Graaf's Worte: "Summopere mirati sumus quosdam anatomicos, non majorem hujus partis mentionem facere, ac si in rerum Natura non existeret" noch heute ihre Geltung haben. Besonders aber hat sich Müller (1) mehrfach gegen die Erectionsfähigkeit der clitoris ausgesprochen, und glaubt gerade hierin die wesentlichste Verschiedenheit der clitoris von der männlichen Ruthe zu finden. Sehen wir denn aber nicht die äusseren Geschlechtstheile aller unserer weiblichen Haussäugethiere schon mit herannahender Zeit der Brünstigkeit und noch weit mehr während derselben und im Begattungsgeschäfte selbst durch vermehrte Succulenz auschwellen und äusserlich hervorragen, und sich in ihrer Empfindlichkeit auf's höchste steigern? Sollte hievon nur eben die nervenreiche clitoris ausgeschlossen sein, deren passives und transitives Schwellorgan in seiner bewunderungswürdigen Einrichtung mit dem analogen männlichen Schwellapparate bis ins kleinste Detail so durchgreifend harmonirt und durch künstliche Füllung von seinen Gefässen aus zur vollständigen Erstarrung und Erection gebracht werden kann? Sollte dies die Natur selbst bei jener offenbaren geschlechtlichen Congestion nicht vermögen? Schon Plazzonus sagt: "Igitur etiam actio clitoris, quae est penis muliebris, erit erectio. Hanc erectionem ipsae lascivientes falentur foeminae, dum sibi aliquid in naturalibus indurari et prominere, cum tentigine laborant, affirmant" (2). Und wahrlich! wären unsere physiologischen Lehrbücher in so vieler Frauen als Männer Hände, wir würden manchem ungläubig lächelnden Gesichte begegnen. Wir haben fast täglich Gelegenheit, uns bei Thierweibchen von der Erection der clitoris zu überzeugen. Bringt man z. B. bei einer läufigen Hündin vor dem Aufspringen des Hundes den Finger in den Wurf, so trifft derselbe auf einen resistenlen Körper, der nichts anderes ist, als die cliloris, die jetzt, aus ihrer Tasche hervorgehoben, frei und starr in den Canal des Vorhofes hineinragt. Ja, bei dem bekannten Umstülpen der Schaamlefzen rossiger Stuten sieht man deutlich, wie der entblösste starre Kitzler in raschen Bewegungen gegen die Achse des Vorhofes einwärts gedrängt wird (3). Die Ursache dieser veränderten Lage, Stellung, Resistenz und Bewegung liegt zum Theil in der strotzenden Füllung des, im Knie gebogenen corpus cavernosum clitoridis, anderen Theils aber auch in der Contraction der vorderen Abtheilung des musculus constrictor cunni, wodurch die clitoris wie ein einarmiger Winkelhebel ins Innere des Vorhofes hineingezogen wird (4). Betrachten wir diese Muskelparthie mit einiger Aufmerksamkeit auf ihre Beziehungen zur clitoris und zum Verhofe, so wird uns diese Wirkung schon ziemlich einleuchtend. Drückt man aber bei letzterwähntem Versuche mit dem behutsam eingebrachten Finger rasch auf die erigirte glans clitoridis, so fühlt man im Bereiche des cunstrictor cunni urplölzlich ein Einwärtsdrängen der beiden aufgeschwollenen bulbi und ein Heben und Anpressen der steifen clitoris an den Finger; wobei ein gleichzeitiges Aufzucken des Thieres die stossweise, subjective Wollustemplindung desselben auch objectiv erkennen lässt (5). Zugleich ergibt sich hieraus, dass beide Abtheilungen des constrictor cumni zur glans clitoridis in genauestem Reflexverhältnisse stehen. Dieser Einfluss des Scheidenschnürers auf die Stellung der clitoris war auch einigen älteren Beobachtern nicht entgangen; denn Santorin (6) sagt mit Rücksicht auf die Lage seiner Bündel: "ut eo facilius, et quo vaginam amplexantur, sphincteris mumus obeant, et quo clitoridem deducunt, suo magis magisque munere fungi possint" und noch bestimmter Lieutaud (7): "auxquels on a donné le nom de constricteurs: il est vrai qu'ils peuvent avoir cet usage; mais ils sont destinés principalement a rapprocher le gland du clitoris vers l'ouverture du vagin".

Der Analogie nach ist ferner mit ziemlicher Gewissheit anzunehmen, dass auch der musculus ischio-cavernosus demselben Reflexverhältnisse unterworfen ist, und dass mit seiner Contraction die höchste Füllung und Steifung des corpus cavernosum clitoridis eintritt, wodurch das Entweichen des Blutes aus der pars intermedia durch die venae communicantes ins Lumen dieses Schwammkörpers unmöglich wird. Alle diese Effecte fallen auch hier auf die erfolgte Eichelreizung in einen Moment zusammen.

Die Scheide muss, vermöge ihres erectilen Gewebes, zur Zeit der Sexualcongestion eine Art von Erection erfahren, wie man dies nach der Injection deutlich zu sehen bekömmt. Graaf (8) hat mithin nicht ganz Unrecht, wenn er sagt: "Vaginae actio erectio est, cum in coitu Vaginae ductus a Pudendo ad Uterum usque erigatur; sic ut Penis regià quasi vià ad Uterum pervenire queat. Natura autem in Vagina talem erectionem molita est, ut congrua Pudendoruin affricatio ad semen eliciendum necessaria fieret, et semen facilius ad Uteri fundum pertingeret". Mit der Aufsteifung ihrer Wände muss sich aber ihr Lumen, wie das der Harnröhre aufziehen, wodurch sie sich gleichsam zu einer Saugröhre umgestaltet (9). Daher mag es auch kommen, dass man in dem Momente, wo das männliche Thier durch eine ungeschickte Bewegung die noch strotzende Rothe rasch aus der Scheide zurückzieht, ein ähnliches Schnalzen hört, wie bei einem derben Kusse, der ja auch nichts anderes ist, als ein plötzlich abgerissenes Saugen. Vergleicht man das weit ausgedehnte, ungemein reichliche, venöse Schwellgewebe der Scheide mit den spärlichen arteriae vaginales, so ermisst man leicht, dass dieselben für die rasche Füllung dieser Venenmassen offenbar viel zu unergiebig sind. Sie erfolgt vielmehr bei den rhythmischen Contractionen des musculus compressor bulbi durch die oben erwähnten Wurzeln aus dem Inhalte des bulbus vestibuli. Ja es dehnt sich vielleicht die Wirkung dieses Pumpapparates (Sexualherzens) in gewissen Momenten selbst bis auf die Tuben und Fimbrien aus (10). Eine solche schwammig elastische Auspolsterung des Seheidenrohres, zu der noch die beiden bulbi am Scheideneingange hinzukommen, qualificirt die vagina vortrefllich zu ihrem Hauptgeschäfte, nämlich zu einem sanften und doch innigen Umfassen und zur blanden Friction der männlichen Ruthe von den verschiedensten Grössenverhältnissen, wozu der constrictor cunni beim Menschen einiges, bei manchen Säugethieren vieles beitragen mag. Hören wir hierüber de Graaf (11): "Nisi enim partes illae constringi ac dlilatari possent, impossibile foret, ut generationis actus tam feliciter inter diversae magnitidinis et aetatis homines celebraretur; mulierum enim Vagina tam affabre facta est; ut se omnibus et singulis fere mentulis accommodet; sic ut brevi occurrat, longae cedat, crassae dilatetur, tenui constringatur: Natura enim omnibus Penis differentiis consuluit, ut non opus sit, sollicite vaginam cultello aequam quaere; sed ubiquc Opificis beneficio inveniatur; ita ut omnes viri cum omnibus foeminis, et omnes foeminae cum omnibis viris convenire possint, si eaetera consentiant."

1) Müller, Physiologie II. VII. 2. Ferner, Müller über zwei verschiedene Typen etc. pag. 22: "Die Erectionsfähigkeit dieses Theiles hat man zu allgemein genommen etc. Beim Menschen sah ich zwar im Inneren der corpora cavernosa clitoridis venöses Maschengewebe. Indess ist auch hier die Erectionsfähigkeit der Clitoris bei normalen Individuen nicht constatiert und jedenfalls kein constantes Phänomen.
2) Plazzonus de partibus generationis. ept. XII pag. 147.
3) Günther I. c. § 33 "Der Wurf (pudendum) zeigt das sogenannte Blinken, das heisst ein krampfhaftes Umklappen und Aufziehen der Ränder mit gleichzeitigem Aufrichten und Heben der 'clitoris'." Ebenso Hausmann I. c. pag. 30. 4) Eine ganz ähnlich Vorkehrung findet sich selbst in der Classe der Vögel. Bei der Ente enthält die an der inneren Fläche der unteren Schaamlippe liegende clitoris einen Knorpel und wird duch einen Muskel aufgerichtet. (Spangenberg disquisitio circa partes genitales foemineas avium. Göttingen 1813. 4. cum tab. pag. 26 seqq.)
5) Müller (I. c. II. VII. 2.) erwähnt, um seine Ansicht über den geringen Antheil des Weibes am Begattungsacte zu begründen: "Bei dem weiblichen Geschlechte wird keine Nerventhätigkeit auf den Act einer Erection verwendet, keine rythmischen heftigen Zusammenziehungen erfolgen auf dem Culmulationspunkte, der geschlechtlichen Erregung" etc. Eine lebenskräftige junge Frau klagte einem meiner Freunde, einem Arzte, dass sie an ihrem Eheherren keine Befriedigung finde, und in Folge dessen während ihrer weiblichen Arbeiten öfter von heftigem Geschlechtsdrange geplagt werde, wobei sie ohne ihr Zuthun dieselben rhytmischen Zuckungen und explodirenden Erschütterungen empfinde, wie bei der Begattung.
6) Santorin I. c. pag. 206
7) Lieutaud I. c. pag. 310
8) Graaf I. c. pag. 87. In ähnlicher Weise spricht sich Plazzonus (I. c. p. 161) aus: "Siquidem cum penis erigitur, durus rigidusque efficitur eo quod fibrae ejus lacae tendantur: pariter com erigitur vagina dura et tensa conspicitur repleta nimirum illius media substantia laxa et rara".
9) Ueber die Saugfähigkeit der Scheide cfr. Günther I. c. § 56. 57
10) Soll sich das Schwellgewebe der Scheide usw. füllen, so darf sich die hintere Portion des musc. constr. cunni nicht zusammenziehen, weil ihre Schne den Zugang zu ihm versperrt. Es scheint deshalb, dass, je nach den verschiedenen Bedürfnissen und Zwecken, bald die eine, bald die andere Abtheilung, bald beide zugleich zur Zusammenziehung bestimmt werden.
11) R. de Graaf I. c. pg. 82


Eine Genealogie des Geschlechtsbegriffs
Akademie Verlag

Biographisches Lexikon
der hervorragenden Aerzte aller Zeiten und Völker
Verlag: Urban & Schwarzenberg


» Zweiter Band (1885) «
» Dritter Band (1886) «
» Vierter Band (1884) «
» Fünfter Band (1887) «
» Sechster Band (1888) «


hervorragender Ärzte des neunzehnten Jahrhunderts
Verlag: Urban & Schwarzenberg
» «

Divider

Substanz und Funktion

Divider


seit dem Ende des siebzehnten Jahrhunderts - Teil 2
Verlag: Wilhelm Engelmann
» «

Homologien und Analogien

Die Botaniker erfanden für die Ähnlichkeiten der Pflanzenorgane den Namen Metamorphose, die Zoologen nannten sie Homologien und Analogien. Der Vorgänger Cuviers, der französische Anatom F. Vicq d'Azyr (1748 - 1794) machte bereits auf die Ähnlichkeiten, einmal unter den Organen verschiedener Tiere (z. B. zwischen der menschlichen Hand und dem Pferdefuß) und dann unter verschiedenen Teilen eines und desselben Tieres (z. B. zwischen der menschlichen Hand und dem menschlichen Fuß) aufmerksam. G. Cuvier erweiterte diesen Gedanken durch eine neue Lehre: der Bau einzelner Organe hängt von der Lebensweise des Tieres ab, der Bau anderer jedoch von der inneren Organisation; so hängen die scharfen Zähne und Klauen und das leichte Skelett eines Raubtieres offenbar mit seiner Lebensweise zusammen, während die Zweihufigkeit der Wiederkäuer nicht aus der Art, wie sie die Nahrung aufnehmen, erklärt werden kann - es müssen irgendwelche innere Verhältnisse im Bau des Tieres die Anzahl seiner Zehen bestimmen. Cuvier blieb bei dem Hinweis auf diesen Unterschied, ohne ihn weiter zu analysieren.

Eine gründlichere Analyse der Analogien geht den Physiologen an; da jedoch die Zeit, als Owen wirkte, physiologischen Untersuchungen nicht günstig war, blieb Owen bei der allgemeinen Bestimmung des Begriffes der Analogie, und da die spätere Zeit überhaupt den Sinn für solche begriffliche Analysen verlor, ist bis auf den heutigen Tag der Begriff der Analogie nicht gründlicher analysiert worden, obwohl es gewiß der Mühe wert wäre, die tierischen Analogien zu klassifizieren und nach dieser Seite hin unsere Kenntnisse vom Leben zu vertiefen.

Owen untersuchte jedoch näher den Begriff der Homologie und unterschied innerhalb desselben: spezielle Homologie, welche in einer Ähnlichkeit der Teile verschiedener Tiere besteht (der Fuß des Pferdes und des Vogels); ferner allgemeine Homologie, welche die Beziehung eines Teiles zu einem allgemeinen Typus bedeutet (so ist z. B. die menschliche Hand die vordere Extremität der Säugetiere). Endlich unterschied er Homotypien: Teile, welche denselben Plan auf demselben Individuum wiederholen (z. B. die Segmente der Ringelwürmer, die vordere und hintere Extremität der Wirbeltiere).

Owens Klassifikation der strukturellen Ähnlichkeiten wurde auch von den Darwinisten angenommen; E. Haeckkl und C. Gegenbaur nahmen sie nur mit kleinen Änderungen in ihre genetische Morphologie auf, obwohl sie den Grundunterschied zwischen den Homologien und Analogien zu verwischen versuchten. E. Hakckel') teilt die Homotypien noch in Homodynamien (Homologien der Segmente längs der Körperachse) und Homonomien (Homologien der Teile, welche senkrecht zur Körperachse liegen, wie Schenkel, Schienbein usw.).

Agassiz unterschied folgende Ähnlichkeiten:

1. Embryonale Typen deuten einen Gedanken an, welcher sich in der Zukunft vollkommener entwickeln wird; die ausgestorbenen mehrzehigen Pferde sind ein Beispiel.

2. Hypembryonale Typen sind solche, bei welchen sich im Übermaß Eigenschaften entwickeln, welche anderswo nur angedeutet vorkommen; die Haut des Fledermausflügels gehört hierher, welche nur eine monströs entwickelte Haut darstellt, die in rudimentärem Zustande auch zwischen den Fingern der übrigen Säuger vorkommt. Die embryonalen und hypembryonalen Typen Agassiz' entsprechen den Homologien Owens.

3. Prophetische Typen sind Owens Analogien: Ichthyosaurier prophezeien z. B, unsere Delphine, fleischfressende Saurier unsere Raubtiere usf.

Diese Philosophie Agassiz' blieb ohne Wirkung auf die Nachwelt; es würde wohl der Mühe wert gewesen sein, zu untersuchen, welche Tiere und worin sie prophetisch, embryonal, hypembryonal sind, allein Agassiz selbst führte seine Gedanken nur im allgemeinen aus, unter Anführung nur einiger Beispiele; auch erschienen seine Ansichten zu einer Zeit, als die Morphologie bereits ihren Zenith überschritten hatte; einige Monate nach seinem Essay erschien das Werk Darwins, welches wohl ganz andere Anschauungen brachte als diejenige war, daß die ausgestorbenen Tiere eine Vorahnung der heutigen seien. Es ist leider auch für die absehbare Zukunft keine Hoffnung, daß jemand den Spuren Agassiz' folgen sollte.

Seit dem Altertum, seit Plato und Aristoteles, erhält sich die Annahme, daß man die Natur als eine ununterbrochene Reihe von aufsteigenden Wesenheiten aufzufassen habe; von Leibniz wurde sie erneuert und wieder belebt, und später wurde sie zur Grundlage der Klassifikationen der organischen Natur erkoren. Da nun die von uns eben geschilderte Zeit überzeugt war, daß das Wesen des Organismus in seiner Form Hege, war sie bemüht, in der Natur jene Reihe von vollkommeneren und vollkommeneren Formen aufzufinden. Seitdem erhält sich auch die Überzeugung, daß die Klassifikation den Höhepunkt der Erkenntnis bildet, da sie am bündigsten und logischesten die Natur begreift. Linné, der zuerst ein großes System der Natur darbot, faßte es zwar nicht besonders tief auf; mehr, als um ein philosophisches Begreifen der Natur, handelte es sich ihm um eine praktische Zusammenstellung der Pflanzen nach ihren Merkmalen, zum Zwecke leichterer Wiedererkennung, sozusagen um einen Bädeker im Reiche der Pflanzen. Nichtsdestoweniger war es ein konsequent und in großem Maßstabe durchgeführter Versuch.

Nicht so harmonisch (wie das der Pflanzen) entwickelten sich die Anschauungen über das System der Tiere. Auch dieses System wurde zuerst im großen von Linné begründet, und wie seine botanischen Ansichten, wirkte auch sein zoologisches System insbesondere in Deutschland, während es in Frankreich durch Cuvier vertieft wurde. Cuvier unterschied vier Tierreihen (embranchements), welche untereinander durch keinen Übergang verbunden sind; in jeder einzelnen Reihe lassen sich jedoch die Tiere in eine Hierarchie zusammenstellen, welche mit den einfachsten Formen anfängt und mit den zusammengesetztesten schließt.

Als man neue und neue Typen annahm, verwarf man zwar nicht gänzlich die Überzeugung von ihrer Bedeutung als isolierter, ohne Übergänge dastehender Tiergruppen, aber eben deshalb, daß die Anschauungen über deren Anzahl auseinandergingen und schwankten, nahm die ursprüngliche Bestimmtheit des Typusbegriffes ab, und es verschwand der absolute Unterschied, welchen Cuvier zwischen den Typen und den niederen Gruppen aufstellte. Trotzdem blieb der Gedanke von der Abgeschlossenheit der einzelnen Typen aufrecht, um so mehr, als ihn C. E. V. Baer durch seine entwicklungsgeschichtlichen Untersuchungen unterstützte; vier Jahre vor der Erscheinung der Darwinschen Schrift verteidigte noch H. Milne-Edwards die vier ursprünglich von Cuvier aufgestellten Typen.

Diese Richtung hielt die Systematik seit Linné bis auf die letzten Jahre ein; alle bisher erwähnten Forscher suchten nach einem natürlichen System der tierischen Formen, indem sie wissentlich unwissentlich die Lebenserscheinungen nur für eine Folge der Körperstruktur hielten. Es erschienen jedoch auch Versuche anderer als anatomischer Systeme. In Frankreich führte Lamarck eine Klassifikation der Tiere nach ihren psychischen Eigenschaften ein; da ihm jedoch diese ungenügend bekannt waren, hatte sein bereits angeführter Versuch keinen Erfolg. In Deutschland wieder versuchte Oken das System auf Physiologie zu gründen.

Wenn irgend jemand seit dem Verfall der Naturphilosophie auf dieses Okensche System zu sprechen kam, begann seine Erwähnung kaum anders als mit risum teneatis; und doch, ein wie tiefer Gedanke liegt ihm zugrunde! Noch heute gibt es viele, und es sind die modernsten, welche behaupten, daß Funktion wesentlicher sei als Struktur; wenn dem so ist, hatte Oken nicht recht, die Tiere nach ihren Funktionen zu ordnen? Ist die Gruppe der Tracheentiere nicht natürlich? Ein unbebautes Gebiet hat da Oken berührt, jedoch kein Verständnis gefunden; ein unbekanntes Gebiet, voll von schönen Tatsachen - doch wird es noch lange dauern, bevor es jemand wagt, in diesem unbekannten Lande nach neuen Entdeckungen zu suchen.

Theorien über das Wesen der Kategorien
in der Klassifikation der Tiere

Die Frage, von woher die Arten, Gattungen usw. kamen, schuf erst das 19. Jahrhundert; im 18. herrschte kein Streit darüber, ob die Arten entstanden oder erschaffen wurden, sondern, ob es Arten gibt oder nicht gibt - ein altes scholastisches Problem, welches durch die Biologen des 18. Jahrhunderts erneuert wurde. Wir wollen zusehen, wie man damals die Frage formulierte. Nach Maupertuis, dem bekannten »docteur Akakia«, wurden die Organismen als eine ununterbrochene Reihe von Formen geschaffen, viele Übergangsformen starben aber aus (ont été détruites); deshalb sei die Hierarchie der Wesen unserer Erkenntnis entrückt worden. Robinet, ein französischer, von Leibniz abhängiger Philosoph, polemisiert gegen diese Ansicht Maupertuis' und schreibt im Jahre 1761:

"Die klarsten Köpfe weisen nach, daß alle Wesen von demselben Range sind, und daß es keine wesentlichen Unterschiede unter ihnen gibt, daß es niemals mehr als ein Prototyp für alle Wesen gab, dessen bewunderungswürdig zahlreiche und auf alle möglichen Arten differenzierte Variationen sie darstellen."

Es waren also beide, Maupertuis wie ROBINET, der Überzeugung, daß die Organismen eine ununterbrochene Hierarchie bilden; nur darin waren sie uneins, ob diese Hierarchie in ihrer Lückenlosigkeit durch den Menschen zu erkennen ist oder nicht.

Lamarck huldigte einer ähnlichen Ansicht; nur darin war er einer anderen Meinung, daß er die Organismen in mehrere aus einem Punkt sich verzweigende Reihen zusammenstellte. Andere sachlichere Forscher dagegen, an ihrer Spitze Linné, wußten aus ihrer Praxis, daß es Arten und Gattungen gibt und daß die Arten scharf umgrenzt zu sein pflegen; sie glaubten auch an die Kontinuität in der Natur, stellten sich aber anstatt einer linearen Stetigkeit eine flächenhafte vor und behaupteten, daß man von einem Individuum, von einer Art, von einer Gattung Übergänge nicht nur nach vorne und hinten (zu einer höheren und einer niederen Form) antreffe, sondern nach allen Seiten, zu vielen anderen Formen ; daß man sich also die Individuen und Arten als Städte, Kreise, Länder auf einer Karte vorstellen könne, welche nach vielen Richtungen zusammenhängen. So lehrten auch Pallas, Decandolle u. a.

Das Artproblem kann noch anders aufgefaßt werden. Es gibt ohne Zweifel in der Natur Arten, sonst wäre keine Anleitung möglich, die Arten zu bestimmen, es wäre nicht möglch, von den Arten zu sprechen; das Problem beginnt erst, wenn es zu sagen gilt, was sie bedeuten. Ist vielleicht die organische Substanz in ihrem Wesen bereits so beschaffen, daß sie besondere Individual-, Varietät-, Art-, Gattungs- usw. Eigenschaften haben muß, etwa so, wie ein jeder Gegenstand Eigenschaften des Punktes, der Linie, der Fläche und des Raumes hat? Dies würde bedeuten, daß ein jeder Organismus besondere Individual-, Art-, Gattungseigenschaften besitzen müsse und diese Gruppen würden etwas Absolutes sein; es müßte in der gesamten lebendigen Natur ein und derselbe Maßstab für die Art vorhanden sein, ein anderer, wieder aber durchgängig derselbe für die Gattung usw.

Oder: die lebendige Substanz hat die Beschaffenheit von Individuen, welche einander mehr oder weniger ähnlich sind: die ähnlichsten stellen wir zu einer Art zusammen, wobei jedoch der Ähnlichkeitsgrad bei verschiedenen Arten verschieden sein kann ; während eine Art (der Hund z. B.) einander sehr unnähnliche Formen enthält, schließt eine andere (z. B. der Hase) Individuen ein, welche einander fast gleich sind. In diesem Falle kann keine allgemeine Definition der Art gegeben werden; man muß jedoch auch hier wieder zwei Möglichkeiten unterscheiden. Entweder liegen die die Art charakterisierenden Merkmale im Wesen der Art selbst, wie wenn wir Ellipse, Hyperbel und Parabel unterscheiden, welche wir durch ihre Konstruktionsregel bestimmen; oder die die Art bestimmenden Merkmale sind durch die Außenwelt gegeben, wie z. B. die Umrisse der Inseln, welche durch Meeresbrandung, durch Flußmündung usw. formiert werden. In diesem Falle hat es wohl keinen Sinn, Regeln zu suchen, nach welchen die Art gebildet ist, sondern man wird nur deren Ursachen erforschen. Man merke wohl, daß im ersten Falle zwei Arten, die Ellipse und der Kreis z. B. durch Übergänge verknüpft werden und doch wesentlich verschieden sein können ; die Stetigkeit der Übergänge ist also kein Beweis gegen das Vorhandensein der Arten.

In der schematischen Form, wie wir die Frage nach dem Wesen der Art jetzt erklärt haben, erschien sie niemals in der Geschichte der Biologie; allein, diesen Sinn hat der Streit um den Begriff der Art gehabt.

Linné unterschied Varietäten, Arten, Gattungen, Ordnungen und faßte das Verhältnis dieser Gruppen so auf: außerhalb des Systems stehen die Varietäten, welche nur künstlich oder zufällig entstehen, und welche, auf sich selbst angewiesen, zur ursprünglichen Form zurückkehren. Die einfachste, systematische Einheit soll die Art sein, z. B. der Birnbaum, der Apfelbaum; die Arten derselben Gattung haben einige Eigenschaften gemeinsam (der Birn- und der Apfelbaum, zu derselben Gattung gehörend, besitzen beide in jedem der Fruchtfächer 2 Samen) und diese gemeinsamen Eigenschaften bilden die Merkmale der Gattung; die übrigen Eigenschaften, wie die Farbe der Kronenblätter, der Staubfäden, der Habitus des Baumes usw. können zwar auch Gattungsmerkmale sein, aber sind verschiedentlich unter anderen Gattungen verteilt; die in eine und dieselbe Ordnung gehörigen Gattungen haben wieder gemeinsame (Ordnungs-) Merkmale, während ihre übrigen Merkmale in anderen Ordnungen vorkommen ; die allen Ordnungen gemeinsamen Eigenschaften charakterisieren die Pflanze im allgemeinen.

Die eben erklärte Ansicht von dem Verhältnis der Eigenschaften zu den systematischen Gruppen drückte Linné in einer eigentümlichen Form aus. Gott soll, so schreibt er, dem Idealtypus der Pflanze, welcher die Pistillnatur hat, verschiedene Staubfädeneigenschaften verliehen haben und auf diese Art so viele, in der Anzahl ihrer Staubfäden verschiedene Individuen geschaffen haben, als es Ordnungen gibt (es ist bekannt, daß Linné die Pflanzenordnungen nach der Anzahl der Staubfäden unterschied). Die Eigenschaften jener Individuen hat Gott untereinander gemischt und soviele Individuen gebildet, als es Gattungen gibt. Die Gattungseigenschaften sollen sich in der Natur durch Kreuzung der Gattungsindividuen vermehrt haben und so sind die Arten entstanden. Der Zufall hat die Arten gemischt, woraus die Varietäten entsprungen sind.

Der Sinn dieser Hypothese, welche später von den Darwinisten oft angeführt und in genetischem Sinne gedeutet wurde, ist, daß die Art-, Gattungs- und Ordnungsgruppen absolut sind und daß es besondere Art-, Gattungs- und Ordnungsmerkmale gibt. Heute dünkt diese Auffassung der organischen Formen den meisten Forschern unmöglich; und doch wurde sie wieder und wieder von den Philosophen aufgegriffen und in der letzten Zeit kehren wieder einige zu derselben zurück; nicht lange vor dem Auftreten Darwins hat sich derselben sehr warm Louis Agassiz angenommen, derselbe, von welchem bereits oben gesprochen wurde. Das System und seine Kategorien, behauptete er, sind nicht nur eine Erfindung des Menschen, sie liegen in der Natur, der sie Gott eingehaucht hatte. Ein jedes Tier hat gewisse Art-, andere Gattungs-Merkmale usw., so daß, wenn man von den Krustentieren z. B. kein anderes Tier als den Krebs kennen würde, man doch an demselben die Artmerkmale von den Gattungs-, Familien- und Ordnungsmerkmalen unterscheiden könnte. Die Theorie der allmählichen Umwandlungen der Tiere durch Einwirkungen der Umgebung bestreitet Agassiz ; viele Seiten seiner Schrift hindurch bekämpft er Lamarck, der dieses lehrt und führt gegen ihm insbesondere folgende Gründe ins Feld:

Die verschiedensten Tiere leben unter denselben Bedingungen der Umgebung; wie mannigfaltig ist z. B. das Leben in einem Wassertropfen! Doch auch umgekehrt treffen wir unter den verschiedensten Umständen dieselben Tiertypen an: der Mensch, der Wolf leben von den Polargegenden bis zu den heißesten Zonen der Erde und dies wäre nicht möglich, wenn die Umgebung auf die Tiere von Einfluß sein würde. Wenn auch die Tiere noch so verschieden sind und verschieden leben, bewahren sie eine Einheit des Planes : vom Pol bis zum Äquator sind alle Vögel wesentlich ähnlich gebaut, und die Homologien lassen sich bis in solche Einzelheiten, wie die zwischen der Vogelfeder und der Fischschuppe verfolgen. Folglich glaubt Agassiz, daß alle vier Typen Cuviers vom ersten Aufkommen des Lebens auf Erden an da waren; seit jener Zeit kamen zwar neue Formen auf, jedoch nicht absolut neue, sondern die späteren drückten nur klarer und klarer denjenigen Plan aus, der von allem Anfang da war. Der Mensch bildet den Höhepunkt und Schlußstein der Entwicklung; höher wird die Natur nicht vordringen, die Zukunft wird nur einen Fortschritt des menschlichen Verstandes sehen.

In einer Hinsicht stand Agassiz hoch über seiner Zeit, welche nur für die Morphologie Sinn hatte: er begriff, daß die anatomische Anschauung vom Lebewesen derart einseitig ist, daß das auf die Morphologie begründete System nicht das natürlichste ist, daß man auch auf die Embryologie, Paläontologie, Physiologie, die geographische Verbreitung Rücksicht nehmen müsse - ein beachtenswerter Gedanke, der niemals zuvor mit einer solchen Klarheit ausgesprochen wurde, und der sich leider in der darwinistischen Flut unbeachtet verlor.

Das Auftreten Schleidens

Es ist nicht abzusehen, welchen Weg die Entwicklung der Zellentheorie weiter genommen hätte, wenn nicht Schleiden aufgetreten wäre; die damalige Zeit scheint die Entdeckung vorbereitet zu haben, daß alle Pflanzenteile aus wesentlich gleichen Elementen, den Zellen, bestehen ; daß Pflanzengefäße, Siebröhren und andere Elemente des Pflanzenkörpers nur als Metamorphose eines und desselben Elementes zu betrachten sind, welches als ein polyedrisches Körperchen den Baustein des Parenchyms, als ein einfaches Kügelchen den Körper der einzelligen Alge bildet.

Schleiden gab nicht nur der Zellentheorie eine andere Richtung, sondern er führte überhaupt in die Biologie eine neue Methode ein, durch welche er die Geister für die Aufnahme der Darwinschen Philosophie vorbereitete. Alle bisher angeführten Biologen waren Rationalisten, die an Pläne, Ideen, Vernunft in der Natur glaubten; jetzt aber sollte der Glaube an eine objektive Vernunft sein Ende finden.

Doch hatte Schleiden ein positives Ziel vor Augen; das Ziel, aus der Pflanzenkunde eine wahre, exakte Wissenschaft zu bilden; darum legte er Nachdruck auf den Titel seiner Schrift »Die Botanik als induktive Wissenschaft«. In der Darstellung seiner positiven Ansichten bekundete er gleichfalls eine frische Lebhaftigkeit; rasch verfolgte er seinen Gedanken, ohne auf Einzelheiten aufzupassen, übersah deshalb manchmal einen Fehler, einen Trugschluß, und ist folglich oft unklar, stets aber entschieden in seiner Behauptung. Man muß auf Kant zurückgehen, behauptete er, und zwar auf dem von Fries angedeuteten Wege (Fries wurde von Schleiden überhaupt sehr geschätzt), und es muß vorzüglich die englische sensualistischc Philosophie und Baco studiert werden, von den Botanikern insbesondere der Engländer Rob. Brown. Das Nachdenken über das Wesen der Dinge ist zu verwerfen; mechanische Erklärung der Natur aus Kombinationen von Grundkräften, durch welche die Formen hervorgebracht werden, ist anzustreben. Wie der Kristallograph aus der Anziehung und Abstoßung der Moleküle die anorganischen Strukturen zu erklären versucht, so soll der Morphologe aus denselben Kräften die organischen Formen verständlich machen; es gibt keinen wesentlichen Unterschied zwischen Kristallen und Organismen. Die Erfahrung sei die Losung des Botanikers, nicht das Verstehen; das Ziel der Wissenschaft sei eine in die Einzelheiten gehende Beschreibung des Geschehens:

»Die ganze Reihe aller Übergänge muß durch die Sinne ergriffen werden und es darf keine unbemerkte Lücke in der Entwicklung bleiben«, so behauptet er und drückt dadurch einen jener Grundsätze aus, die für die moderne Wissenschaft am bezeichnendsten sind.

Das Ideal einer induktiven Wissenschaft führte ihn direkt auf die genetische Philosophie. Wie man bei der Induktion vom einzelnen zum allgemeinen, vom einfachen zum zusammengesetzten fortschreitet, so sollen wir die Lebensvorgänge nur durch Verfolgung ihrer Entwicklung richtig auffassen, welche ebenfalls vom einfachen zum zusammengesetzten sich erhebt. Der Bau der Pflanzen diente ihm als Beispiel: das entwickelte Pflanzengewebe besteht aus verschiedenen Gebilden: Zellen, Gefäßen, Siebröhren, Milchröhren; erst indem man ihrer Entwicklung folgt, erkennt man ihren Zusammenhang, d. h. die Entwicklung aller aus ähnlichen Anfängen. Deshalb empfiehlt Schleiden immer wieder die genetische (embryologische) Betrachtung; deshalb verwirft er die idealistische Morphologie, die Lehre von der Einheit des Planes, von der Metamorphose, von den Homologien.

Die Bestimmtheit, mit welcher Schleiden seine Ansichten über die Entstehung der Zellen vortrug, überzeugte viele Histologen und brachte das Zellenproblem in den Mittelpunkt der Forschung; deshalb fand man bald seinen Irrtum heraus, wonach neue Zellen in den alten, aus der in ihnen eingeschlossenen embryonalen Substanz kristallisieren sollen. 1839 beschrieb H. v. Mohl die Entstehung der Sporen durch Vierteilung einer Mutterzelle und 1841 richtete F. Unger direkt gegen Schleiden seine Entdeckung, daß am Vegetationspunkt der Pflanze neue Zellen durch Teilung der alten entstehen; diese Beobachtungen wurden dann durch Nägeli und H. V. Mühl weiter verfolgt.

Theodor Schwann

Der gute Kern der Schleidenschen Theorie ging aber nicht verloren ; noch ehe seine Hypothese von der Entstehung der Zellen zum Falle gebracht wurde, wurde seine Lehre von der Entwicklung der Gewebe aus Zellen von Theodor Schwann (1840 - 1882) auch auf die Tiere angewendet. Es fehlte früher keineswegs an Versuchen, den Tierkörper in lebendige Elemente zu analysieren; der Theorien Leibnizen's und Buffon's ist Erwähnung getan; am Ausgang des 18. Jahrhunderts behauptete Erasmus Darwin (Alb. Haller war bereits früher einer ähnlichen Ansicht) und andere, daß der Tierkörper aus Elementarfibrillen zusammengesetzt ist und H. Milne-Edwards lehrte, daß die lebendigen Elemente des Tierkörpers äußerst kleine Kügelchen seien. Mehrere Forscher wurden bereits der tierischen Zellen gewahr, ja einige verglichen sie schon mit den Pflanzenzellen; es waren dies in Frankreich Dutrochet, Turpin, DUumortier; auch Purkinje beobachtete insbesondere in tierischen Drüsen Zellen und analogisierte diese »tierischen Körnchen« mit den Pflanzenzellen. Der Gedanke, daß auch der erwachsene Organismus aus Zellen besteht, wurde von Schwann nicht, wenigstens nicht mit voller Klarheit, verteidigt.

So brachte Schwanns Zellentheorie zweifaches dar: erstens die Erkenntnis, daß der zusammengesetzte Organismus sich aus Zellen entwickelt, zweitens eine neue Philosophie, welche induktiv, genetisch und mechanisch war. Schwann war sich der weitreichenden philosophischen Bedeutung seines Werkes bewußt; er schreibt im Vorwort: »die vorliegende Abhandlung hat zur Aufgabe, den innigsten Zusammennang beider Reiche der organischen Natur aus der Gleichheit der Entwicklungsgesetze der Elementarteile der Tiere und Pflanzen nachzuweisen«.

Auch über das Mechanische seiner Theorie war er sich klar. Schleiden behauptete (und Schwann bestritt diese Behauptung nicht), daß der Organismus ein gesetzmäßiges Aggregat von Einzelwesen niederer Ordnung sei; gegen die vitalistische Ansicht von der Einheit des Lebens im organischen Körper, gegen eine einheitliche Lebenskraft führte Schleiden aus, daß das Leben ein Resultat aus dem Zusammenarbeiten vieler Zellen sei. Schwann schreibt ebenfalls in diesem Sinne:

»Einem Organismus liegt keine nach einer bestimmten Idee wirkende Kraft zugrunde, sondern er entsteht nach blinden Gesetzen der Notwendigkeit durch Kräfte, die ebenso durch die Existenz der Materie gesetzt sind, wie die Kräfte in der anorganischen Natur. Da die Elementarstoffe in der organischen Natur von denen der anorganischen nicht verschieden sind, so kann der Grund der organischen Erscheinungen nur in einer anderen Kombination der Stoffe liegen.«

Die Bedeutung neuer Beweise (für den Darwinismus)

Im 17. und 18. Jahrhundert lehrte man, daß das menschliche Spermatozoon ein kleines Männlein sei; und es fanden sich Forscher, welche bestätigten, daß sie in der Tat durch das Mikroskop im Spermatozoon Teile des menschlichen Körpers gesehen hätten. Ihnen gegenüber behaupteten andere, daß das Tier nicht im Spermatozoon, sondern im Ei eingeschlossen liege; der berühmte Biologe Spallanzani bestätigte diese Theorie durch das Studium der Kaulquappenentwicklung. Auch herrschte damals der Glaube an das Phlogiston, das man durch Hitze aus den Substanzen austreiben wollte; und wirklich entdeckte man die Tatsache, das viele Substanzen im Feuer leichter werden. Man glaubte an vorsintflutliche Menschen; A. Scheuchzer entdeckte als Beweis eine Versteinerung, die er »homo diluvii testis* benannte; Cuvier wollte aber an diluviale Menschen nicht glauben: er erntete viel Ruhm durch den Beweis, daß Scheuchzer's Fund nur ein fossiler Salamander war - und trotzdem hat der diluviale Mensch gelebt. Und so wäre es möglich, der Geschichte der Wissenschaft Schritt für Schritt zu folgen und zu zeigen, daß sie eine Geschichte von Beweisen ist, die keine waren.

Es ist die objektive Wissenschaft, welche diese Auffassung der Tatsachen herbeiführte, welche den Unterschied zwischen Tatsache, Hypothese, Theorie, Beweis usf. aufstellte. Tatsache soll die reine, durch keine Subjektivität getrübte Erkenntnis darstellen; Hypothese eine Möglichkeit, welche noch des Beweises harrt, Theorie eine Zusammenstellung von Tatsachen zu einer einheitlichen Auffassung; an die Tatsachen muß man glauben, an die Hypothesen und Theorien darf man jedoch nicht glauben; die Tatsachen sollen ganz neutral sein und in jede Hypothese, in jede Theorie, in jede Philosophie hinein passen, die Hypothesen und Theorien dagegen nur in ihrer tatsächlichen Begründung der Wahrheit entsprechen. Diese Unterscheidungen sind aber Wortspielereien, welche von der Scholastik nur darin abweichen, daß sie um einige Jahrhunderte jünger sind. Kein aufrichtiger Forscher glaubt in seiner Praxis weder an die objektive Wissenschaft, noch an die Unterschiede von Tatsachen und Theorien, sondern bedient sich dieser Worte nur aus Höflichkeit, um seine Überzeugungen in anständige Form zu gießen; für ihn selbst gilt als die wahrste Wirklichkeit, als Tatsache, was andere als Hypothese bezeichnen würden; »objektive Tatsachen« erkennt er nicht an, sondern nur subjektive, indem jede Tatsache im Lichte seiner neuen Entdeckung neue Farben, neue Formen zeigt ; zeigt sie sie nicht, so ist sie für ihn wertlos, existiert überhaupt nicht. Darwin war beispielsweise ein äußerst objektiver Forscher, allein seine Objektivität bestand bloß darin, daß er in höflichster Form die Einwendungen seiner Gegner besprach, ohne sich durch dieselben im geringsten im Glauben an seine Lehre beirren zu lassen. Die Entwicklung der Organismenwelt, welche alle als Theorie bezeichnen, hielt er in seinem Inneren ohne Zweifel für die wahrste Tatsache von der Welt, und die »objektive« Tatsache, daß es Arten gibt, betrachtete er als falsch. Jeder Forscher folgt dieser Methode, muß ihr folgen: es wäre eine Frivolität, wenn jemand eine Hypothese aufstellte, von deren Wahrheit er nicht gleichzeitig fest überzeugt wäre ; es ist eben nur Höflichkeit, wenn er diese seine Überzeugung dem Leser als bloße Möglichkeit darbietet.

Es gibt also keine objektiven Tatsachen; jede Tatsache ist subjektiv und ist als solche nicht frei von Hypothese, von Theorie, von Philosophie; jede Tatsache, welche nicht als sinnloses Wort auf dem Papier steht, sondern welche aus dem Geiste des Menschen als sein lebendiges Produkt gesetzt wird, stellt einen ganzen Mikrokosmos dar, welcher eine neue Auffassung nicht nur einer einzelnen Erscheinung, sondern der ganzen Welt enthält. Eine Entdeckung, welche nicht die Umwälzung der gesamten Weltanschauung als Möglichkeit einschließt, ist gar keine Entdeckung.

Infolgedessen ist der Grundsatz der modernen Wissenschaft, die Tatsachen selbst sprechen zu lassen, an sich sehr richtig, nur muß man ihm gerade den entgegengesetzten Sinn geben, als ihm gemeinhin unterlegt wird. Die toten, jeder Subjektivität baren Tatsachen sind stumm und können nicht sprechen, nur die im Geiste des Menschen lebenden haben eine Sprache, und je subjektiver sie sind, desto leichter sind sie zu verstehen, desto natürlicher ist ihre Wirkung auf uns, die wir auch lebende Subjekte sind. Die toten Tatsachen können aufeinander nicht reagieren, können nichts beweisen, nichts widerlegen, können sich zu keiner Wahrheit zusammenscharen; darum hat die objektive Wissenschaft zur Logik, zur Beweisführung greifen müssen, um Bewegungsmittel, Hebel und Maschinen zu haben, durch welche die totgeschlagenen Tatsachen hin und her geschoben werden könnten. Einerseits Tatsachen, anderseits Hypothesen und Theorien: der eine schiebt die Tatsache hierher, der andere dorthin, und das nennt sich Beweisführung, bei der die Tatsachen selbst sprechen.

Doch uns, die wir die Entwicklung des Darwinismus verfolgen, bleibt nichts anderes übrig, als zu konstatieren, daß für das Aufblühen dieser Lehre die toten Tatsachen, zu gewissen Beweisen zusammengestellt, von großem Einfluß waren.

https://commons.wikimedia.org/wiki/File:Edwin_Klebs.jpg


Verlag: August Hirschfeld
» «

Die anatomische Erforschung der Krankheitsvorgänge ist die Aufgabe derjenigen Wissenschaft, welche man gegenwärtig, freilich grammaticalisch nicht richtig, kurzweg als "pathologische Anatomie" bezeichnet. Sie datirt von demjenigen Zeitpunkte, an welchem man aufhörte, die Krankheiten als fremde Wesen zu betrachten, welche den normalen Bau und Verrichtung des Körpers stören. Seit dieser Zeit giebt es für den wissenschaftlichen Forscher nur Abweichungen von den normalen Lebensvorgängen, die ihren Grund in der veränderten Beschaffenheit der Körpertheile haben müssen. Es kann nicht in Frage gestellt werden, ob jeder Krankheitsprocess eine materielle Grundlage habe; denn wir können die Existenz von Kräften nicht anerkennen, welche von der Materie abgelöst sind; sondern es ist vielmehr die Frage, ob diese materiellen Veränderungen in jedem Fall nachgewiesen werden können, und diese Frage muss verneint werden. Die pathologische Anatomie ist demnach eine unvollkommene Wissenschaft, aber der Jünger, welcher sich an ihr Studium begiebt, kann sich damit trösten, dass sie zugleich eine progressive Wissenschaft ist. In kurzer Zeit, seit dem Ende des vorigen Jahrhunderts, ist ein gewaltiges Material von Thatsachen zusammengebracht, und, was mehr sagen will, so weit gesichtet, das umfassende Gebiete dem wahren, wissenschaftlichen Verständniss erschlossen sind. Andere warten noch der Bearbeitung, welche die gegenwärtigen Untersuchungsmethoden gestatten, und andre endlich werden sich demjenigen erst erschliessen, welcher neue Wege der Forschung eröffnet.

Über die Verhältnisse der organischen Kräfte untereinander
in der Reihe der verschiedenen Organisationen,
die Gesetze und Folgen dieser Verhältnisse

Faksimile der Ausgabe von » Karl Friedrich von Kielmeyer « Stuttgart 1793
Verlag: Armin Gens

» Die Gesetz der grossen Maschine der organischen Welt «
Book review
Journal for General Philosophy of Science volume 26, pages 191-202 (1995)
» Kristian Köchy « und Ansgar Richter

Wenn moderne Wissenschaftstheoretiker zu der Einsicht gelangen, daß "die Themen 'Organisation' erst recht 'Selbstorganisation' [...] im Anschluß an die wissenschaftliche Revolution des 17. Jahrhunderts zu einem zentralen Problem geworden" sind, dann ist damit auch ein aktuelles Themenfeld biowissenschaftllicher Forschung angesprochen, das letztlich in der Frage kulmieren muß: "Was ist Leben?" Mit einer solchen Fragestellung ist allerdings heutzutage für viele Fachvertreter bereits der enge Rahmen der Disziplin "Biologie" überschritten, in der zwecks Erhaltung des Leistungsstandes solche "metaphysischen Restbestände" systematisch ausgeklammert und in den Zuständigkeitsbereich der Philosophie verwiesen werden. Diese Distanzierung stellt für die Wissenschaft vom Lebendigen allerdings eine Negierung ihrer Grundfunktion dar. die Trennung der Arbeitsfelder von Fachwissenschaft und Philosophie bietet hier nur eine Scheinlösung. Betrachtet man nämlich die innovativen und progressiven Phasen der Wissenschaftsentwicklung etwas eingehender, so wird man feststellen, daß gerade in diesen Phasen verständlicherweise metatheoretische Diskussionen in die Fachwelt hineingetragen werden, wobei sich vor allem die Wissenschaftler an der Forschungsfront auch philosophischen Analysen gegenüber offener zeigen. Im Lichte dieser Feststellungen erweist sich die Situation der modernen Biologie als höchst unbefriedigend. Sie zeichnet sich dardurch aus, daß es ihr weitgehend an einem metatheoretischen und philosophischen Diskurs fehlt. So überläßt die Biologie die Diskussion über ihre eigenen Grundbegriffe in großem Umfang fachfremden Wissenschaftlern.

Divider

Pathologie
Teratologie

Divider


Erster Theil - Allgemeine Pathologie
Verlag: Schäferische Buchhandlung
» «

Im Zeitalter der Renaissance galt es, die allgemeine Wissenschaft zu vernichten, um die individuelle zur Geltung zu bringen, also gerade das Gegenteil des heutigen Ideals.
(Emanuel Rádl)


seit dem Ende des siebzehnten Jahrhunderts - Teil 1
Verlag: Wilhelm Engelmann
» «

6. Der Verfall der Biologie nach Leibniz.

Es ist merkwürdig, wie rasch das Interesse an tiefen biologischen Problemen, das in der Zeit von Harvey bis Swammerdam so viele tüchtige Männer erfüllte, am Ende des 17. und am Anfang des 18. Jahrhunderts verschwand und einer flachen Naturanschauung Platz machte. In der vergleichenden Anatomie war bis in die zweite Hälfte des 18. Jahrhunderts kein Fortschritt zu verzeichnen. Die Bearbeitung der Histologie hörte mit Malpighi auf, und erst Bichat hat in den letzten Jahren des Jahrhunderts diese Wissenschaft von neuem entdecken müssen. Die Embryologie war zwar ein sehr oft behandeltes Gebiet, aber der Streit der Ovisten und der Animalkulisten, sowie die evolutionistischen Theorien überhaupt geben ein nur zu deutliches Bild von dem kläglichen Zustand des biologischen Denkens in jener Zeit. Die wichtige Arbeit von C. F. Wolff, welche in der Mitte des 18. Jahrhunderts erschien, wurde nicht verstanden und geriet in Vergessenheit; im 19. Jahrhundert mußte sie von neuem entdeckt und herausgegeben werden, damit man auf sie aufmerksam würde. In der Systematik hat Linné zwar nachhaltig gewirkt, aber mehr in die Breite gehend als in die Tiefe, und aus der Physiologie hat nur die Lehre von der Irritabilität der Biologie einen verhältnismäßig neuen Gedanken zugeführt.

Woher kam denn dieser Stillstand der Wissenschaft? Es ist mir nicht möglich, seine Ursachen vollständig anzuführen; aber das sehe ich deutlich, daß die Biologen der ersten Hälfte des 18. Jahrhunderts nur Epigonen von Malpighi, Swammerdam, Borelli, Stahl usf. waren, und wie es die Art des Epigonentums ist, haben sie zwar die materielle Seite ihrer großen Vorgänger nachzuahmen gewußt, ohne aber den Geist ihrer Naturanschauung erfassen zu können. Sie haben ganz richtig die Erfahrung betont, wie Reaumur und Haller; sie haben auch dicke Bücher über Naturphilosophie verfaßt, wie Bonnet; sie haben viel Neues entdeckt, wie Leeuwenhoek, doch hat ihnen die Kraft gefehlt, welche ihrer Erfahrung, ihren Theorien, ihren Entdeckungen innerliches Leben hätte verleihen können.

Eine andere ebenfalls nicht sonderlich erfreuliche Erscheinung in der Biologie des 18. Jahrhunderts ist die große Berühmtheit, die einigen Naturforschern damals zuteil wurde. Gewiß ist es dem Leser bereits aufgefallen, daß man noch heute immer von dem »berühmten Réaumur«, dem »berühmten Haller« spricht, nicht aber von dem berühmten C. F. Wolff usf. Es kommt dies daher, daß im 18. Jahrhundert mehr als zu andern Zeiten die äußeren Schicksale für den Ruhm eines Forschers entscheidend waren. Die Wissenschaft war aristokratisch, sie hatte Zutritt in die Salons der hohen Gesellschaft erlangt, und das, was sich der oberflächlichen und genial sein sollenden Auffassung dieser Kreise anpaßte, wurde mit größten weltlichen Ehren aufgenommen; dasjenige aber, was als wirklich wahr zu gelten beanspruchte und deshalb seichten Köpfen unzugänglich war, wurde mißachtet. Zu keiner Zeit, weder zuvor noch nachher, haben die Naturforscher sich gegenseitig so geehrt, wie damals. Reaumur, Haller, Bonnet Spallanzani behandeln einander in ihren Schriften als lauter Genies und Weltberühmtheiten.

Im 18. Jahrhundert wurde der erste Schritt zur Laïsierung der Biologie getan. In früheren Zeiten waren alle Biologen (ausgenommen etwa die Systematiker) Ärzte. Linke hat anfangs noch die ärztliche Praxis geübt und auch mehrere medizinische Schriften verfaßt; Swammerdam war wissenschaftlich noch in Berührung mit den medizinischen Theorien (über die Atmung, über die Drüsen usf.), Linné war jedoch seiner wissenschaftlichen Richtung nach bereits wesentlich nicht Mediziner, sondern Biologe im allgemeinen. Reaumur, Bonnet, Buffon, Cuvier waren keine Arzte mehr und pflegten nur die Biologie als solche. Seit jener Zeit ist es trotz wiederholter Bemühungen nicht mehr gelungen, beide Gebiete wieder in eine Bahn zu lenken: heute gibt es Gebiete, die der Mediziner ebenso wie der Biologe bearbeiten kann, andere dagegen, wie die Physiologie und die Morphologie der Wirbeltiere (Gebiete, welche die Entwicklung der Theorien in der Biologie eigentlich beherrschen), werden ganz überwiegend von medizinisch gebildeten Forschern in Anspruch genommen.

Der innere Niedergang der Biologie im i8, Jahrhundert hat etwa bis in die achtziger Jahre des Jahrhunderts gedauert. Mit Cuvier hat wieder eine ernstere Forschung angefangen, wenn man auch bei dem Ruhme, der sich an seinen Namen knüpft, die Nachwirkung der früheren Zeiten in Betracht ziehen muß. In Deutschland und in England ist es zu solchen Extremen, wie in Frankreich, nicht gekommen, doch hat sich mir wiederholt der Gedanke aufgedrängt, daß sich die spätere deutsche Naturphilosophie in mehrfacher Hinsicht mit der französischen Wissenschaft aus der Mitte des i8. Jahrhunderts vergleichen läßt. Die französischen Biologen haben sich in der Mitte des 18. Jahrhunderts wesentlich nur für das Geistreiche interessiert. Sie haben mit der Lösung biologischer Probleme weniger ein subjektiv empfundenes Bedürfnis nach der Erkenntnis der Wahrheit gestillt, ihre Theorien waren weit mehr für den Leser als für den Autor bestimmt: die französisch aufgefaßte Genialität war ihr Ziel. Ganz ähnlich kann man auch die deutsche Naturphilosophie als den Versuch einer genialen Auffassung der Natur - genial um jeden Preis - betrachten: das Wühlen in den abstraktesten Begriffen, das Verschmähen jeder Logik, die Geringschätzung der Erfahrung, die Betonung der Mathematik, der dunkle Stil usw. - alles trug die Merkmale der Genialität an sich.

https://commons.wikimedia.org/wiki/File:Edwin_Klebs.jpg


Verlag: August Hirschfeld
» «

Wir müssen in der Geschichte der pathologischen Anatomie zwei Perioden unterscheiden, in deren erster ausschliesslich Material gesammelt wurde, während in der zweiten die Zusammenfassung und Ordnung der Thatsachen nach allgemeinen Gesichtspunkten angestrebt wird. Die Werke der ersten Periode, welche von Vesal bis gegen das Ende des 18. Jahrhunderts reicht, sind dahei wesentlich casuistisch und unterscheiden sich in ihrem Werth je nach der geringeren oder grösseren eigenen Erfahrung der Verfasser.

Zunächst in Deutschland vollzog sich um das Jahr 1840 ein grosser Wandlungsprocess in unserer Wissenschaft, indem die mikroscopische Forschung den gröberen anatomischen Befund ergänzte und verfeinerte, und die allgemeinpathologischen Anschauungen einer Reform entgegenführte, welche durch die Anwendung der cellularen Theorie auf die pathologischen Vorgänge ihren Gipfelpunkt erreichte: Es zeigte sich, dass ein grosser Theil jener Veränderungen, welche man, namentlich in der Wiener Schule, von einer Exsudation flüssiger Theile aus dem Blute herleitete, im Wesentlichem eine Function der zelligen Gewebsbestandttheile ist. Die Reform begann mit den Untersuchungen von Schwann, welcher die jetzt allgemein anerkannte Zusammensetzung der Gewebe in ihren Grundzügen feststellte, und von Johannes Müller, welcher dieselben oder analoge Formbestandtheile in pathologischen Neubildungen nachwies, ungerechnet die vielen andern Forscher, welche mehr im Einzelnen demselben Ziele zustrebten. Noch aber herrschte die alte Blastemtheorie, jene Lehre von Schleiden, nach welcher eine freie Bildung von Zellen in Flüssigkeiten angenommen wurde. Es sind zwei Männer, welche zu gleicher Zeit und an gleichem Ort, wenn auch in verschiedenen Gebieten die Lehre von der "legitimen Succession der Zellen" begründeten: Remak auf embryologischem, Virchow auf pathologischem Gebiete. Dem letzteren gebührt unbestritten das Verdienst der schärferen Formulirung der neuen Lehre, zu deren Begründung die Arbeiten beider Männer in gleicher Weise beigetragen. Das Wort: Omnis cellula e cellula eröffnete für die Pathologie weite Gebiete der Forschung und Erkenntniss, welche die alte Blastem- und Exsudattheorie in bequemer Weise von sich abgewiesen hatte. Indem gezeigt war, wie Zelle aus Zelle hervorgeht, jede mit einem gewissen Maass von individuellem Leben ausgestattet, mussten die Besonderheiten jedes normalen und pathologischen Gewebes in viel schärferer Weise festgestellt werden, als vordem. Soviel in dieser Beziehung geleistet, so stehen wir jedoch noch beiweitem nicht am Ziel dieser Entwicklungsperiode, der vollständigen Erkenntniss normaler und pathologischer Zellenthätigkeit.

Es ist begreiflich, dass der neue Aufschwung der mikrographischen Forschung auch auf die systematische Darstellung der pathologischen Anatomie nicht ohne Einfluss bleiben konnte. In Frankreich war es namentlich Lebert, welcher in zahlreichen Werken in diesem Sinn eine Reform der Pathologie und pathologischen Anatomie anzubahnen versuchte, allein, wie dies auch noch später vielfach geschehen ist, in der irrigen Voraussetzung, dass die Morphologie der kleinsten Theile die bestimmt ausgeprägten Verschiedenheiten der grob-anatomischen Zustände wiederholen müsste. Es ist dieser Irrthum an sich sehr natürlich und wurde von einer grossen Anzahl der tüchtigsten Forscher getheilt, ja lebt sogar in dem Bewusstsein zahlreicher Aerzte neben der alten Exsudattheorie fort. Auch hier scheint die Bequemlichkeit der Menschen nicht ohne Einfluss auf ihre Meinungen geblieben zu sein, indem es allerdings ausserordentlich angenehm und nützlich wäre, mit einem Blick in das Mikroscop alle Schwierigkeiten der differentiellen Diagnose zu überwinden. So leicht aber geben sich die Naturdinge dem Beobachter nicht. Die Leistungen Leberts für die systematische Darstellung der pathologischen Anatomie, welche in seinem grossen, mit einem prächtigen Atlas ausgestatteten Werk (Traite d'anatomie pathologique. 2 Bde. Text und 2 Bde. Tafeln. Paris, 1857.) niedergelegt sind, sollen deshalb nicht geringer geschätzt werden. Für Frankreich ist er der Begründer der pathologischen Mikrographie und sein Atlas ist für die gröbere pathologische Anatomie unzweifelhaft das bedeutendste aller vorhandenen Werke.

» Monster oder Laune der Natur (2004) «
Medizin und die Lehre von Missbildungen 1780-1914
Campus Verlag
Urs Zürcher
» Rezension von Urte Helduser «

Im Jahr 1998 wurde das Pathologische Museum Rudolf Virchows in Berlin wiedereröffnet, das der berühmte Arzt und liberale Politiker ein knappes Jahrhundert zuvor eingerichtet hatte. Mit ihren zahlreichen Präparaten von spektakulären "Missgeburten", die Virchow über mehrere Jahrzehnte hinweg zusammengetragen hatte, eignete sich seine Sammlung besonders für die Popularisierung von Wissenschaft. Die kürzliche Wiedereröffnung ist auch ein Zeichen für die Renaissance dieses spektakulären Themas. Das wiedererweckte Interesse an so genannten "Missgeburten", "Monstrositäten" oder "Freaks" dokumentiert sich in einer Vielzahl medizinhistorischer und kulturwissenschaftlicher Untersuchungen der letzten Jahre. Neuere Publikationen haben sich dabei hauptsächlich auf die so genannten "Monstrositäten" des Mittelalters und der Frühen Neuzeit oder aber die "Freaks" des ausgehenden 19. und des 20. Jahrhunderts konzentriert (z.B. Lorraine Daston / Katharine Park, "Wunder und die Ordnung der Natur 1150-1750", 2002; Rosemarie Garland Thomson (Hg.), "Freakery. Cultural Spectacles of the Extraordinary Body", 1996).

Die jetzt im Campus Verlag erschienene Dissertation Urs Zürchers, "Monster oder Laune der Natur. Medizin und die Lehre von den Missbildungen", schließt diesbezüglich eine Lücke. Sie schildert die im ausgehenden 18. Jahrhundert einsetzende und im 19. Jahrhundert ihren Höhepunkt erreichende Verwissenschaftlichung des Diskurses über Monstrositäten und die Herausbildung einer einheitlichen Missbildungsforschung, die antritt, um die bis in die Antike reichende Faszination für das Monströse aus der religiösen Spekulation in das Reich der Wissenschaft zu überführen, gewissermaßen eine Verschiebung von der Theologie zur Teratologie - so der Name der entstehenden Spezialdisziplin.

Die medizinische Beschäftigung mit Missbildungen erreicht im 19. Jahrhundert einen Höhepunkt, der sich in der Herausbildung der Teratologie manifestiert. Aber auch über die disziplinäre Spezialisierung hinaus entfalten die Missbildungen bedeutsame wissensbildende Impulse. Paradigmatisch für das 19. Jahrhundert lassen sich am Beispiel der Missbildungsforschung wissenschaftliche Verfahrensweisen der Klassifizierung und Systematisierung der Natur beobachten. Zürcher liefert damit eine beeindruckende, akribisch recherchierte und anregende Fallstudie zur Wissenschaftsgeschichte des 19. Jahrhunderts.

Am Beginn der Untersuchung steht die "Theoria Generationis" Caspar Friedrich Wolffs (1759). Mit seiner Auffassung, dass entstehendes Leben keineswegs in einem Kern vorgebildet ist, wie die Verfechter der Präformationstheorie meinten, sondern vielmehr das "Geformte aus dem Ungeformten" entstehe, vertritt Wolff ein frühes Entwicklungsmodell. Für die Nachfolger wie Blumenbach, Henke, Meckel oder Soemmering geht es darum, die Missbildungen zu systematisieren und in eine Ordnung zu bringen. Als einer der Ersten setzt Samuel Thomas Soemmering dazu systematisch Abbildungen ein und entwickelt hiermit eine spezifische Ikonografie der Missgeburten. Der Zoologe Geoffroy Saint-Hilaire führt eine Versuchsreihe mit Hühnereiern durch, in der es ihm gelingt, missgebildete Embryonen zu erzeugen. Etienne Geoffroy Saint-Hilaire und sein Sohn Isidore werden als eigentliche Begründer der Teratologie in die Medizingeschichte eingehen. Zwar führten die beiden Ansätze ihrer vornehmlich deutschen Vorgänger weiter, für die Radikalität ihres Unternehmens bedurfte es jedoch nach Auffassung Zürchers des gesellschaftlichen Kontexts des revolutionären Frankreichs. Ihr Ziel einer endgültigen Erledigung der Präformationstheorie begründen Vater und Sohn mit einem aus der Revolution abgeleiteten Fortschrittsverständnis. Das Bestreben der beiden, der Teratologie einen festen Platz in den Naturwissenschaften zu sichern, ist mit der weiteren Systematisierung des Missbildungswissens verbunden: Isidore entwickelt ein Schema zur Klassifikation der Missbildungen nach dem Vorbild Linnés, in das nun alle Formen der Monstrositäten eingeordnet werden können. Die Monstrositäten haben damit endgültig ihren Platz in der natürlichen Ordnung gefunden, sie können nun in ihrer eigenen Regelhaftigkeit erkannt werden.

Am Ausgang des 19. Jahrhunderts markieren diese Tendenzen letztlich das Ende der Teratologie. Zunächst kommt es zu einer Popularisierung der Wissenschaft von den Fehlbildungen, wie Virchow sie mit der Zurschaustellung seiner anatomischen Sammlung betreibt, dies führt jedoch dazu, dass die wissenschaftliche Beglaubigung des Monströsen vor allem dazu dient, die Attraktivität von Menschen mit Missbildungen für das aufkommende Showbusiness zu steigern. Berühmtes Beispiel hierfür sind die "siamesischen Zwillinge" Chang und Eng, die auf mehreren Europa-Touren als Sensationen gezeigt wurden und zugleich Ärzten wie Virchow als Forschungsobjekt dienten. Während Virchows pathologisches Museum bereits kurz nach seiner Eröffnung 1899 mit dem Tod des berühmten Arztes 1902 nachlassende Besucherzahlen vermerken muss und schließlich verkleinert wird, erlebt der amerikanische Zirkus Barnum & Bailey zur gleichen Zeit mit seinen Freakshows auf Europa-Tournee große Erfolge. Nach Zürcher ist damit aber auch schon der Höhepunkt der Missgeburten-Schaustellerei erreicht. Die Monstrositäten verlieren ihre Attraktionskraft in dem Augenblick, in dem als Folge des Ersten Weltkriegs die Verkrüpplung zur Massenerscheinung wird.

Die einstmals mit revolutionärem Fortschrittsgeist versehene Teratologie erfährt im beginnenden 20. Jahrhundert ihren endgültigen Niedergang. Für den Zerfall der Disziplin macht Zürcher zunächst nur wissenschaftsinterne Gründe geltend. Danach ist es der Teratologie nicht gelungen, sich aus den verschiedenen Fachgebieten zwischen pathologischer Anatomie und Zoologie als einheitliches Fach zu institutionalisieren. Ebenso habe sie den Anschluss an die medizinische Entwicklung verpasst, indem sie wichtige Paradigmenwechsel nicht mitvollzogen habe. Mit dem Abbruch seiner Untersuchung zur Zeit des Ersten Weltkriegs lässt Zürcher eine Schlussfolgerung aus, die seine Analysen selbst nahe legen. So stellt er fest, dass das Missbildungswissen seit der zweiten Hälfte des 19. Jahrhunderts laut Zürcher "immer öfter in einem rassistischen und eugenischen Zusammenhang" erscheint. Zürchers Untersuchung endet - ohne dass der Autor diesen Zusammenhang herstellt - gewissermaßen dort, wo die teratologische Fortschrittsgeschichte sich endgültig in ihr Gegenteil verkehrt: bei den in den 1920er Jahren entwickelten Konzepten zur "Vernichtung lebensunwerten Lebens" und ihrer Umsetzung im Nationalsozialismus.

Berliner Medizinhistorische Museum der Charité

» Berliner Medizinhistorische Museum der Charité «

» Handbuch der pathologischen Anatomie (1863) «
Verlag: Leopold Voss
» «

Ueber den Bau der männlichen Geschlechtsorgane finden sich nur wenig Notizen und ebenso verhält es sich mit den krankhaften Veränderungen, von denen metastatische Orchitis, durch heftigen Husten entstandene Hodengeschwulst (Hernie?), Wassergeschwulst und Varix flüchtig und ohne nähere Beschreibung erwähnt werden. Von den weiblichen Geschlechtsorganen kannte man nur die Theile näher, welche der äusseren Untersuchung zugänglich sind, also Vulva, Vagina, Vaginalportion und höchstens noch den Cervix uteri mit seinem Kanal und Mündungen, über alles in der Bauchhöhle Verborgene hatte man keine Kenntniss und meist ganz falsche Vorstellungen, die Ovarien und Tuben werden nirgends erwähnt. Dem Uterus, den man offenbar für doppelt oder in Hörner ausgehend hielt, schrieb man eine eigentümliche, willkürliche Bewegungsfähigkeit und eine Liebhaberei für Wohlgerüche und Absehen gegen übelriechende Dinge zu, kurz man stellte ihn fast einem Thiere gleich, eine Ansicht, die sich auch bei späteren Autoren wiederfindet. Daher spielte unter den Veränderungen des Uterus das "Aufsteigen" desselben bis zum Halse hinauf eine grosse Rolle, wie ja auch noch heute in der Volksmedicin alle hysterischen Erscheinungen vom Aufsteigen der Mutter abgeleitet werden. Ausserdem kannte man aber auch den Prolapsus, die Retroversio, die Schieflage oder Seitenlage und selbst die Inversio nach der Einbindung (Epidem. II), so gut man diese Veränderungen eben an Lebenden beurtheilcn kann. Man kannte ferner die Uterusentzündung im Puerperium, die bei Wöchnerinnen vorkommenden Entzündungen und Ulcerationen der Scheide und Vulva und die zuweilen hieraus hervorgehenden Atresien. Uebrigens wird oft von Entzündung und Verschwörung des Uterus, oder, wie es gewöhnlich heisst, der Uteri, gesprochen, wo man sehr willkürlich aus den Symptomen Schlüsse zog. Das Carcinom der Mamma und des Uterus kannte man aus den Untersuchungen an Lebenden leidlich; sehr unbestimmte Anschauungen hatte man von Wassersucht, Aufblähung, Rothlauf, Verdrehung u. s. w. der Uteri. Uebrigens hatte man einige Kenntniss von Beckenabscessen und deren Perforation in die Scheide.

In Galen (Claudius Galents, 131 - 201 n. Chr.) finden wir einen Forscher, dessen Bestrehungen sich nicht auf die Befriedigung der Bedürfnisse der Praxis beschränkten, sondern im Sinne ächter Wissenschaft auf möglichst umfangreiche Erforschung der Natur und der Organismen gerichtet waren und welchem in dieser Hinsicht im ganzen griechischen Alterthume nur Aristoteles an die Seite gestellt werden kann. Dies beweisen aber vor Allem seine Leistungen im Gebiete der Anatomie, welche für alle Zeilen grossartig dastehen, ohschon sie sich vorzugsweise auf die Thiere beschränken. Galen erkannte den Bau des Herzens und der Gefässe, den Blutgehalt der Arterien nebst deren Vertheilung ziemlich genau und wurde nur durch seine unglücklichen theoretischen Ansichten von der Entdeckung des Blutlaufes abgehalten; ferner hatte er den Bau des Gehirns und Bückenmarkes und der von ihnen abgehenden Nerven zum grossen Theile richtig erkannt, wurde aber auf diesem Gebiete durch seine vorgefassten Meinungen irre geleitet und von der richtigen Einsicht abgelenkt. Galen untersuchte ausser vielen anderen Thieren vorzugsweise Affen und hielt den Bau der letzteren für so identisch mit dem des Menschen , dass er anatomische Untersuchungen der letzteren kaum für sehr nothwendig hielt. Dass zu seiner Zeit Menschenleichen hie und da zur Untersuchung des Körperbaues benutzt wurden, geht aus verschiedenen Stellen seiner Werke (z. B. de anat. admin. 1. 2. III. 5.) hervor, er selbst kann aber schwerlich viele solche Untersuchungen gemacht haben, da seine Beschreibungen, auch wenn er sie auf den Menschen bezieht, doch offenbar meist der Untersuchung von Thieren entnommen sind; jedenfalls kann er nie einen menschlichen weiblichen Körper untersucht haben, sonst würde er nicht die Ziege und das Kalb unter diejenigen Thiere rechnen, deren Uterus dem menschlichen gleich ist. (De dissect. uter. 3.). Uebrigens ist gerade in Bezug auf den Uterus Galen der Erste, welcher aus anatomischen Gründen die Möglichkeit des Aufsteigens des Uterus bis zum Zwerchfell und weiter widerlegt (De loc. affect. VI. 5.).

Paulus von Aegina (c. 660 n. Chr.) gab in seinem Lehrbuche eine kurze Zusammenstellung des Besten aus den Werken seiner Vorgänger und seiner eignen Erfahrungen, die sich besonders auf das Gebiet der Chirurgie und Weiberkrankheiten erstreckten. Alle totalen, der äusseren Untersuchung zugänglichen Veränderungen werden zwar sehr kurz, aber oft mit grosser Treue beschrieben, so besonders der Krebs des Uterus und der Mamma, die Fetthyperlrophie der letzleren bei Männern, die Geschwüre und Condylome der äusseren Geschlechtstheile, die Aneurysmen, die Polydaktylie, welche Paulus ganz treffend schildert, Hypospadie des geringsten Grades, während die der höheren Grade als Hermaphrodismus aufgeführt werden, die Hydrocele, Cirsocele, Hernia scrotalis, Atresia vaginae und ani, die Filaria medinenis, Varicen, bei denen auch die am Bauche unter dem Nabel vorkommenden erwähnt werden. Aus der Beschreibung der Häute der Hoden, inbesondere der eigenthümlichen Scheidenhaut, und der Fracturen und Luxationen geht hervor, dass Paulus die betreffenden Theile wohl an menschlichen Leichen untersucht haben musste. Die Veränderungen der inneren Organe werden nur nach den Symptomen beschrieben und hier der Vermuthung ziemlicher Spielraum gelassen; Hinweise auf Leichenbefunde kommen nicht vor.

Werfen wir noch einen Blick auf die Geschichte der pathologischen Zootomie in dieser Periode, so kann man schon aus der ganzen vorigen Darstellung ersehen, dass sie unter günstigeren Verhältnissen und eher begann, als die pathologische Anatomie des Menschen. Sie hatte zunächst den grossen Vortheil, dass die physiologische Zootomie einen hohen Grad der Ausbildung erreichte und sie daher viel eher eine sichere Grundlage gewann ; und ferner war sie dadurch begünstigt, dass Thierleichen ohne Scheu und Verstoss secirt werden konnten und also ein reiches Material zu Gebote stand. Dennoch beschränkt sich das, was in der pathologischen Zootomie geleistet wurde, ganz gleich wie bei der physiologischen Zootomie, fast nur auf die Beobachtungen einzelner Naturforscher und Menschenärzte, während die eigentlichen Thierärzte nur äusserst wenig zur Bereicherung dieser Zweige der Wissenschaft beitrugen.

Nachdem schon im dreizehnten Jahrhundert der grosse Franciscaner Roger Baco, seine Zeit weit überragend, auf die empirische Forschung als die Quelle der Erkenntniss hingewiesen, nachdem im vierzehnten und fünfzehnten Jahrhundert der Sinn für reales Wissen und positive Kenntniss im Gegensatz zu den inhaltsleeren Luftgebilden der scholastischen Dialektik allmälig immer mehr gewachsen, kamen endlich im sechzehnten Jahrhundert der neue, frische Geist selbstständiger Forschung, und der gewaltig alle Schranken durchbrechende Trieb nach ureigner Erkenntniss, unabhängig von den Alten und von der Schablone der Scholastik, zur vollen Entwicklung. Eine neue Culturperiode blühte auf, getragen von dem wohlhabenden und gebildeten Mittelstande, der sich endlich durch die im Mittelalter allein herrschenden Stände des Clerus und des Adels Bahn gebrochen hatte; eine Culturperiode, die sich ächt menschliche Bildung, vollste Entfaltung der Humanität zum Ziele steckte, um so mit den neuen, durch die Schule vieler Jahrhunderte geläuterten Kräften der modernen Culturvölker das zu erreichen, was schon das edle Volk der alten Griechen versucht halte. Zu Boden fiel der blinde Autoritätsglaube, der so lange schwer auf dem geistigen Leben der Völker gelastet hatte, und die Menschheit fasste wieder den Muth zur freien, wissenschaftlichen Forschung, die nur die Gesetze vernünftiger Erkenntniss und keine anderen über sich duldet.

Die alte Weltanschauung fiel, als Kopernicus und Galilei die Fesseln der Erde gelöst und mit der Bewegung der Erde auch die der Geister erweckt hatten; an die Stelle des Wunders trat die physische Gesetzmässigkeit, nachdem Kepler und Newton den Mechanismus der Weltkörper und sein Gesetz erkannt hatten. Es erstand die mechanische Naturwissenschaft und mit ihr der Sieg der iuductiven Methode, die freilich in der Medicin erst nach langen Kämpfen errungen wurde. Aber Eines theilte die Medicin schon im Anfang dieser neuen Culturperiode, den Trieb nach eigner, selbstständiger Forschung, und dieser trug bald die schönsten Früchte, denn er riss die Medicin aus dem Moder des blinden Autoritätsglaubens, aus den Fesseln der spitzfindigen Dialektik und führte sie zurück auf ihre wahre, letzte Grundlage: die Erkenntniss der Natur und der Organismen. Und so war es denn die anatomische Forschung, welche zuerst die Geister beschäftigte und den Grundstein bildete für die neue Epoche der Medicin, welche nun auch der pathologischen Anatomie neue Bahnen eröffnete', in denen sie von nun an in immer reicherer Entwickelung vorwärts schritt, bis sie aus einem unbedeutenden Anhängsel der Diagnostik zur vollständigen Wissenschaft wurde.

Die Zeilen der ausschliesslich symptomatischen Auffassung der Krankheiten, wie sie noch im vorigen Jahrhundert bei Sydenham in höchster Blüthe obwaltete, waren vorüber, bei allen bedeutenden Pathologen dringt der Grundsatz durch, dass die Erkenntniss und mit ihr die Heilung der Krankheiten in erster Linie auf Erkenntniss der Anatomie und Physiologie des Körpers begründet werden muss und dass die einzelnen Krankheiten nur mit Hülfe der Kenntniss der Veränderungen, welche sie im Körper hervorrufen, richtig beurtheilt werden können. Blieb auch die Krankheit immer noch ein mehr oder weniger personificirter Symptomencomplex, hielt man auch vielfach die anatomischen Veränderungen nur für die Producte des "Krankheitswesens", so erkannte man doch, dass die meisten der überhaupt existirenden, aufgestellten und beschriebenen Symptomencomplexe im engsten Zusammenhange mit gewissen anatomischen Veränderungen der Organe des Körpers stehen und in denselben grösstenteils ihre Erklärung finden. Und diese Erklärung der Symptomencomplexe in anatomischen Veränderungen nachzuweisen und so den Krankheiten ihren Sitz anzuweisen, nicht blos nach Vermuthungen aus den Symptomen, wie es die Alten thaten, sondern aus Leichenöffnungen, das wurde nun die Aufgabe aller Aerzte, die, unbefriedigt von dem Symptomenspiel der alten Medicin, nach neuer, positiver Begründung der Erkenntniss der Krankheiten strebten. Der pathologischen Anatomie wurde somit ein weites neues Feld eröffnet und statt zur Sammlung massenhafter Einzelheiten und Curiositäten zu dienen, wurde ihr nun die Aufgabe, eine Grundlage für die ganze Praxis zu liefern und für alle Krankheiten die anatomische Seite zu ergründen und festzustellen. Daher finden wir nun auch im achtzehnten Jahrhundert eine ganze Reihe von Werken, welche der pathologischen Anatomie ausschliesslich gewidmet sind, und letztere tritt als ein sehr wichtiger Zweig in die Reihe der übrigen Disciplinen der Medicin.

Das Gebiet der pathologischen Anatomie erstreckt sich nicht allein auf diejenigen Veränderungen der Organe und Gewebe, welche am ausgebildeten Körper vorkommen, sondern auch auf diejenigen, welche während der Bildung und Entwickelung der Organe im Ei entstehen. Die Betrachtung und Darstellung der letzleren ist Gegenstand der pathologischen Entwickelungsgeschichle. Diese Veränderungen, mögen ihre näheren Bedingungen im einzelnen Falle sein, welche sie wollen, sind sich sämmtlich darin gleich, dass sie Entstellungen der äusseren Form und Bildung bewirken, welche sich am Koitus oder Kind als Missbildungen darstellen. Von den, stets durch pathologische Entwicklung des Ei's oder Embryo's bedingten, Missbildungen sind wohl zu unterscheiden diejenigen angeborenen Krankheiten, welche durch anatomische Veränderungen der Organe und Gewebe des ausgebildeten Foetus bedingt sind, welche sich nicht mehr als Missbildungcn, sondern als Störungen der Textur darstellen, welche denen des Körpers nach der Geburt im kindlichen und reifen Alter vollkommen gleich sind. Mit dem Namen Missbildung (Monstrositas, Vitium primae formationis) bezeichnet man übrigens nicht blos die Veränderung, sondern auch den in Folge dieser Veränderung missgestalteten Foetus (Missgeburt, Monstrum, Teras) selbst, doch pflegt man im gewöhnlichen Sprachgebrauch einen Foetus oder ein neugeborenes Kind nur dann eine Missbildung, Missgeburt oder Monstrum zu nennen, wenn die Veränderung so beschaffen ist, dass sie eine bedeutende, von der normalen weit abweichende, meist die Lebensfähigkeit abschliessende Störung der Bildung bewirkte.

Die besondere Beschaffenheit oder der Charakter der Störungen der physiologischen Entwickelung und die Art und Weise, wie sie in Wirksamkeit treten, sind zwar sehr mannigfach, lassen sich aber doch leicht unter gewisse einfache Kategorien bringen. Zunächst kann man alle Missbildungen in zwei grosse Abtheilungen bringen, zu deren einer diejenigen zu stellen sind, bei denen es sich nur um eine quantitative Veränderung, eine Veränderung der Grösse und Zahl handelt, zu der anderen aber diejenigen Missbildungen gehören, bei denen das Wesentliche in qualitativer Abweichung vom normalen Bildungsgänge beruht. Die quantitative Bildungsstörung kann sich nun als eine Vermehrung oder als eine Verminderung der Bildung darstellen. Betrachten wir zunächst die erstere, so zerfallen die zugehörigen Missbildungen (Monstra per excessum) in solche, bei denen die Grösse und in solche, bei denen die Zahl vermehrt ist; Missbildungen durch abnorme Grösse des ganzen Körpers oder einzelner Organe und deren Theile kommen nicht sehr häufig zur Beobachtung, hingegen werden die durch abnorme Zahl bedingten häufig beobachtet und mit grossem Interesse; es gehören hierher die Verdoppelungen oder selbst Verdreifachungen des ganzen Körpers, einzelner Gegenden, Organe oder Theile. Die durch Verminderung der Bildung charakterisirten Missbildungen (Monstra per defectum) stellen sich bald als einfache Defecte, bald als Hemmungsbildungen dar; bei den ersteren ist ein grösserer oder kleinerer Theil des Körpers einfach gar nicht oder zu klein und kümmerlich gebildet, es handelt sich also um eine vollständige Behinderung der Bildung ; bei den zweiten, den Hemmungsbildungen, sind die embryonalen Anlagen des Körpers oder der betreffenden Theile desselben regelmässig und vollständig gebildet, aber die Ausbildung desselben in die reifen, fertigen Körperformen wird gehemmt, bleibt auf einer gewissen Stufe stehen und wir sehen demnach an dem Foetus oder ausgetragenen Kinde eine gewisse Form als Missbildung, welche für eine bestimmte Entwicklungsstufe des embryonalen Lebens normal war. Diese Arten der Missbildungen sind sehr häufig und von grossem Interesse, sie sind es gerade, an welchen sich vorzugsweise die pathologische Entwicklungsgeschichte zu einem Zweige der Wissenschaft herangebildet hat, im Gegensatze zu der früheren Lehre von den Missbilduugen, welche in denselben eine ganz besondere Classe von Geschöpfen sah, die als Spiele der Natur oder Strafen des zornigen und eifrigen Gottes in die Welt gesetzt worden, aber mit dem normalen Körper nichts zu thun hatten. Die einzelnen Arten der Hemmungsbildungen sind unter einander sehr verschieden; die beiden wichtigsten sind: die Spaltbildungen, hervorgehend aus Hemmung der gegenseitigen Verwachsung ursprünglich getrennter Theile; und die den vorigen entgegengesetzten Atresien, bedingt durch Hemmung des Oeffnens ursprünglich solider Theile. Die dritte Abtheilung der Missbildungen, bei welchen es sich wesentlich um qualitative Abweichung handelt (Monstra per fabricani alienam), sind ebenfalls häufig und gewähren das grösste wissenschaftliche Interesse, indem sie ganz eigentümliche Verirrungen der Entwicklung darstellen, welche sich in ihrem gesetzmässigen Gange nur auf Grund der physiologischen Entwickelungsgeschichte erklären lassen. Es gehören hierher die sogenannten Zwitterbildungen, die Verdoppelungen des Uterus, die meisten Missbildungen des Herzens, Veränderungen, welche sämmtlich in ihrem Wesen erst durch die wissenschaftliche Verbindung der physiologischen und pathologischen Entwicklungsgeschichte unsrer Tage erkannt wurden.


Verlag: Leopold Voss
» «

VI. Pathologische Entwickelung des Enddarmes und Uro-Genitalapparates

Bis zur 5. Woche des embryonalen Lebens findet sich noch keine äussere Oeffnung für den Enddarm und Urogenitalapparat, der Enddarm endigt zu dieser Zeit blind ; an seiner vorderen Wand communicirt er mit der Allantois, welche die Wolff'schen Gänge aufnimmt. In der 5. und 6. Woche bildet sich eine Oeffnung für die genannten Apparate, welche zur Kloake führt, in diese mündet unten der Enddarm, ohen der Sinus urogenitalis, in welchen sich die, unterdessen aus dem unteren Theile der Allantois gehildete und vom Enddarm angeschlossene Harnblase und die Geschlechtsgänge (Wolff'sche und Müller'sche Gänge) öffnen. Später schwindet die Kloake allmälig und es zeigen sich zwei getrennte Oeffnungen, eine obere für den Sinus urogenitalis und eine untere für den Enddarm. Der Sinus urogenitalis stellt sich anfangs als Fortsetzung der Harnblase dar, die Grenze zwischen beiden wird durch die Einmündung der Geschlechtsgänge bezeichnet. Später bildet sich am unteren Ende der Harnblase die Urethra aus und nun mündet diese in den Sinus und zwar an derselben Stelle wie die Geschlechtsgänge. Beim Manne erlangt mit der Entwicklung und Verlängerung des Penis der Sinus eine bedeutende Länge und stellt den zwischen dem Ostium externum und dem Samenhügel befindlichen Theil der Urethra dar ; beim Weibe dagegen schwindet der Sinus fast ganz und wird durch die seichte Einbuchtung, Scheidenvorhof, repräsentirt, in welche die Urethra und der weibliche Geschlechtsgang, die Vagina, einmünden. Gleichzeitig mit dieser Bildung der äusseren Oeffnungen geht auch die der äusseren Genitalien vor sich; schon zur Zeit als nur eine Kloakenöffnung existirt, erhebt sich über derselben ein konischer Höcker, der Genitalkörper, welcher bald ein knopfförmiges Ende erhält und unten eine tiefe Furche, Genilalrinne, zeigt ; aussen um die Kloake erheben sich aber zwei Falten, die äusseren Genitalfalten. Mit der Sonderung der Oeffnungen des Sinus urogenitalis und des Enddarms und der weiteren Entwickelung der inneren Genitalien wachsen auch Genitalhöcker und -Falten mehr und mehr ; bis zur 11. Woche haben die äusseren Geschlechtstheile einen vorwiegend weiblichen Charakter und erst in der 12. Woche tritt die entschieden geschlechtliche Sonderung ein. Beim Weibe wird der Genitalhöcker zur Clitoris, welche nun im Wachsthum zurückbleibt und von ihrem Praeputium überdeckt wird; die äusseren Genitalfalten werden zu den Schamlippen. Beim Manne wird der Genitalhöcker zum Penis, die Genitalrinne schliesst sich allmälig von hinten nach vorn und wird zur Verlängerung des Sinus urogenitalis oder zur Urethra, die äusseren Genitalfallen verwachsen untereinander und werden zum Scrotum, in welches im 8. Monat die Hoden treten. So wie die äusseren entwickeln sich auch die inneren Genitalien aus einer gemeinschaftlichen Grundlage und eine deutliche Differenzirung der Geschlechter tritt auch hier erst gegen Ende des 3. Monats ein. Zuerst bilden sich zu beiden Seiten der Wirbelsäule die Wolff'schen Körper mit den Wolffschen Gängen ; in der 7. Woche entstehen dann an der Seite der ersteren die Geschlechtsdrüsen und zwei neue Gänge, die Müller'schen, welche neben den Wolff'schen in den Sinus urogenitalis münden. Beim Manne werden die Geschlechtsdrüsen zu den Hoden, die Wolff'schen Gänge zu den Samenleitern, der mittlere Theil des Wolff'schen Körpers wird zum Nebenhoden, der obere und untere Theil desselben schwindet, doch bleiben öfters einzelne Drüsengänge zurück, die sich dann später in Cysten umwandeln können. Die Müller'schen Gänge verschwinden beim Manne grösstenteils, nur ihre unteren Enden bleiben, fliessen zusammen und bilden die Vesicula prostalica, welche zwischen den Samenleitern in den Sinus urogenitalis (Urethra) mündet; zuweilen bleibt auch das obere Ende eines Müller'schen Ganges erhalten und wird in eine langgestielte Cyste umgewandelt. Samenblasen, Prostata und Cowper'sche Drüsen bilden sich später als accessorische Organe. Beim Weibe werden die Geschlechtsdrüsen zu Eierstöcken, aus den Müller'schen Gängen entwickeln sich Tuben, Uterus und Vagina, indem sie oben getrennt bleiben, unten aber in einen Kanal verschmelzen; der Uterus behält beim Foetus bis zum 4. und 5. Monat eine gehörnte Gestalt; die Sonderung zwischen Uterus und Scheide ist im 4. Monat vollendet; zu derselben Zeit zeigt sich auch die Bauchöffnung der Tuben, etwas entfernt vom blinden Ende der Müller'schen Gänge, welches letztere entweder verödet oder in eine gestielte Cyste umgewandelt wird. Die Wolff'schen Gänge schwinden beim Weibe in der Regel ganz und nur äusserst selten hat man Spuren derselben im späteren Alter gefunden ; zuweilen wird ihr oberes Ende in eine Cyste umgewandelt. Ein Theil des Wolff'schen Körpers bleibt und stellt den Nebeneierstock dar, die übrigen Drüsenschläuche schwinden oder werden zu kleinen Cysten. Die Entwickelung des Harnapparates beginnt mit der der Allantois, dieselbe entwickelt sich in Form zweier Höcker, die sich aber bald zu einem vereinigen, ursprünglich als solide Wucherung von der vorderen Bauchwand ; tritt dann aber mit dem Darmfaserblatt in Verbindung und das Darmdrüsenblatt bildet eine Ausstülpung in dieselbe, so dass die Allantois endlich von der Bauchwand ganz frei wird und sich als eine auf der vorderen Wand des Enddarms sitzende aus Darmfaserblatt und Darmdrüsenblatt bestehende gestielte Blase darstellt. Der Stiel dieser Blase (Urachus) ist hohl und erweitert sich allmälig zur Harnblase, welche also eine Zeit lang in offnem Zusammenhange mit dem Enddarme steht, später wird dieser Verbindungsstrang mit dem Enddarme solid, so wie auch der Verbindungsstrang der Harnblase mit dem ausserhalb des Embryo zwischen Dottersack und Amnion gelagerten Allantoistheile solid wird und sich als Ligamentum vesicae medium darstellt. Die übrigen Harnorgane entstehen als hohle Ausstülpung der hinteren Wand der Harnblase oder des früheren Urachus, zunächst die Harnleiter, dann als Ausbuchtungen desselben die Nierenkelche und von diesen aus die Harnkanälchen, welche später mehr und mehr auswachsen. Die Nieren liegen anfangs hinter dem untersten Theile des Wolff'schen Körpers, rücken allmälig weiter nach oben und kommen hinter die viel grösseren Nebennieren zu liegen, welche sich um die 6. und 7. Woche vor der Aorta und zwischen den Wolff'schen Körpern bilden und ursprünglich wahrscheinlich zusammenhängen. Die pathologische Entwickelungsgeschichte des Enddarmes und Urogenitalapparatcs schliesst sich grösstentheils eng an die physiologische an; die wichtigsten Missbildungen dieses Gebietes stellen sich meist als Hemmungsbildungen, als Stehenbleiben auf einer früheren Bildungsstufe oder als Verirrung der Umbildung embryonaler Anlagen in fötale Organe dar.

Bleibt der Enddarm auf der frühesten Stufe seiner Entwickelung stehen und öffnet er sich nicht nach aussen, so geht hieraus Atresia ani hervor; wird gleichzeitig die ursprüngliche offne Verbindung zwischen Enddarm und Harnblase bleibend, so entsteht beim männlichen Geschlecht die Atresia ani vesicalis oder urethralis; aus bleibender offner Verbindung des Enddarmes mit dem Sinus urogenitalis bildet sich beim Weibe die Atresia ani vaginalis und beim Manne eine Form der A. a. urethralis hervor. Ausser dieser Form eines Stehenbleibens auf der Stufe der embryonalen Kloake kommen auch noch andere vor, indem sich bald an der entsprechenden Stelle ein Sinus findet, in welchen Enddarm, Harn- oder Geschlechtsgänge sich öffnen oder gleichzeitig eine Blasenspalte und Darmspalte vorhanden ist, durch welche die Ureteren und der Mitteldarm nach aussen münden. Diese bei Menschen nicht seltnen Missbildungen sind bisher mit Ausnahme der einfachen Atresia ani bei Thieren nur wenig beobachtet worden. (Vergl. meine Missbildungen. und spec. Theil p. 98. GURLT II. p. 148. Atretocormus aproctus.)

Bleibt die Entwicklung der äusseren männlichen Genitalien auf der Bildungsstufe der 10. Woche stehen, so entsteht die als Hypospadie bekannte, gewöhnlich als Zwitterbildung bezeichnete Missbildung, bei welcher der rudimentäre Penis keine Urethra, sondern an deren Stelle eine Furche (Genitalrinne) hat und der Sinus urogenitalis zwischen den schamlippenartigen, getrennt gebliebenen Scrotalhälften mündet. Bilden sich beim Manne die Müller'schen Gänge nicht zurück, sondern gehen sie eine ähnliche Umbildung wie beim Weibe ein, so zeigen sich an der Stelle der Vesicula prostatica Vagina, Uterus und Tuben in mehr oder weniger ausgebildetem Zustande. Einige Beobachter wollen in solchen Fällen gesehen haben, dass auf der einen Seite ein Hode mit Samenleiter und auf der entgegengesetzten Seite ein Ovarium mit Tube vorhanden waren: Hermaphroditismus lateralis; Andere wollen in solchen Fällen das gleichzeitige Vorkommen von Hoden und Eierstücken auf beiden Seiten beobachtet haben : Hermaphroditismus androgynus; jedoch ist beim Menschen das gleichzeitige Vorkommen von Hoden und Eierstock noch nicht exact nachgewiesen worden, während es bei Säugethieren und Vögeln allerdings vorkommt. - Tritt der Descensus testiculorum auf einer oder beiden Seiten nicht oder unregelmässig ein, so geht daraus der Cryptochmismus hervor; aus mangelhafter Entwicklung einer oder beider männlichen Geschlechtsdrüsen folgen Anorchismus, Monorchismus oder Microschismus. (S. im spec. Theile p. 343. Vergl. auch meine Mißbildungen p. 148. Taf. XXI. GURLT I. c. p. 184. u. f.)

Der Hypospadie des Mannes entsprechend ist die weibliche Zwitterbildung; die Clitoris ist hier abnorm gross, penisartig, die Vagina eng, der Uterus klein, die Eierstöcke meist wenig entwickelt, ebenso die Brüste, der Körperbau hat mehr männlichen als weiblichen Habitus. - Verschmelzen beim Weibe die Müller'schen Gänge bei der Bildung des Uterus und der Scheide nicht in einen Kanal, sondern entwickeln sich vollständig, so gehen daraus die verschiedenen Arten des Uterus duplex, bicornis und unicornis hervor, Mißbildungen, die bei Thieren nicht vorkommen. (S. im spec. Theile p. 404. 453. 463; Missbildungen p. 15S. Taf. XX.)

Ausser den angeführten Hemmungs- und Verirrungsbildungen der Genitalien kommen auch noch Defectbildungen, Verschmelzungen, Atresien u. s. w. vor; an der Mamma auch Doppelbildungen, indem sich statt 2 Brüste 3, 4 und selbst 5 bilden ; alle diese Missbildungen sind im speciellen Theile beschrieben worden.

An den Harnorganen kommen vorzugsweise Defecte, Atresien, Lageveränderungen und Verschmelzungsbildungen vor; eine der wichtigsten Missbildungen der Harnblase, die Blasenspalte, ist schon bei den Bauchspalten berührt worden ; mit dieser Blasenspalte combinirt, aber auch als selbstständige Missbildung kommt beim Manne zuweilen die Epispadie vor; bei derselben ist der Penis klein, rudimentär, die Urethra fehlt an ihrer normalen Stelle, liegt auf dem Bücken des Penis oder genauer ausgedrückt auf den cavernösen Körpern des Penis, ist aber nach oben gespalten und bildet daher eine offne Rinne. Bei Thieren scheint diese Missbildung nicht vorzukommen.

Divider


Verlag: Leopold Voss


Verlag: Leopold Voss

Handbuch der Geschichte der Medizin ()
» Erster Band «
» Zweiter Band «
» Dritter Band «
Verlag: Gustav Fischer
» «, » «, » «

Divider

Psychopathia sexualis

Divider

Scala evolutionis
» Polaritas sexualis qua sexus sejunctus «


» «

Divider

Homosexuellenkonzepte

Divider

Divider

Männerliebe

Divider


Die Männerliebe der Griechen, ihre Beziehungen zur Geschichte,
Erziehung, Literatur und Gesetzgebung aller Zeiten.
Forschungen über platonische Liebe

Verlag: Glarus
» «
Schriftsteller

Divider

Uranismus, Urning und Urninde
sowie Dioning Dioninge

Divider


Moralphilosophische und sozialphilosophische Studien über urnische Liebe
12 Bände (1864-1879)
Autor und Hrsg.: » «
Jurist, Journalist, Verleger, Schriftsteller, Pionier der Sexualwissenschaft

» Wikipedia « : "Auf dem deutschen Juristentag 1867 in München forderte er in einer Rede erstmals öffentlich die Straffreiheit gleichgeschlechtlicher sexueller Handlungen, da diese auf einer natürlichen Veranlagung beruhen würden, worauf es zu tumultartigen Szenen unter den Zuhörern und zum Abbruch seiner Rede kam. Ulrichs gilt als ein früher Vordenker und -kämpfer der heutigen Lesben- und Schwulenbewegung, blieb aber zu Lebzeiten mit seinen Ideen und Forderungen ein Außenseiter. Statt der angestrebten Liberalisierung musste er die zunehmende staatliche Repression gegen Homosexuelle nach der deutschen Reichsgründung 1871 miterleben, weshalb er 1880 enttäuscht ins Exil nach Italien ging. Teile seiner wissenschaftlichen Theorien zur Sexualität wurden nach seinem Tod von anderen Pionieren der Sexualwissenschaft wie Magnus Hirschfeld aufgegriffen."

» Wikipedia « : "Weil die bis dato benutzten Ausdrücke für die Vertreter des dritten Geschlechts ihm zu sehr negativ gefärbt erschienen, führte Ulrichs seine eigenen Begriffe ein. Seine Terminologie baute sich auf der Rede Pausanias in Platons Symposion (Kapitel 8 und 9), die zwei Formen der Liebesgöttin Aphrodite vorstellt: Den heterosexuellen Mann bezeichnete Ulrichs als Dioning - nach der Göttin Aphrodite Dionea, die Zeus als Vater und Dione als Mutter hatte und somit verschiedengeschlechtliche Liebe repräsentierte. Den homosexuellen Mann bezeichnete Ulrichs als Urning - nach der Göttin Aphrodite Urania, die nach der Legende aus abgetrennten Körperteilen ihres Vaters Uranus entstand, also eingeschlechtliche Liebe repräsentierte. Ulrichs' Systematik sah auch den Begriff Urninde für eine homosexuelle Frau vor."

» Hubert Kennedy «
Karl Heinrich Ulrichs, Pioneer of the Modern Gay Movement (Autobiographie - 2002)

Divider

Das dritte Geschlecht

Divider


Verlag: Richard Eckstein Nachfahre H. Krüger
» «
Schriftsteller, Verlagslektor

Divider

Monosexual, Homosexual, Heterosexual und Pygisten

Divider


Serbe's (Comissions-) Verlag
» «
österreichisch-ungarischer Schriftsteller

» DeAcademic «

Im Jahre 1848 zog er nach Berlin. Zu dieser Zeit begann er, über Homosexualität zu schreiben, motiviert, wie er sagte, durch ein "anthropologisches Interesse", Gerechtigkeitssinn und die Sorge um die Menschenrechte. Im Jahre 1869 veröffentlichte er anonym ein Flugblatt mit dem Thema: "Paragraph 143 des preußischen Strafgesetzbuches vom 14. April 1851 und seine Wiederbestätigung als Paragraph 152 im vorgeschlagenen Strafgesetzbuch für den Norddeutschen Bund. Eine offene und berufliche Korrespondenz mit Seiner Exzellenz Dr. Leonhardt, dem Königlichen preußischen Justizminister." Ein zweites Flugblatt zum selben Thema folgte bald. In seinen Schriften behauptete Kertbeny, dass das Preußische Sodomie-Gesetz, Paragraph 143, die Menschenrechte verletze. Er brachte das klassisch freiheitliche Argument vor, dass der private und freiwillige Geschlechtsverkehr nicht Sache des Strafrechts sein solle. Bezüglich seines Freundes aus den Tagen seiner Buchhändler-Lehre behauptete er, dass Homosexuelle aufgrund des preußischen Gesetzes erpressbar seien und deshalb oft in den Selbstmord getrieben würden. Kertbeny brachte auch die Ansicht vor, dass Homosexualität angeboren und unveränderlich sei, ein Argument, das später das "medizinische Modell" der Homosexualität genannt wurde. Er widersprach damit der vorherrschenden Ansicht dieser Zeit, dass Männer Sodomie aus bloßer Boshaftigkeit begingen. Homosexuelle Männer, sagte er, seien nicht von Natur aus weichlich, und er wies darauf hin, dass viele große Helden der Geschichte homosexuell waren. Er war der erste Schriftsteller, der diese Argumente vorbrachte.

In seinen Schriften prägte Kertbeny das Wort "homosexuell" als Bestandteil seines Systems für die Klassifikation von sexuellen Typen. Er nannte Männer, die von Frauen angezogen werden, "heterosexuell", Masturbatoren nannte er "monosexuell" und Anhänger des Analverkehrs nannte er "Pygisten" (griechisch pygê = Steiß). Klassische Gelehrte haben Kertbenys Wortschöpfung seitdem bedauert: Das Wort "homosexuell" verbindet das griechische Adjektiv homós ("gleich"), mit dem lateinischen Substantiv sexus ("Geschlecht") und ist damit eine Kombination griechischer und lateinischer Elemente. Das Wort "homosexuell" führe zudem zur Verwechslung des griechischen homós mit dem lateinischen homo ("Mensch" oder "Mann"). Männer wie Karl Heinrich Ulrichs, die sich als homosexuell zu erkennen gegeben hatten, begannen in der Folge für homosexuelle Rechte zu kämpfen; Kertbeny dagegen zog sich zurück. Im Jahre 1880 trug er ein Kapitel über Homosexualität zu Gustav Jägers Buch Entdeckung der Seele bei, jedoch entschied Jägers Herausgeber, das Thema sei zu umstritten, und ließ es weg. Dennoch gebrauchte Jäger die Fachsprache von Kertbeny an einer anderen Stelle des Buches. Für seine eigenen Schriften entlehnte der österreichische Sexualwissenschaftler Richard von Krafft-Ebing Kertbenys Worte homosexuell und heterosexuell aus Jägers Buch. Krafft-Ebings Arbeit war so einflussreich, dass diese Bezeichnungen zu Standard-Begriffen für die sexuelle Orientierung wurden und Ulrichs Bezeichnung Urning (für den homosexuellen Mann) ersetzten.

Karl Maria Kertbeny: Schriften zur Homosexualitätsforschung ()
Manfred Herzer (Hrsg.), Verlag Rosa Winkel / Männerschwarmskript
Enthält die beiden 1869 anonym erschienenen Broschüren
und Kertbenys Beiträge zu Gustav Jägers Buch Die Entdeckung der Seele,
sowie eine Schilderung von Kertbenys Leben
nach Dokumenten und Selbstzeugnissen von Manfred Herzer.

== Etymologie ==

» mono « in der Forschungsliteratur
Autonomie und Isonomie fremder und indigener Wortbildung (2008)
am Beispiel ausgewählter numerativer Wortbildungseinheiten
Verlag: Frank & Timme (ISBN:978-3-86596-141-9)
Anja Seiffert

» Heterogen und Homogen «
Kurzes deutsches Wörterbuch für Etymologie, Synonymik und Orthographie (1834)
S. 125, 129
Verlag: Friedrich Metz
Friedrich Schmitthenner

== ==

Divider

conträre Sexualempfindung und Conträrsexueller

(Transsexualität - 1869)

Divider


Archiv für Psychiatrie und Nervenkrankheiten
II. Band. 1. Heft
» «
Psychiater und Neurologe


Hrsg.: Fischer's medicinische Buchhandlung
» Albert Moll «
Arzt, Psychiater und Sexualwissenschaftler


mit besonderer Berücksichtigung der kulturgeschichtlichen Beziehungen
Verlag: F. C. W. Vogel
(borrow only)
» «

» Psychopathia Sexualis () «
mit besonderer Berücksichtigung der konträren Sexualempfindung
Verlag: Ferdinand Enke
» «
Psychiater, Neurologe und Rechtsmediziner

Divider

Ambisexualität

Divider

Hierzu gibt es zwei Versionen, welche über die gleiche Version der Enzyklopädie 'Human Sexuality' beschrieben werden. Markant ist hierin, daß man bei Haeberle's elektronischer Archiv-Fassung eine Korrektur der Originalfassung antrifft, die sich jedoch als gerechtfertigt erweist, wie sein Buch 'Die Sexualität des Menschen' aus 1983 eindeutig nachweist.

Archivfassung Haeberle

» Human Sexuality: An Encyclopedia () «
Verlag: Garland Publishing, Inc.
Artikel: Ambisexuality
Autor:

The term "ambisexuality" was first published by Erwin J. Haeberle in 1978 in his textbook "The Sex Atlas" as an alternative, more precise term for "bisexuality". Masters and Johnson adopted the term in 1979, but used it to describe men and women who had frequent sexual interaction with members of both genders but who reported absolutely no preference for one or the other. Sexual interaction was viewed as simply a matter of sexual release. They defined the term ambisexual therefore as "a man or woman who unreservedly enjoys, solicits, or responds to overt sexual opportunity with equal ease and interest regardless of the sex of the partners, and who, as a sexually mature individual, has never evidenced interest in a continuing relationship."

Original Buchausgabe


Verlag: Garland Publishing, Inc.
Artikel: Ambisexuality (S. 26)
Autor:

The term "ambisexuality" was first published by Masters and Johnson in 1979 to describe men and women who had frequent sexual interaction with members of both sexes but who reported absolutely no preference for the gender of the partner. Sexual interaction was viewed as simply a matter of sexual release. They defined the term as "a man or woman who unreservedly enjoys, solicits, or responds to overt sexual opportunity with equal ease and interest regardless of the sex of the partners, and who, as a sexually mature individual, has never evidenced interest in a continuing relationship".


Handbuch und Atlas
Verlag: Walter de Gruyter
Deutsche Übersetzung der Originalausgabe:
The Sex Atlas, The Seabury Press, New York, 1978
Autor:

Divider

In der Unzahl von Berichten über den Werdegang sind nüchterne Inbetrachtziehungen Raritäten. Sie sind fast ausschließlich mit Exzessen der Verfolgung von Ideologien durchzogen. Jedoch gelangt man mittlerweile auch immer mehr zur Ernüchterung, worüber die Geschichtsschreibung in eine neue Phase gelangt, nämlich zu einem Standpunkt des Allgegenwärtigen der Sache, worin es nicht mehr darum geht, das Bestehende in seinem Grundsatz der Daseinsberechtigung in Frage zu stellen, sondern es als eine präsente Gegebenheit des kulturellen Lebens in Betracht zu ziehen. Als mustergültige Aufarbeitung des Vergangenen erweist sich das Institut für Geschichte der Medizin der Universität Würzburg, mit ihrem Forschungsprojekt » Frühneuzeitliche Ärztebriefe «, worüber die handschriftlichen Korrespondenzen in einer » Datenbank « erfaßt und allgemein zugänglich gemacht werden. Sinn des Ganzen ist vor allem, das widerspiegeln der stattgefundenen Kommunikation über die Rezeption neuer Theorien und Entdeckungen. Daraus entstehen neuerliche objektive Beschreibungen. Nachfolgend die Einleitung eines Berichts, erschienen im » Forum Qualitative Sozialforschung «, von Dr. phil. Tilmann Walter, welcher zwischenzeitlich Mitarbeiter des Instituts geworden ist.


Forum Qualitative Sozialforschung, Volume 6, No. 1, Art. 10 - Januar

Zusammenfassung: Die Geschichte des frühen homosexuellen Selbst lässt sich in drei Phasen unterteilen: eine Zeit "latenter" Selbstzeugnisse, die bis ca. 1865 andauerte, dann eine Phase der Aktivierung des "homosexuellen" Wissens durch medizinische Experten und eine seit ca. 1895 andauernde Phase der zunehmenden Entmündigung dieser Stimme im Expertendiskurs. Um 1900 war Homosexualität als Verhalten bereits auf das "Skript" "homosexuelles Selbst" festgelegt: In den Augen der meisten Experten handelte es sich dabei um eine behandlungsbedürftige Krankheit, in den Augen der betroffenen Personen meistens nicht. In historischen Darstellungen werden "die Homosexuellen" deshalb häufig als Opfer medizinischer Machtausübung dargestellt. Hier soll demgegenüber argumentiert werden, dass sich Subjekte im Rahmen einer "flexiblen Normalisierung" selbst gesellschaftlichen Normen unterworfen haben. Historische Dokumente werden von mir mit Hilfe eines Modells der Persönlichkeitsentwicklung in der therapeutischen Beziehung interpretiert. Inzwischen hat die Einheitsanthropologie, die die Scientia sexualis anfangs geprägt hat, stark an Bedeutung verloren: Geschlecht und Sexualität gelten weithin als "Verhandlungssache", die Lebensweisen "heterosexueller" und "homosexueller" Männer - und inzwischen auch vieler berufstätiger Frauen - unterscheiden sich immer weniger deutlich. Von entscheidendem Einfluss scheint dafür der Wandel von der Produktions- hin zur Konsumtionsgesellschaft gewesen zu sein: "Die Homosexuellen" um 1900 können als "Avantgarde" des konsumistischen Habitus interpretiert werden.

Divider

Sprachtechnische
Barrieren

Divider

Das Handikap der Kommunikation zwischen Allgemeinheit und Wissenschaft basiert vor allem auf dem Handikap interner wissenschaftlicher Verhältnisse, was darauf beruht, daß es keine » Sexualwissenschaft « als solches gibt und diverse Grundlagenkenntnisse nicht aus der Wissenschaft heraus gebildet wurden. Das einzige sexualwissenschaftliche Institut, welches von » Volkmar Sigusch « 1972 begründet wurde, wurde auf seine Emeritierung (» Altersruhe «) hin 2006 wieder geschlossen. Gegenwärtig bietet einzig die » Hochschule Merseburg « einen » Masterstudiengang « für Angewandte Sexualwissenschaft, sowie für Sexologie an. Darüber hinaus gibt es jedoch Einige zur Sexualpädagogik, wobei diese Zertifizierung » nicht geschützt « ist. Grundsätzlich ist jedoch die Sexualität, gemäß des Geschlechtswesens, der » Medizin « zugeordnet, sodaß sich auch das Weitere fachlich differenziert daran angliedert. Die » Interdisziplinarität « bildet sich dem gemäß über das Veröffentlichungswesen. Hierüber vermischt sich alles, was sich als Bezugnehmendes deklariert, jedoch nicht bedingend einem erforderlichen gemeinsamen Grundsatz entspricht. So ergibt sich hierin jedoch bereits in den Ursprüngen der Entwicklung heraus das Mißverhältnis des Sprachgebrauchs gegenüber fachtechnischen Erfordernissen, filtert sich jedoch im Verlaufe über die informelle Verbreitung und Aufklärung jeweils wieder heraus.

Als unüberwindliches Makel und gar zerstörerisch auf den Sprachschatz einwirkend, erweist sich indess das deutsch-englische Sprachverhältnis, vor allem, aufgrund der Festlegung der internationalen Wissenschaftssprache Englisch. Sex im Englischen, gemäß seines lateinischen Ursprungs » Sexus «, bedeutet übersetzt im Deutschen » Geschlecht «, wohingegen die Bedeutung von » Sex « im Deutschen den Sexualakt ausdrückt. Damit verbunden ist bereits im Deutschen gleichermaßen aufgrund der lateinischen Übernahme von Sexus → Sex-ualität die Geschlechtsfixierung gegeben, jedoch hat man im Allgemeinen gar keinen Bezug dazu, sodaß hierin auch regulär der Bezug mit Sex in Verbindung gebracht wird und nicht, wie im Englischen mit dem Geschlecht. Dem gegenüber gibt es im Englischen keinen derartigen Geschlechtsbezug im grammatikalischen » Genus «, der klassifizierenden Anwendung der » Substantive «, in Verbindung mit der » Artikulierung « und den Artikeln selbst (the = der, die, das). Was bedeutet in dieser/unserer Sprache somit » Gender «, wo in der Deutschen Sprache dies als Grundlage der Sprache darin enthalten ist und im Englischen nicht? Dies führte zwangsläufigerweise zur Auseinandersetzung über die generelle Infragestellung der » Geschlechtsidentität «, gemäß dem man es antrifft, insofern man nämlich die Grundlagenerörterungen in Englisch ausführt.

» Wikidata (bisexuality - Q43200) «
sexual and/or romantic attraction to people of both the same gender and the opposite gender
Language Label Description Also known as
Deutsch Bisexualität sexuelle oder romantische
Orientierung oder Neigung
zum eigenen und
anderen » Geschlecht «
Bisexuell
Ambisexualität
Bisexueller
Bisexuelle
English bisexuality sexual and/or romantic
attraction to people
of both the same » gender «
and the opposite gender
bisexual
bi
French bisexualité attirance sexuelle
pour les gens du même » genre «
et de genre différent
bisexuel
bisexuelle
bi-sexuel
bie
bi

Wie als Musterbeispiel die Wikidata-Informationen aufweisen, so ist im Englischen gar nicht das körperliche Geschlecht Bestandteil der Inbetrachtziehung und es handelt sich auch um die » Etikettierung « eines darauf gesetzten Hinzufügens in den Sprachgehalt. Hingegen findet man beim deutschen Sprachgebrauch der » Geschlechtsausdifferenzierung « mittlerweile ein » Gender « (soziales Geschlecht, beschreibt eine Person in Gesellschaft und Kultur). Jedoch stellt sich Sexual attraction to a gender für deutschsprachige Verhältnisse als eine vom Geschlechtswesen ausgehende Attraktion zum sozialen Geschlecht. Der Hintergrund dessen basiert auf der sozial(wissenschaftlich)en Ergründung der sexuellen Identität (» Gender Studien «), auf der Grundlage von » Transgender « und » Intersexualität «, worin es dessen bedingt, um das Verhältniswesen darin dem Allgemeinwesen entsprechend zu vermitteln.

Dem gegenüber haben Diejenigen, auf die einst » Alfred C. Kinsey « in den » Kinsey-Reports « hervorhebend hinwies (siehe Kapitel » Kinsey-Reports «), einen Gegenpol dazu gebildet. Sie haben gemäß ihrer jeweiligen Individualität Sprachbildnisse geschaffen, um vor allem das Eine des gemeinsamen Nenners zu vermitteln: daß ihr Geschlechtsbezug nämlich nicht eindeutig spezifiziert und/oder festgelegt ist. Sachstand wurde jedoch zunächst das allgemeine Ersichten, daß man ein Bisexualität (eigentlich » Homosexualität «) bereits seit seinen Ursprüngen handhabte. Gemäß dem bildete sich jedoch zunächst auch » Queer «, vor allem jedoch, um generell die Abweichungen von der heterosexuellen Lebensweise darüber zu spezifizieren und das Vereinen darüber zu gewährleisten. Erst im Anschluß an die mißlich erfolgte Eingliederung der sogenannten Bisexuellen darin bildeten sich diverse Deklarationen, um die eigentliche Wesensart darüber zum Ausdruck zu bringen.

Urgrund aller Mißstände ist jedoch das verbal- und schriftsprachliche Mißverhältnis gegenüber dem Sinneswesen. Das Hervortreten der Veranlagung findet über das » Instinkt- « und Intuitivwesen (» Intuition «) statt. Der Mensch erfährt es vor allem auch über sein Gefühlsleben. Wie es sich mit der geistigen Vorstellung darüber verhält, wird weitläufig einzig noch über das Sprachverhältnis bestimmt, worüber der Mensch verfügt. Und was darin nicht enthalten ist, kann somit auch darüber weder sich selbst, noch nach außen vermittelt werden darüber. Betrachtet man sich hierzu den kulturgeschichtlichen Werdegang, gemäß dem es auch aus der Gegenwart heraus sich darlegt, dann erfährt man darüber, daß der Mensch kein Tier ist und aufgrund dessen auch nicht instinktiv, sondern geistig sein Sein handhabt. Gerade über die Veranlagung zeigt sich jedoch, daß dem zwar so ist, jedoch die Instinkte und Triebe evolutionär sich nicht verändert haben, sondern wie man damit umgeht. Und hierin zeigt sich auf besondere Weise, wie sie gar außen vor gestellt werden, obwohl sie unleugbar sind. Aufgrund dessen wurde jedoch auch das Sprachverhältnis darauf eingerichtet, sodaß es erst gar nicht darin erscheint.

Vor allem jedoch ist das Gravierende an der Situation, daß die Liebe hierin in keiner Weise anzutreffen ist. Das Miteinander basiert auf der Resonanz - auf der sinnlichen Resonanz, woraus sich die Lieben substanziert.


Hrsg.: Markus Antonius Wirtz - Verlag: Hofgrefe
siehe auch: » Ethologie «

instinct; lat. instiguere anstacheln, antreiben], [KOG, PER], Bez. für die bis in die Antike reichende Annahme eines angeborenen Verhaltens bzw. einer grundlegenden Steuerung (endogene Automatismen) desselben im Tierreich (Instinkttheorie). C. Darwin verstand unter «Instinkthandlungen» Verhaltensweisen, die vollkommen ohne Erfahrung schon beim erstmaligen Ausführen beherrscht werden.

Die seit den 1930er-Jahren aus der Tierps. hervorgegangene Ethologie sah es als eines ihrer wesentlichen Forschungsziele an, die äußerlich sichtbaren Auswirkungen von I. zu untersuchen. Heute vermeiden die Ps. und die Verhaltensbiologie weitgehend diesen nie eindeutig definierten Begriff und ersetzen ihn durch «angeborenes Verhalten». I. spielen allenfalls noch als Metapher für funktionale Zusammenhänge eine Rolle, deren physiol. Grundlagen noch nicht geklärt sind. So definierte der Ethologe N. Tinbergen (1951) I. als einen «hierarchisch organisierten nervösen Mechanismus, der auf best. innere und äußere, vorwarnende, auslösende und richtende Impulse anspricht und sie mit koordinierten, lebens- und arterhaltenden Bewegungen beantwortet»: also ein komplexes System aus Schlüsselreizen (Schlüsselreiz), hierdurch verursachten inneren Zustandsänderungen (Auslösemechanismus, «AAM») und nachfolgenden Verhaltensweisen, was heute besser auch als Erbkoordination bez. wird.

Divider

Quellenwerke

Divider

Archive


Gegründet und betreut seit 1994 von Prof. Dr. Erwin J. Haeberle

» Magnus Hirschfeld Stiftung «

» Die großen Bibliophilen () «
Geschichte der Büchersammler und ihrer Sammlungen
- » Band II « - » Band III «
Verlag: E. A. Seemann
» Register (von Venturus) «
» «

Band I, S.2: Allmählich erst war dem Altertum das Buch zu einem Kulturelement und Kulturrepräsentanten geworden. Die Antike, auch im Bereiche der klassischen Literatur, bedurfte für die Ausbreitung ihrer Bildung weit weniger der Buchvermittlung als der des gesprochenen Wortes. Von Anfang an wendeten sich die Dichter an die Hörer, nicht an die Leser. ' Selber die Muse lehrt sie den hohen Gesang und waltet über die Sänger' (Homer). Der Notbehelf schriftlicher Aufzeichnungen blieb jahrhundertelang nur ein solcher. Die Ausgestaltung des Bühnenwesens, der Redekunst, des geselligen Vortrages, des wissenschaftlichen Zwiegespräches schuf die Formen einer Überlieferung, die zum Schrifttum wurdgn, ohne daß deshalb die weitere Wirkung des Wortes aufgehört hätte. Und auch den Philosophen bewegten Zweifel, ob das Buch ein Geschenk der Götter sei. Man höre Platos Meinung: Durch Bücher werde, infolge der Vernachlässigung des Gedächtnisses, in der Seele der Lernenden Vergessenheit hervorgerufen, da diese sich an die Schrift halten und sich mehr von außen her durch fremde Zeichen als innerlich aus sich selbst erinnern werden ... Sie kommen so wohl zu Meinungen, aber nicht zur Wahrheit; denn vieles mögen sie aufnehmen und deshalb glauben, Vielwisser zu sein, während sie doch nichts gelernt hätten und Scheinweise geworden seien, nicht Weise ... Etwas Arges sei an Bild und Schrift. Beider Hervorbringungen zeigten sich, als ob sie lebendig wären. Frage man sie, so antworteten sie mit vornehmem Schweigen ... Sei das Wort niedergeschrieben, verbreite es sich überall hin, unter die, die es verständen, ebenso wie unter die, an die es nicht gerichtet wäre, und es habe dann keine Macht mehr darüber, mit wem es sprechen wolle, mit wem nicht. Werde es mißbraucht oder fälschlich gescholten, bedürfe es immer des Beistandes seines Vaters, selbst sei es nicht fähig, sich zu wehren oder sich sonst zu helfen. - Die Bedeutung des Buches und der Bücher, die das Gedächtnis der Menschheit werden - in bibliothecis loquuntur defunctorum immortales animae [Plinius maior] - erkannten nüchternen, praktisch-realistischen Sinnes die Römer. Derart bezeichnete das Buch, die Bürgschaft menschlicher Unsterblichkeit, der ältere Plinius [hist. nat. XIII. 70], den Papyrus einen Erhalter insbesondere der geschichtlichen Erinnerung nennend, so die Begriffe Buch und Urkunde nicht mehr als etwas ganz und gar gleichartiges verbindend. Derart erschien auch dem Diodorus Siculus das Aufbewahren des Aufgeschriebenen für den Menschen und die Menschheit wichtig: "Wer wäre imstande, der Schreibkunst eine würdige Lobrede zu halten? Denn nur durch die Schrift erhalten sich die Toten in dem Andenken der Lebenden und verkehren die Entfernten miteinander als ständen sie sich zur Seite. Nur das zuverlässige Zeugnis des schriftlichen Wortes verbürgt den Bestand der im Krieg zwischen Königen und Völkern geschlossenen Verträge. Nur die Schrift allein bewahrt die köstlichen Gedanken der weisen Männer und die Aussprüche der Götter, ja selbst alle Philosophie und Wissenschaft, und übergibt sie immer von Jahrhundert zu Jahrhundert den kommenden Geschlechtern. Darum müssen wir wohl die Natur als die Quelle unseres physischen Lebens anerkennen, aber als die Quelle unseres edlen, unseres geistigen Lebens die Schrift." [Übersetzt von L. Feuerbach.]

Divider

Bibliografien

» An analytic bibliography of on-line neo-latin texts «

Sexualwissenschaft


Campus Verlag
» «

» Studies in Human Sexuality (1995) «
A Selected Guide
Second Edition
Verlag: Libraries Unlimited, Inc.
Suzanne G. Frayser, Thomas J. Whitby

The purpose of this new, expanded edition of Studies in Human Sexuality remains the same as before: to provide scholars, professionals, students, and laypersons with a bibliographic guide, comprehensive in scope, to the best books in the English language on the subject of human sexuality. Within the biological, social and behavioral sciences, and the humanities, it covers such general areas as medicine, psychology, anthropology, sociology, religion, law, education, history, literature, and the arts. It also highlights the pressing issues of the day with abstracts on abortion. AIDS, child sexual abuse, incest, rape, sexual harassment, homosexuality, pornography, and prostitution.


The Encyclopedia of Lesbian and Gay Histories and Cultures - Volume II
Verlag: Routledge


A philosopical Encyklopedia
Volume 1: A-L

Greenwood Press


Verlag: Elsevier


Kinsey Institute (KI) librarians created Sexual Nomenclature in the 1970s as a means of improving cataloging accuracy for KI collections. This article traces the two origins of the thesaurus: Alfred Kinsey's original library organization in the 1940s and 1950s and gay and lesbian library activism in the 1960s and 1970s. Sexual Nomenclature's authors aimed to create and to deploy sex-specific terms that other libraries could use to improve user access to and knowledge of sex-related materials. An examination of Sexual Nomenclature's functionality in the past and present demonstrates both the difficulty and necessity of keeping controlled vocabularies for sexological concepts up-to-date.


Eine Genealogie des Geschlechtsbegriffs
Akademie Verlag GmbH

» Archives of Sexual Behavior «
The Official Publication of the International Academy of Sex Research
» ResearchGate «

Divider

Wissenschaft

» Cuvier's History of the Natural Sciences () «

Verlag: » Publications scientifiques du Muséum «
Autor:
Übersetzung: Beatrice Marx

Georges Cuvier was sixty years old when in 1829 he began to give a series of lectures on the "history of the natural sciences" at the College of France. As usual, he did not write down the content of his lectures. He probably used instead small notebooks in which he only entered general ideas, names and dates, and points of reference for his prodigious memory. While his "lessons on comparative anatomy," given at the beginning of his career, were published on the basis of notes taken by Constant Duméril, his lectures on the "history of the natural sciences" were published on the basis of notes taken by Magdeleine de Saint-Agy. Cuvier's last lecture, on the topic of Naturphilosophy, was on 8 May 1832, just a few days before he passed away on 13 May. While his death made it impossible for him to review a draft of these written notes, we find in this edition, even without a rigorous stylistic analysis, a clarity of expression and the tone, sometimes serious, sometimes ironical, which is characteristic of Cuvier's style. A somewhat familiar tone indicates the presence of an audience. One might think that as Cuvier reached the peak of his career as a scholar and a public man, he chose to give his work a more historical approach. But, in fact, Cuvier, from a young age -as is reflected so well in his early correspondence- had always tried to incorporate the knowledge of his time in the historical progression of ideas. He was both an active participant and an attentive and perceptive witness to the amazing explosion of knowledge that occurred in the beginning of the nineteenth century and which led to the constitution of the sciences as they are known today. As the permanent secretary of the department of physics and mathematical sciences of the institute, he prepared in 1810, on the request of Emperor Napoleon Bonaparte, a "historical report on the development of natural sciences since 1789 and on their current state." In this report, he wrote "the last two centuries have done more for the sciences than all the centuries before, and the last thirty years alone might have contributed as much as the last two centuries." But what is worth noticing is Cuvier's unique approach to the history of the sciences. Starting with the first pages of this volume where he introduces his plan of study, he outlines the history of Europe between the sixteenth and the beginning of the eighteenth century, linking together the development of religions, political regimes, contacts and communications between populations, and the effect of techniques on discoveries. He thus tells his audience that his intention is to follow the slow path which, thanks to the "freedom of thought and writing, which was the result of religious battles," enabled scholars to go from the exclusive use of erudition to the use of observation, experiment, and conclusion. "This is how human things progress: they do not cut short one day to start a new direction the day after; they develop as a continuum; they move forward without interruptions." Cuvier is definitely far away from the "epistemological disconnections" or "changes of paradigms" dear to the twentieth century historians. However, he signals changes in rhythm, impasses, and enlightenments. He is also sensitive to the role of social usefulness as a factor in the progress of knowledge as well as in the cosmopolitanism of scholars. For example, when he talks about anatomy, which, according to him, owes its constant development in history to its usefulness to the sciences of health, he says: "Christian princes had Jewish physicians who had studied in the Moorish schools of Spain." Cuvier sets the first phase in the sixteenth century, a century when eminent scholars established the basis of the sciences that became divided as scholarship became more specialized. But at that time, scholars were strongly dependent on kings, princes, and cardinals. They were like nomadic wanderers. "Thus, a man from Brussels could teach in Padua and a man from Padua could teach in Brussels without any problem. This would be very difficult today since almost everywhere courses are given in the native language of the country in which they are taught."

These scholars were faced with the constraints of their country, of the types of power, the dominant ideas and religious fights as well as the level of development of techniques. Cuvier only retains the liberating effects that came out of the religious battles. He avoids mentioning the events in which the defense of the dogmas was violently opposed to wisdom, the condemnation of Galileo by the Catholic Rome in 1633 and the execution of Michel Servet by the reformed Geneva in 1553. He insists on the very important role that printing and engraving played on the dissemination of discoveries and the debates that followed. Even artists, such as Cranach and Dürer, participated in this movement. It was also the time when Europeans journeyed on quests of discovery in faraway lands. According to Cuvier, the dissemination of the compilation of works written by Conrad Gessner and Aldrovandi had a stimulating effect on the explorers; furthermore, kings like François I of France sent scholars on these expeditions to gather all kinds of information, including political and military! In this regard, Cuvier does not hesitate to make digressions of a geopolitical nature. For example, he links the military policy of Selim II, which put an end to the commercial monopoly of Venice with the Orient, and the race between Portugal and Spain to discover the maritime routes across the Atlantic and Indian oceans. The Netherlands, as soon as they freed themselves from Spanish domination, participated in the race toward the "East Indies," China, and Japan, which, at the same time, opened up a vast field to the natural sciences. The wars and battles that occurred in the first half of the seventeenth century bankrupted most of the kings and, as a result, artists and scholars found themselves without any support. Cuvier sees it as a reason why scholars began to gather together to form various societies. In England, the mysterious "Invisible College," a precursor to the Royal Society of London, might have been a refuge for scholars around 1647 during Cromwell's administration. The Royal Society of London then received its Letters Patent from Charles II in 1660. However, in Paris, the Academy of Sciences was founded in 1666 directly by royal decree. It seems important to Cuvier to demonstrate that these organizations were the opposite of universities, which were established much earlier in the thirteenth century, since the goal was not to teach what was already known, but to work toward expanding knowledge.

Cuvier presents an overview of the natural sciences that enables him to distinguish three phases in their development. A first phase was devoted to criticisms and commentaries on the works of the ancient authors, a second phase focused on the description of exotic productions, and, finally, a third phase, when methods of classification were established. Bacon, Galileo, and Descartes opened the door to the third phase. Cuvier gave pride of place to Chancellor Francis Bacon for re-establishing Aristotle's true thought, which, according to him, had been distorted by scholasticism. It shows how much Cuvier admired Aristotle, who partly inspired Cuvier's rule of organic correlations, and how much he appreciated Bacon's use of induction to reach general laws and the empirical movement that he initiated. With regard to chemistry, which he considers to be lagging behind the other sciences, Cuvier uses the terminology of "religious era" to refer to its esoteric beginnings. It is surprising to see a somewhat similarity between the phases described by Cuvier and the positivist concept of the "three states" developed by August Comte in his lectures during the same period. Did Stuart Mill, in his biography of Comte, not see already all of his thought in "Bacon, Descartes, and Galileo"? It is probable that this comparison between Cuvier and the beginnings of positivism was overlooked.

Divider

Portrait
JÖRG LENAU

GALMERSTR. 36
65549 LIMBURG/LAHN

Tel: 0171-3309037

» Prinzipien des Seins «

Weitere Kontaktseiten
» Facebook «» Twitter «» LinkedIn «» Whatsapp «
Diese Seite anderen mitteilen
» Impressum «  •  » Datenschutzerklärung «