Homepage - https://www.sya.de/

PRINZIPIEN DES SEINS

THE RELATIVITY OF (HUMAN) BEING

Divider

Die Bi-Sexualität

Die Urgründe der Nachvollziehbarkeit

Bi-Triangle.jpg

» Vorwort
Die Bewandtnis der Inbetrachtziehung
» Einleitung
Der sprach-sachtechnische Erörterungsgrund
» Kinsey-Reports
Initialinitiative des Öffentlichkeitswesens
» Der Sexualitätsbegriff
Ursprung und Entwicklung
» Der Geschlechtsbegriff
Die Verwicklungen der Kulturwandel
» Anatomie
Die körperliche Inbetrachtziehung
» Prinzipien des Da-Seins
Gegenüberstellung zum binären System
Der Geschlechtswandel «
Verhältnisse des Ermessungswesens
Substanz und Funktion «
Die wissenschaftliche Ausgrenzung
Pathologie - Teratologie «
Von der Anatomie zur Pathologie
Psychopathia sexualis «
Die Psychopathologie
Homosexuellenkonzepte «
Entstehung und Entwicklung
Sprachtechnische Barrieren «
Ursachen und deren Wirken
Quellenwerke «
Spezialisierte Werke
» Vorbereitung «
Sammlung vorbereiteter Inputs
» Filme «
mediale Darstellungen
» Informationen «
zum Aufbereitungsblauf

Als » Bisexualität (eigentlich Ambisexualität) « trifft man es in lexikalischen und enzyklopädischen Werken an und besagt, daß es sich um Ambisexuelles handelt, was als Bisexuelles bezeichnet wird. In der Ergründung dieser Gegebenheit zeigt sich jedoch, daß es sich tatsächlich um weder noch handelt, sondern die Anwendungen ganz andere Bedeutungen haben, als die begrifflichen Deklarationen als solches besagen.

Nachfolgend die systematische Ordnung, gemäß dem die Deklarationen wissenschaftlich begründet wurden. Der Ursprung basiert auf der aus dem Griechischen abgeleiteten Deklaration der Zweigeschlechtlichkeit des Hermaphroditen. Hierin geht es um die beide Geschlechter beinhaltende Präsenz des in Betracht ziehenden Organismus. Über die tabellarische Übersicht verdeutlich sich auch der jeweilige spezifizierende Bedeutungsinhalt, gemäß dem die Bisexualität die konstante Präsenz beider Geschlechter bezeichnet, sowie auch als Überbegriff/-ordnung fungiert, hingegen die Ambisexualität die Varianten der Ambivalenzen. In Verbindung mit der Ergründung der Fortpflanzung in der Pflanzenwelt, zur Spezifizierung und Unterscheidung gegenüber der ungeschlechtlichen Vermehrung, fand es im weiteren auch im Bezug auf Tiere und den Menschen seine Anwendung. Die Bisexualität bezeichnete indess ursprünglich somit das, was man später als Heterosexualität deklariert. Aus dem zwei Geschlechter in sich beinhalten wurde damit verbunden daraus gleichzeitig auch die Deklaration der Geschlechtsvereinigung 'mit-zwei-Geschlechtern'. Wie sich jedoch aufweist, nicht um dessen Eigenständigkeit als solche zu deklarieren, sondern um die in Betracht ziehenden Anomalien des Monosexualismus darüber zu spezifizieren. Darum dreht es sich auch in dieser Aufklärung, nämlich um die 'Bi-Natur', die man hierüber antrifft, in welcher die Natur des Seins den geistigen Ideologien gegenüber steht und es sich primär darum dreht, zu sondieren, inwiefern man das Eine oder das Andere antrifft, man hingegen einer Ungetrenntheit gegenüber steht, worüber es nicht (sogleich) ersichtlich ist. Der Mensch verfügt über die Sinne, worüber es sich klärt, nur werden gerade diese außen vor gekehrt und die Dinge verklärt, genau so, wie man es bezüglich dieser Deklaration antrifft und somit auch mustergültig sich darüber darlegt, wie es sich damit verhält.

Hermaphroditismus / Bisexualität (Zweigeschlechtlichkeit)
Deklaration (grch.)
Geschlechtlichkeit
Typus Geschlechtspräsenz Deklaration (lat.)
Geschlechtsverbund
Hermaphroditismus
verus
Geschlecht
nicht wechselnd
beide
präsent
konstant Bisexualität
simultaner
Hermaphroditismus
Geschlechtsfähigkeit
wechselnd
simultan Ambisexualität
sequentieller
Hermaphroditismus
Geschlecht
wechselnd
eines
präsent
sequentiell

Darauf basiert auch die verwickelte Entstehung der neuerlichen Spezifikation zur geschlechtlichen Vereinigung des Menschen. Ausgangspunkt war die Ergründung, ob und inwiefern die beim Menschen präsente Zweigeschlechtlichkeit, mit dem der Geschlechtsvereinigung im Verbund einher geht. Inbetrachtziehungsgegenstand wurden hierin die Anomalien gegenüber der normierten Monosexualität, worin sich dies mit der Ergründung des Hermaphroditismus, Transsexualismus und der Homosexualität verband. Zentrum der Inbetrachtziehung wurde, neben der Grundlage der Präsenz der Geschlechtsorgane, die geistige Identität. Während sich einerseits herausfilterte, daß sich über das eigene Geschlecht die Bestimmung der Geschlechtsvereinigung nicht ergibt, ergab sich hingegen auch keine andere Variante, worüber sich die Geschlechtsvereinigung (in anderer Weise als der Monosexuellen!) bestimmt. Weder in den Genen, noch in den neuronalen Verhältnissen, ließ sich etwas entsprechendes ausfindig machen. Die Mentalität ausmachende angeborene Persönlichkeitsveranlagungen existieren generell, aufgrund der Unauffindbarkeit, in den naturwissenschaftlichen Verhältnissen nicht.

Und damit befinden wir uns auch schon mitten drin, in der Darlegung und Aufklärung des Desasters, welches damit einher geht. Die Grundlage hierin bildet nämlich der stattfindende wissenschaftlich regulierende Ermessungsgegenstand, worin einzig evident (existent) ist, was den Augen selbst oder durch die Technik diesen ersichtlich gemacht werden kann und reproduzierbar - anderen gleichermaßen ersichtlich ist. Somit ist diese nämlich auf die Äußerlichkeiten - das körperlich Ersichtliche - eingeschränkt, dem gegenüber das Innen(er)leben des Menschen darin außen vor steht - es ist weder über das Auge, noch über die äußeren Sinne generell ersichtlich. Darauf basiert es auch, daß man die geistige Identität ermisst, inwiefern diese mit der Präsenz des körperlichen Geschlechts übereinstimmt und welcher Bezug sich darüber zur Geschlechtsvereinigung darlegt. Die Fixierung der sexuellen Ausrichtung, in Ermessung der Veranlagung, 'kann nicht' Gegenstand der Inbetrachtziehung darin sein, da es darin des Ermessungsgegenstandes entbehrt, worüber es sich (er)klärt. Einzig was über das Handlungs- und Kommunikationsswesen nach außen dringt, ist dem gegenüber faßbar. Indess ist das, was einzig in einem selbst erfahrbar ist, darin nicht Gegenstand und kann es aufgrund der Prinzipien darin auch nicht sein.

Darauf beruht auch der breite Graben, welcher sich hierin zwischen Mensch und Wissenschaft ausbreitet, denn das Gefühlsleben im Selbst, wie überhaupt das Leit- und Triebwesen der sich darüber vermittelnden Veranlagungen, sind einem Jeden einzig in sich selbst zugänglich, dem gegenüber man selbst zwar gerade über die resonierende sexuelle Vereinigung, zu Einblicken in sein Gegenüber gelangt, es jedoch darauf beschränkt ist und keinem Außenstehenden möglich ist, dies zu ersichten und in Erfahrung zu bringen. Zum Anderen, und gerade darin besteht auch meine Bewandtnis des Aufbringens, existiert bisher noch gar keine erkenntnisbegründete Grundlage über das Substanzwesen darin, zumal die substanzielle Präsenz gar negiert wird und man einzig einen geistigen Bezug handhabt. Es ist somit einzig möglich, die erforderliche Ermessung für sich selbst vorzunehmen, jedoch ist dies 'als solches' gar nicht vermittelbar, da es der Grundlage entbehrt, das Ermessende sachtechnisch zu (v)ermitteln. Bereits in den philosophischen Bezügen, stellte man diesen Bereich unseres Innen(er)lebens systematisch außen vor, auf der Grundlage, daß der Mensch nicht wie das Tier, instinktiv handeln würde, sondern einzig geistig, zumal es darin keine antomische Unterteilung gibt, sondern einzig das Eine der Seele und den Geist. Welche präkere Situation man darüber geschaffen hat, ist man sich indess in keiner Weise im Klaren, denn diese Inbetrachziehungsweise beseitigt es nicht, sondern im Gegenteil, denn insofern der Mensch sein Selbst nicht achtet, wird es zum Selbstläufer. Aufgrund der beiden Handhabungen von Philosophie und Wissenschaft existieren somit aber auch nicht die erforderlichen Erkenntnisse und damit verbundenen Bildnisse, was vor allem jedoch dazu führt, daß die Gegebenheiten darin weitläufig sogar als unbewußt einher gehen - gar nicht derart ersehen werden, wie sie einher gehen.

Nachfolgend das Anwendungswesen des sexualwissenschaftlichen Händlings, worüber sich die völlige Veränderung der Deklarationen ergibt. Es ist darin weder noch der Sachstand, sondern es dreht sich einzig um Anomalien gegenüber dem Monosexualismus. Für sowohl als auch, weist sich eine völlig andere Definition auf, als diese Spezifikationen als solche besagen, in Anbetracht dessen, daß es eine solche Veranlagung wissenschaftstechnisch gar nicht gibt. Hintergrund dieser Anwendung ist, daß einzig die Bisexualität, in seiner Verbindung zur Homosexualität, die Anerkenntnis einer Manifestation erlangt hat, hingegen die Ambisexualität darin gar nicht bedacht ist. Dem gegenüber ist jedoch die Bisexualität (gemäß der Konstanten zu-zwei-Geschlechtern) darin gar nicht Sachstand des Händlingswesens, sondern einzig Ambisexuelles (ambivalente Verhaltensweisen). Die Bisexualität ist vor allem darin auch nicht Inbetrachtziehungsgegenstand, da man davon ausgeht, daß dies (gemäß des 'echten' Hermaphroditen) nicht existiert, obwohl bereits spezifisch die Homosexualität belegt, daß es nicht aus dem Geschlecht heraus resultiert und sich somit auch nicht darüber spezifiziert. Hingegen ist sämtlicher Bezug einzig auf das Geschlechtliche überhaupt ausgerichtet und die Gesinnung wird darin aus dem Geschlechtlichen heraus resultierend erachtet. Und so verdeutlicht sich gerade darüber auch, daß tatsächlich gar nichts anderes Ermessungsgegenstand ist, sondern jegliche Abweichung des regulären Mann-Frau-Bezuges, als eine Anomalie im Raum steht und somit die begriffstechnische Spezifikation auch letztendlich einzig diesen Bezug wiederspiegelt und nicht, was es als solches besagt. Und gerade dies führt zu dem, was man damit verbunden auch antrifft, nämlich einer gänzlichen Ver(w)irrung in jeglichem Bezug, denn selbst die Heterosexualität hat darüber ihre Klarheit verloren und alles miteinander endet letztendlich in Queer(elen), wenn es sich einzig auf das Geschlechtliche bezieht, was seine Inbetrachtziehung erfährt.

Inbetrachtziehung Geschlechtspräsenz Anwendungsweise
Heterosexualität konstant Heterosexualität
Ambisexualität
(eigentlich Heterosexualität)
ambivalent Bisexualität
(eigentlich Ambisexualität)
Bisexualität
Ambisexualität
(eigentlich Homosexualität)
ambivalent
Homosexualität konstant Homosexualität

Bei der Veranlagung der Bisexualität und Ambisexualität handelt es sich, gleichermaßen wie bei der Hetero- und Homosexualität, um eine Spezifikation der veranlagten Sinnlichkeitsprägung und der damit einhergehenden triebhaften Erfüllungsbedürftigkeit mit dem/den Sexualpartner/n, in welchem das Verbundwesen enthalten ist. Darauf beruht das Kernwesen der Angelegenheit, nämlich daß die sexuelle Erfüllung im eigenen Selbst, in seiner Prägung präsent ist und sich über die Reflektierung des Gefühlslebens äußert und darüber spezifisch erfahren wird. Die veranlagte Individualität des sinnlichen Sexualwesens differenziert sich substanziell in seiner Präsenz, wie auch seinem Wirkwesen, gegenüber dem des Geschlechtswesens, geht jedoch als kollektives Einheitswesen damit einher. Die relative Präsenz der Triebwirkung beruht auf der Varianz der veranlagten Ausgeprägtheit, dem gegenüber das Relative des geistig Beurteilenden und Be(ur)kundenden darauf beruht, daß es sich nicht um geistige Veranlagungen handelt und sich erst ein Identitätsverhältnis darin ausbilden muß, sodaß man dies dem entsprechend, (passenderweise) separierend als sexuelle Orientierung deklariert. Man achte auf die unterstrichene Hervorhebung zur Unterscheidung von Geschlechtswesen und Sexualwesen, was weitläufig undifferenziert einher geht, dessen Unterscheidung jedoch des Wesens Kern (so auch der Mißverhältnisse) darlegt. Maßgeblich ist hierin vor allem auch, daß das Geschlechtswesen, im Bezug auf das Sexualwesen, anteiliger 'sekundärer Bestandteil' ist und nicht das Geschlecht, sondern die Gesinnung (die Mentalität Ausmachende) das ist, worüber sich die Eigenart dessen darlegt. Die Markantz dessen und das Detailreichtum des Sinnen(er)lebens, erfahren wir über die Liebe, dem gegenüber der Sex das repräsentiert, was man im Bezug auf den Geschlechtsverkehr als regulären Ermessungsgegenstand in Betracht zieht.

Nachfolgend der substanzielle Einheitsverbund, worüber sich die Wesensart darlegt. Maßgeblich hierin ist, daß die bedürftige Erfüllung in der Veranlagung präsent ist. Aus der Triebwirkung erwächst auch die Leidenschaft (Leiden schafft Leidenschaft), worüber es sich entfaltet und seine Erfüllung anstrebt. Hierin gibt es nicht, wie man es ermisst, einzig männlich und weiblich, was nämlich einzig den Geschlechsbezug repräsentiert und zu einer völligen Ver(w)irrung führt, sondern gemäß der Varianten, ergibt sich die Spezifizierung über die jeweilige Einheit der Gesinnung, in seinem Verbund mit dem Geschlecht. Die drei Varianten ergeben sich auch logisch und zwar, indem die Heterosexualität auf der Ergänzung, die Homosexualität auf dem Gemeinsamen und die Bisexualität auf dem Kombinat von beidem beruht, gemäß den regulären Vereinigungen der Einheitswesen im Sein, worin genau dies die Grundlage bildet. Wie man dem Schaubild entnehmen kann, so gibt es zwei Varianten der bisexuellen Vereinigung, worüber sich verdeutlicht, warum man darin mit einer derartigen Komplexität konfrontiert ist. Man stelle dem einmal die Meßlatte gegenüber, welche man praktiziert und man wird erkennen, wie dies doch alles durcheinander bringt, da man einzig das Geschlecht dabei bedenkt. Regulär ist es tatsächlich überhaupt nicht kompliziert und es bedingt noch nicht einmal des logischen geistigen Nachvollzuges (worüber es sich indess dem entsprechend nachvollziehbar darlegt), denn generell reguliert es sich darin über das stattfindende sinnliche Resonanzwesen, sodaß sich über das erfahrende Gefühlsleben klärt, worüber sich die jeweilige Passform ergibt und worin nicht. Gerade dies ist auch das Wesentliche: das Instinktwesen ist daraufhin eingerichtet - der Geist indess von Grund auf nicht, sodaß es darin der Ausbildung der Einrichtung darauf bedingt. Nicht das Geistige ist es, worüber sich die veranlagten Präsenzen vermitteln, sondern das Instinktive und Intuititive.

Geschlecht
männlich weiblich
sexuelle Konstitution

 heterosexuell 

Identität
der
Heterosexuelle
die
Heterosexuelle
Konstellation
Geschlecht
männlich männlich
sexuelle Konstitution

 homosexuell 

Identität
der
Homosexuelle
der
Homosexuelle
Konstellation
Geschlecht
weiblich weiblich
sexuelle Konstitution

 homosexuell 

Identität
die
Homosexuelle
die
Homosexuelle
Konstellation
Geschlecht
weiblich männlich weiblich
sexuelle Konstitution

 bisexuell 

Identität
weibliches
bisexuelles
Pondant
der
bisexuelle
Dritte
weibliches
bisexuelles
Pondant
Konstellation
Geschlecht
männlich weiblich männlich
sexuelle Konstitution

 bisexuell 

Identität
männliches
bisexuelles
Pondant
die
bisexuelle
Dritte
männliches
bisexuelles
Pondant
Konstellation

Was die Bisexualität betrifft, so habe ich dafür die erforderlichen Deklarationen begründet, um dessen Wesensart darüber ersichtlich und erkenntlich werden zu lassen. Wie sich zeigt, so findet hierin suggestiv begründet, einerseits nur das zu-Dritt als solches seine Erachtung und andererseits bezieht es sich einzig auf die Spezifizierung, gemäß des zu-zwei-Geschlechtern und somit der Pondants. Ein klares Bildnis darüber existiert indess nicht, obwohl es, wie man aus der Gegenüberstellung heraus ersehen wird, darin sich dem entsprechend darlegt, über das Bezugsverhältnis von FMF/MFM und keineswegs austauschbar ist, wie es sich darin erfüllt. So verdeutlicht sich speziell über die beiden Varianten der Verbünde, daß selbst darin die sexuelle Vereinigung keine rein geschlechtsbezogene ist, sondern gemäß aller dieser Veranlagungen, das Vereinigungswesen - die Einheit - der Erfüllungsgegenstand ist und gerade hierin seine unübersehbare Deutlichkeit erfährt. Gravierend ist nämlich, daß es sich gerade bei den bisexuellen Dritten doch anders verhält, wie bei den Pondants und somit ohne das entsprechende nachvollziehende Verständnis, hingegen sich grundsätzlich auch als fraglich stellt, wie es sich damit verhält. Gerade hierin ist es somit auch, im Gegensatz zur Hetero- und Homosexualität, gar unerläßlich, daß man sich auf die Nachvollziehbarkeit der Gesinnung bezieht, aufgrund der bestehenden Verwirrwesen. Generell ist das Einzelne grundsätzlich nur gemäß dem in seiner Klarheit ersichtlich, gemäß dem es im Verhältnis des Ganzen seine Sichtung erfährt. In der bisexuellen Veranlagung ist vor allem primär das zu-Dritt das Elementare, dessen Wirkwesen sich nicht auf die sexuellen Verbünde beschränkt, sondern auf das generelle Miteinander auswirkt. So ergibt sich auch in einem erfüllenden oder auch reduzierten zu-Zweit, ein sich auswirkender Widerspruch einer Unausgefülltheit und somit Disharmonie. Gerade darin besteht auch das ungemein Komplexe darin, daß es sich einzig in seinem erfüllenden zu-Dritt auch als harmonische Erfüllung ausgestaltet. So gilt es mir auch hervorzuheben, daß die Bisexualität weit verbreiter ist, als man sich vorstellt, hingegen wird sie aufgrund der vielfältigen Umstände, die ich hier in ihren Bestandteilen darlege, nur von einem äußerst geringen Anteil derer tatsächlich gelebt, jedoch von einem weitaus größeren Anteil hingegen angestrebt - weitläufig jedoch unbewußt gegenüber dem Sachstand, wie es funktioniert, sodaß es sich im Regelfall einzig nur zeitweise überhaupt ergibt und in kaum einem Fall eine dauerhafte Aufrechterhaltung erfährt.

Über die Ambisexualität spezifiziert sich hingegen die Unausgeprägtheit. Die Ausgeprägtheit ist ein Sachstand der graduellen Ausprägung der Veranlagung und der daraus hervortretenden Triebwirkungen, dem gegenüber sich die Asexualität als gänzliche Unausgeprägtheit stellt. Bei der Ambisexualität handelt es sich hingegen um eine schwache Ausprägung, was sich darüber darlegt, daß hierin sich keine Bestimmung aufweist, was man auch erfährt über die Darlegungen, welche dies zum Ausdruck bringen. Aufgrund der graduellen Gegebenheit existiert hierin jedoch keine klare Grenze, sodaß man 'an sich' auch nur zwischen stark und schwach ausgeprägt 'als solches' unterscheiden kann. Dies gilt für Beinhaltende, wie auch für sich damit Vereinigende gleichermaßen. Gerade das damit einhergehende Mißverhältnis ist indess allgemein geläufig, denn während in den anderen Verbindungen es klare Ordnungen gibt, so ist dies hierin nicht gegeben und somit auch generell oder auch zeitweise variabel. Maßgeblich hierin ist, daß das sinnliche Ermessungswesen einer Fixiertheit, somit auch nicht gegeben ist, welches sich über die Resonanz der sinnlichen Vereinigung als solches vermittelt. Ausschlaggebend ist des weiteren, daß damit verbunden auch die Konstanz der Partnerwahl darin nicht gegeben ist. Und somit ergibt sich auch hierin eine spezifische Eigenart der Ausprägung der Veranlagung. Auch hier wiederum gilt, daß auch dies keineswegs der Hetero- oder Homosexualität zuzurechnen ist, da die Unausgeprägtheit gar nicht ersichtlich werden läßt, inwiefern was darin die Prägung repräsentieren würde und vor allem die Konstanz der Partnerwahl hierin gar nicht gegeben ist. Somit gilt aber auch hierin das Prinzipielle dieser Veranlagung, daß sich die Sexualpartner über das Einheitswesen ergeben und somit, in Ergänzung zu obiger Tabelle, Ambisexuelle mit Ambisexuellen verbindet.

Gerade den Aspekt der Ausgeprägtheit hat man ebenfalls generell nicht in Berücksichtigung, was gar in ausartender Weise für gravierende Mißverständnisse Sorge trägt. Wobei man doch gerade dieses Spezifische der Unbestimmtheit - des Ambivalenten, über den Verlauf ausgiebig in Erfahrung bringen konnte und bei den Ambisexuellen sogar ein Identitätswesen erwirkte, worüber diese ihre Unbestimmtheit zwischenzeitlich auch entsprechend demonstrativ klar und unmißverständlich vermitteln. Die Inakzeptanz dessen beruht indess darauf, daß man das ist-nicht-fixiert als inakzektabel erachtet und man erfordert, daß diese sich darauf einrichten, gemäß des Erachtungswesens des Konstanten zu handeln, ohne zu berücksichtigen, daß es diesen gar nicht möglich - nicht gegeben ist, danach zu handeln. Es sind somit auch keineswegs die Ambisexuellen, welche alles durcheinander bringen, sondern vielmehr verdeutlichen diese die Unklarheiten des Antreffenden, worin obige Darlegung des Einheitswesens derart gar nicht die Richtlinie bildet und sich gerade dies als unspezifiziert stellt. Es hat sich jedoch vor allem vermittelt, daß es sich prinzipiell um keine Konstante darin handelt und darüber erfährt es auch seine allgemeingültige Spezifizierung der Differenzierung, ebenfalls auch zur Bisexualität.

Dem gegenüber ist jedoch das Bezugswesens der veranlagten Konstanten des Bisexuellen nach wie vor abseits des wissenschaftlich Fundierten offen ersichtlich präsent, in seinem althergebrachten Bezugswesen von » Dreiecksbeziehungen « und im Darstellungswesen dessen als » Dreiecksgeschichten « (FMF/MFM), jedoch auch dort weitläufig mit anderem vermischt. Als solches erfährt es generell einzig in seiner spezifischen Inbetrachtziehung seine Erachtung, worüber jedoch in aller Deutlichkeit ersichtlich ist, wie es sich mit dieser Wesensart verhält und was es damit auf sich hat. Tatsächlich begründe ich dem gegenüber einzig die Deklarationen und darüber verbildlichenden erläuternden Darstellungen dessen, worüber es seinen nachvollziehbaren Gehalt erfährt. Wie es mir vor allem auch darzulegen gilt, so ist das Einheitswesen, wie man es in der sexuellen Konstitution antrifft, eine reguläre Natürlichkeit, was sich darüber verdeutlicht, daß die Einheitsverbünde des Seins grundsätzlich auf diesen Varianten beruht, sodaß man darin Verbünde von Ergänzungen, Gemeinsamkeiten, sowie das Kombinat davon, als Regularien der Einheiten antrifft und sich überhaupt erst darüber die Verständigkeit der Natur des Daseins darlegt, wie sie sich uns darbietet. Somit gilt es mir hier auch darzulegen, wie es sich mit dem Verbundswesen verhält, primär des Menschen Bezug zu seinem Selbst, wie jedoch auch der das Sein beschreibenden Wissenschaft und Philosophie, welche sich dem gegenüber nicht nur differenzieren, sondern gar distanzieren, indess die Ausgrenzung mißachten, die sie darüber einrichten und somit alles miteinander durcheinander gerät. Sondiert man somit die Einheitswesen, gemäß ihrer spezifischen Funktionalität, ergibt sich darüber auch die erforderliche Klarheit.

Divider

Vorwort

Divider

In den Verhältnissen, welche unsere Allgemeinkenntnisse begründen und somit auf philosophischen, vor allem jedoch den entstandenen wissenschaftlichen Grundlagen beruhen, hat sich im Verlaufe über die Alleinstellung der Wissenschaft ein Substanzverhältnis etabliert, in welchem das, was wir als unser Innen(er)leben erfahren, nicht existiert. Während in dem ursprünglich Philosophischen bereits das Instinktive außen vor gestellt wurde, aufgrund der Ideologie, daß der Mensch kein Tier sei und somit einzig geistig orientiert handeln würde (um dies zu formieren), hat man später, im Bezugsfeld der aufkommenden Naturwissenschaften, zusätzlich die Introspektion (Innensichtung) gänzlich verworfen, aufgrund der Ideologie, dies sei rein subjektiv und daraus könne keine Objektivität heraus hervor gehen. Die entstandene Naturwissenschaft hingegen, basiert auf der Voraussetzung des empirischen (offen ersichtlich nachprüfbaren) Beweises, worin einzig das als evident (existent) gilt, was dem entspricht. Die maßrichtende Grundlage bildet hierin somit das dem Auge (selbst oder durch Technik) Ersichtliche. Somit existiert in dem Bezug auch einzig der Körper und die Physis - selbst der Geist existiert darin nicht. Nachfolgend die bestehende Differenzierung dessen, was sich über die Naturwissenschaften darbietet, dem gegenüber die Psychologie auf der Philosophie fußt, hingegen in beiden Verhältnissen nicht Inhalt ist, was sich mir über meine langjährige Ergründung des Innen(er)lebens darüber darlegt. Wie man dem entnehmen kann, so handelt es sich gerade um den substanziellen Bestandteil, welcher unser Selbst repräsentiert. Und genau dies gilt es mir auch zu vermitteln. Man möge hierin auf die Spezifizierung von Naturwissenschaft achten, was erforderlich ist, denn im weiteren Umfeld dreht es sich indess auch um eine Sexualwissenschaft, die es als solches gar nicht gibt, sich zu etablieren suchte, dies jedoch nicht erlangte, indess sich ein regelrechtes Kollegium etablierte, dem gegenüber sich jedoch die Grundlagen der Leitlinien der Wissenschaft, generell über die naturwissenschaftlichen Fachbereiche begründen und die Psychologie, wie auch die Philosophie, der Geisteswissenschaft zugehörig und somit ebenfalls nicht Ermessungsgegenstand des Substanzwesens (geworden) ist.

Philosophie/Psychologie, Wissenschaft und das Meinige im Nebeneinander

Nachfolgend die substanziellen Bestandteile, gemäß des Organisationskonstrukt, welches sich mir über das Substanzwesen des Menschen darlegt. Wie man dem entnehmen kann, so ergibt sich über die Innenperspektive eine Sichtung, die weder dem Philosophischen entspricht, noch der Naturwissenschaft. Indess repräsentiert es die funktionalen Bestandteile, welche der Mensch über sein Innen(er)leben auf direkte Weise erfährt. Hierzu gilt es mir anzumerken, daß ich in meinen bisherigen Recherchen, in keiner Weise auf etwas Vergleichbares gestoßen bin, hingegen gelange ich nach und nach zu immer mehr fragmentarischen Kenntnissen von anderen, welche Teile dessen dem entsprechend darlegen, gemäß dem ich die Verfügbarkeit entsprechend mit einbinde. Nichts von dem, was ich aufbringe, ist gänzlich unbekannt, indess zeigt sich, daß eine derartige Gesamtsichtung dessen bisher ganz einfach noch nie vollzogen wurde, obwohl das Erfahren dessen, jedem Menschen gegeben ist, es jedoch zur Klarheit der Ersichtung dessen, auch des Nachvollzuges der jeweiligen Funktionalität bedingt. In meinem Fall war es die Infragestellung meines veranlagten Selbst, worüber sich mir die Ergründung zwangsläufig ergab, indess kann ich bestätigen, daß es derart regulär nicht ersichtlich ist - nicht in dieser Klarheit. Hingegen sind uns alle diese Gegebenheiten bekannt und auch, worüber sich die Dinge darin voneinander unterscheiden: (bewußt) wahrnehmen, denken, erinnern, das Instinktive/Intuitive, der Charakter, die Begabungen und auch die sexuelle Kontitution, im Bezug auf sein Erfüllungswesen. Und all unser Selbst zeigt sich über dessen Reflektionen, welche wir als Gefühle erfahren - in uns drinnen, jedoch keinem im Draußen. Meine Ergründung beruht maßgeblich auf dem spezifischen Erfassen der Funktionalität - wie funktioniert das Jeweilige - worüber es auch seine allgemeingültige Beschreibung und somit auch seine spezifische Ersichtung erfährt, welche darüber für Jeden in seinem Selbst nachvollziehbar wird. Meine erlangten Erkenntnisse zu vermitteln, befindet sich noch in der Auf-, oder passender ausgedrückt Ausbauphase, jedoch derart konstruiert entwickelt, sodaß was verfügbar ist, auch entsprechend nutzbar ist. Zumal es sich damit verbunden auch um ein umfangreiches Spektrum an Aufklärung handelt, bedingt es auch generell der entsprechenden Umschweife, um all das nachzuvollziehen, was sich darüber darbietet.

Organisationskonstrukt

Das Bewußtsein ist die substanzielle Präsenz dessen, was wir gemäß seines Kollektivkonstruktes über unsere Bewußtwerdung im Innen(er)leben erfahren. Hierbei handelt es sich um den Bewußtsinn, die Erinnerung und den Geist im Überbewußtsein, sowie den Instinkt, die Begabungen, den Charakter, die Konstitutionen und die (unterbewußte) Erinnerung im Unterbewußtsein. Während die beiden Erinnerungswesen und der Geist rein funktionale Organe sind, sind hingegen die anderen Sinnesorgane. Das Bewußtsein repräsentiert die Mentalität des Menschen, gemäß seiner individuellen Prägung der jeweiligen Eigenart, welche sich einerseits über die der Veranlagungen ergibt, darüber hinaus jedoch auch über das Erleben und die sich darüber ausgestaltende geistige Prägung. Gleich den Organen des Körperlichen, haben die des Bewußtseins eine jeweilige funktionale Einrichtung, worüber diese als solche kenntlich sind. Hingegen handelt es sich hierbei um reine Wirksubstanzen und nicht um eine Körperlichkeit, welche somit auch einzig über die Wirkungen erfahrbar sind, gemäß dem wir es auch sprachlich kennen und benennen. Maßgeblich unbekannt ist indess das substanzielle Koordinat des Einheitswesens, gemäß dem ich es aufzeige, wie auch der Bewußtsinn, worüber die Bewußtwerdung hervortritt und überhaupt erst in Anbetracht und Anwendung dessen, sich dieses Sichtungswesen ergibt. Generell gilt hierin, daß die substanziellen Präsenzen, als solche weder ersichtlich, noch deren inhaltliche Präsenzen einsehbar sind, sondern einzig die Wirkungen, welche über diese hervortreten, sodaß man weder in die Erinnerung, noch in die Gegebenheiten des Unterbewußtseins direkten Einblick nehmen kann. Es ist einzig ersichtlich, was aus dem Jeweiligen hervortritt und man entsprechend der Erfordernis seine Aufmerksamkeit darauf richtet und es darüber bewußt in Erscheinung tritt. So ist jedoch das gesamte Konstrukt, neben dem Eigenwirken der Veranlagungen, auf Reflektion und Resonanz eingerichtet, worüber sich generell das Einheitswesen Mensch kollektiv umsetzt und somit auch gemäß dem ersichtlich, wie es sich darüber darbietet. Wesentlich hierin ist, daß jeder substanzielle Bestandteil eine spezifische Markantz an funktionalem Wirkwesen repräsentiert und diese in Verbindung damit auch in entsprechender Klarheit in Erscheinung treten, gemäß dem, wie man es über das Denken des Geistes kennt. Über das Verhältnis des Wirkwesens des Einzelnen, wie auch das der kollektiven Einheitswesen ergibt sich die klare Wesensschau. Herausragend in all dem, ist im geistigen Verhältniswesen Mensch der Verstand, dessen Funktionalität primär darin besteht, die geistigen Bildnisse gegenüber dem wahrnehmenden Erleben abzuklären, im Bezug auf auftretende Widersprüche, worüber sich überhaupt erst das Regulat des Realitätsbewußtseins ergibt.

Bewusstsein.jpg

Der Inhalt des erstgeschaffenen Buches bringt die Präsenz der Gegebenheiten gegenüber dem Substanzwesen auf den Punkt, um es als solches darzulegen. Zur Detaillierung entstehen zwei weitere Bücher. In dem Einen, welches auf einer anderen Seite seine Aufbereitung erfährt (» Die Anatomie der mentalen Organe «) erfährt das Substanzwesen als solches seine Erläuterung, in Verbindung mit unserem wahrnehmungsgemäßen Dasein. Das Andere, welches hier seine Aufbereitung erfährt, ist spezifisch ausgerichtet auf die mentalen Veranlagungen - den Gaben des Menschen, worin die Einrichtung der geistigen Identität auf das eigene Selbst, seinen entsprechenden Stellenwert erfährt. Gerade das Sexualwesen nimmt einen elementaren Raum ein, in des Menschen veranlagten Lebenserfüllung, gemäß dem wir über das Sinnenhafte das Selbst erfahren. Und so ergibt sich gerade hierüber eine allumfassende Darbietung der Wesensart darin. Während somit in dem Einen das Kernwesen der Substanz und das Bewußtsein seine ausführliche Darlegung erfährt, dreht es sich in dem Anderen um das veranlagte Selbst im Unterbewußtsein, sodaß sich beides miteinander ergänzt zu einer Gesamtdarstellung, dem gegenüber das erste Buch den überblickenden Einstieg dazu bereitet. Die Unterteilung dieser beiden Bücher erwies sich nicht nur als erforderlich, sondern entspricht vor allem auch dem Differenzierungsverhältnis von Über- und Unterbewußtsein. Diese bilden zwar funktional eine kollektive Einheit, jedoch sind sie ein 'einzurichtender' Einheitsverbund, im Bezug auf deren inhaltliche Präsenz (gerade darauf beruht auch deren gravierende Unterscheidung!). Während die mentalen Veranlagungen und auch der Instinkt, über angeborene Inhalte verfügen, ist indess die Erinnerung und somit das Überbewußtsein, zunächst mit einer Leere - einzig mit seiner Funktionalität - ausgestattet, was sich erst über das bewußte Erleben erfüllt. Die erfolgende Vereinigung des Überbewußtseins mit dem Unterbewußtsein stellt sich somit auch relativ dem, inwiefern es sich über erfahrende Inhalte des Unterbewußtseins erfüllt. Und gerade dies erweist sich, nicht nur aus dem miseren Gegenwartsverhältnis heraus, sondern generell, nicht als Selbstverständlichkeit, daß es derart stattfindet. Es ist keineswegs ein Zufall, daß der Mensch sich im Verlaufe in dieser Art auf die 'geistigen Erscheinungen' der Außenwelt fixiert hat, sondern eine notgedrungen Gewordene, da der Mensch sich immer mehr von 'anderem' nährt, immer mehr sich nicht auf seine regulären Erfordernisse beschränkt, sondern zwischenzeitlich gar einzig noch den Profit ersieht, sodaß dieser gerade aus diesem Verhältnis heraus, regelrecht sich selbst dabei übersieht. Über diese Ausführung gilt es mir somit auch, spezifisch zu vermitteln, daß die Erfüllung im Selbst (vor)gegeben ist, und damit ist das gemeint, WAS einen erfüllt, hingegen in dem rein Äußerlichen dies gar nicht ersichtlich ist - es des Ersichten des Selbst bedingt. Während somit der Mensch in seiner reinen Veräußerung sich gar der Willkür preis gibt und dabei sogar verlustigt geht, was diesem gegeben ist, ist indess in dessen Selbst sowohl die Substanz und auch das (V)Erlangen eine Gegebenheit, deren es einzig der Berücksichtigung bedingt, um daraus seine Lebenserfüllung zu erlangen - die man ansonsten gar nicht sieht. Wie ich dazu sage, so ist der Geist einzig der Reiter des Pferdes, jedoch ist man sich dessen weitläufig gar nicht mehr bewußt. Gerade dies ist auch das Bindeglied in beidem Aufbringen, in seinem erforderlichen Umfange darzulegen, wie es dazu kommt und was es damit auf sich hat - die ersichtlichen Ursachen über die Funktionalität zu vermitteln. Das Bezugswesen der » Bi-Sexualität « stellt sich zumal gerade in dem Bezug auch als i-Tüpfelchen zu all dem, denn darüber erfährt die stattfindende geistige Verlustigung seine besondere Auszeichnung, dem gegenüber indess die Funktionalität über die Gegenständlichkeit aufklärt.

Die substanzielle Beschaffenheit - Bewußtsein

Die Aufbereitung zur Vermittlung präsenter Kenntnisse über das Bi-Sexualitätswesen und dessen Anwendungswesen, findet gemäß des weitreichenden und sich als gravierend verklärend stellenden Umfanges, fragmentarisch, jedoch in systematischer Reihenfolge statt. Dem entsprechend wird im ersten Schritt zunächst die Gegenwart abgebildet, ausweitend auf die Ursprünge hin, um ein Bildnis über die bestehende sach- und vor allem auch sprachtechnische Anwendung aufzubereiten. Hierzu gilt es hervorzuheben, daß nicht nur die Gegebenheit der Bisexualität völlig verklärt im Raume steht, sondern bereits die Sexualität ein Zerwürfnis darstellt, da es sach-, wie auch sprachtechnisch nicht auf dem Geschlecht beruht, derart man es händelt, sondern im Verbund damit einher geht. Es besteht eine klare Differenzierung zwischen dem Sexualwesen, Geschlechtswesen und Fortpflanzungswesen, sowohl substanziell, wie auch funktional. Hingegen ist, aufgrund des Grundsatzes des außen vor stellens des Instinktwesens des Menschen, das präsente Bezugswesen der mentalen Veranlagungen und somit auch das Spezifische des Sexualwesens, als solches nicht ergründet worden und nicht Bestandteil der Erachtung. Hingegen wurde, wie es hiernach seine Erläuterung erfährt, die Begrifflichkeit der Sexualität eben nicht auf der Grundlage des Geschlechtswesens begründet, dessen Markantz des ursprünglichen Aufbringens dies auch verdeutlicht und gar sein Kernwesen darüber tatsächlich repräsentiert. Im Verlauf der Beschreibungen gilt es somit zunächst einmal das darzulegen, wofür die entsprechenden Kenntnisse präsent sind und die Verklärtheiten aufzuklären, dem gegenüber im Anschluß daran meine eigenen Ergründungen ihre Darstellung und Erläuterung erfahren, indess es jedoch auch grundlegender Bestandteil und somit generell über die Inhalte als solches zur Vermittlung gelangt. Generell gilt es zu bedenken, daß einzig über die Gesamtsicht auch das Einzelne überhaupt zu seiner tatsächlichen Klarheit gelangt, gemäß der Natur des Seins, worin alles miteinander gemäß eines Kollektivs verwoben ist.

Elementare Grundlage in diesem regulären Händling, gemäß dem wir funktional eingerichtet sind, ist die Steuerung der Wahrnehmung und damit verbunden, aus dem Ersehen das nachvollziehende Verstehen zu begründen. Dem gegenüber begründet sich indess die geistig projizierten Vorstellungen aus der bewußt erfahrenen Erinnerung heraus, wohingegen man die Sprachbildung allgegenwärtig nicht aus dem Selbst heraus begründet. Bei der bewußten Wahrnehmung des Überbewußtseins, handelt es sich um eine Zusätzliche, dem die des Selbst im Unterbewußtsein jedoch nicht bedingend vorausgeht, zumal, wenn es sich um sprachliche Inhalte handelt, derer es zunächst der bewußten Entfaltung dessen bedingt, wie überhaupt in Bezügen, worin die bewußt wahrnehmende Verarbeitung Voraussetzung ist, um gemäß dem seine Ersichtlichkeit zu erfahren. Maßgeblich hierin ist, daß die äußeren/körperlichen Sinnes- und Wahrnehmungsorgane nicht die Wahrnehmung vollziehen, sondern einzig Mittler sind und die eigentliche Wahrnehmung und somit, die Verarbeitung und Reflektierung des Wahrgenommenen - das Wahrnehmen - sich einzig im Innern vollzieht. Dem gegenüber werden wir mit Verhältnissen konfrontiert, worin das Selbst - das Subjekt - gar nicht Inhalt ist. Man verdeutliche es sich über nachfolgendes Bildnis der Kugel im Raum, wie es sich damit verhält.

Würfel

Wie man diesem Bildnis entnehmen kann, so kann man über die reine Außenperspektive, in dem Fall der Inbetrachtnahme der Kugel, das Innere von außen gar nicht ersichten, dem gegenüber es dem Ersichten aus dem Inneren heraus bedingt, um auch dies ersichtlich werden zu lassen. Gemäß dem verhält es sich auch mit unseren äußeren und inneren Sinnen, wie auch den damit verbundenen Wirkwesen, sodaß in keiner Weise über die äußeren Sinne ein inneres Ersichten dessen, was die inneren Sinne in Erscheinung bringen, erlangt werden kann. Auch kann man nicht zu des anderen Innensichten gelangen, denn sie sind einzig dem eigenen Selbst möglich. Hingegen ergibt sich mustergültig über die sexuelle sinnliche Resonanz eine der vielfältigen sinnlichen Verbindungen, worüber eine solche Innenschau über den resonierenden Verbund gegeben ist. Zumal über das eigene Erleben Verhältnismäßigkeiten über des anderen Erleben zu erlangen ist, über Gleiches und Ähnlichkeiten des erfahrenden Erlebens, hingegen jedoch in keiner Weise über die äußeren Sinne. Die Wahrnehmung ist somit auch das wesentliche Bindeglied, um die Gegebenheiten zu (v)ermitteln. Hierin gilt es somit auch primär, sich zu verdeutlichen, daß die angewandte Objektivität, welche man als Standard praktiziert, das Subjekt gar nicht beinhaltet, dem gegenüber die Subjektivität des Menschen Daseinsverhältnis zum Sein repräsentiert und generell nicht außer Acht stehen kann, da dieser selbst darüber als solches außen vor gerät - sein Selbst darüber nicht in Erscheinung tritt, wie auch jegliches andere Selbst darüber nicht Inhalt ist. Man verdeutliche sich somit auch, welche Unterscheidung sich darüber darbietet und wie es sich damit verhält, denn gerade dies ist das Kernwesen, um das es sich hierbei dreht.


Wie ist es, eine Fledermaus zu sein?
» «

Thomas Nagel bringt die Gegebenheit auf den Punkt: das sinnliche Erfahren kann man einzig im Verhältnis der gleichen Präsenz an Sinnen erfahren. Gerade die Gegebenheit, daß es Denen der einen Ausprägung der Veranlagung sinnengemäß nicht nachvollziebar ist, wie es sich mit dem Sinnenerfahren bei den anderen Ausprägungen verhält, verdeutlicht die sinnengeprägte Prägnanz der Veranlagung in aller Deutlichkeit. Gleichermaßen, wie des Mannes sexuelles Sinneserfahren nicht von einer Frau, wie auch umgekehrt, gleich dem erfahren werden kann, so verhält sich auch gegenüber der Veranlagung der sexuellen Ausrichtung des Vereinigungswesens untereinander. Spezifisch dies verdeutlicht unmißverständlich, daß es sich hierbei um eine Eigenart an Sinneswesen handelt, hingegen jedoch nicht auf dem Körperlichen beruht, sondern gemäß dem es über das reflektive Gefühlsleben in Erscheinung tritt, darüber auch dessen Verbundswesen der Präsenz darlegt. Das ist es auch, worum es sich dreht: es bedingt des eigenen sinnlichen Erfahrens dessen. Indess ist gerade darüber auch nachvollziehbar, wie es sich darin generell verhält, denn gegenüber einer grundlegenden Unterscheidung der Sinne, wie im Beispiel der Fledermaus gegenüber dem Menschen, handelt es sich hierbei um den gleichen Sinn, jedoch mit einer unterschiedlichen Ausprägung des Erfüllungsbezuges, nicht jedoch des Sexualwesens als solches, sodaß einzig der Erfüllungsbezug sinnlich nicht nachvollziehbar ist, hingegen jedoch alles weitere, sodaß auch dieser Teil darüber indirekt, nämlich wie alles miteinander, über die Funktionalität nachvollziehbar ist. Und so ist dem Menschen gar indirekt nachvollziehbar, wie eine Fledermaus per Echolot sich orientiert, was an sich nämlich nichts anderes ist, als des Menschen Orientierungssinn, im Bezug auf sein Erfüllungswesen. Das prinzipielle Funktionswesen ist hier wie dort gleich und unterscheidet sich einzig in dem, worüber es sich umsetzt.

Die substanzielle Beschaffenheit

Bewusstsein

Die substanzielle Beschaffenheit - Bewußtsein

Handeinband Halbfranzband Marmorpapier
Anfertigung: » Buchbinderei Diller «
Selbstverlag - 300 Seiten - 134,- Euro

» Leseprobe (45 Seiten) «

Divider

Einleitung

Divider

Die Deklaration Bisexualität ist sowohl ein » Oberbegriff « und neben der Ambisexualität gleichzeitig auch ein unterscheidender » Unterbegriff « (zwecks » Klassifizierung « der Unterscheidungsmerkmale). Dies findet jedoch einzig derart spezifizierend und differenzierend in » Fachspezifikas « seine Anwendung und ist in der Allgemeinheit, vor allem die unterscheidende Deklaration der Ambisexualität unbekannt. Als Oberbegriff bezeichnet Bisexualität das beinhalten von zwei, bzw. beider Geschlechter und als Untergliederndes die Konstanz dessen, dem gegenüber die Ambisexualität die Ambivalenz (variierend/wechselnd) bezeichnet (biologische Klassifizierung). Ursprünglich in der » Pflanzenkunde « aufgebracht, fand es später auch in der Tier- und Menschenkunde zur Bestimmung des körperlichen Geschlechts seine Anwendung.

In Verbindung mit den » Entwicklungen zur Homosexualität « wurde es jedoch auch fester Bestandteil der Deklaration und Bestimmung der veranlagten sexuellen Ausrichtung des Geschlechtsverbundes, welches sich als ein durch die Ausprägung bestimmter eigenständiger Sinnestrieb, abseits des Geschlechtstriebes aufweist. Sein beides Beinhaltendes trägt es auch in sich in seiner Bezeichnung, welches man aus dem lateinischen » Sexus « (» Geschlecht « und griechischen bi (zwei) /» ambi « (zu zweien/beidem) zusammensetzte. Gegenüber der » Heterosexualität « und » Homosexualität « ist, aufgrund des » Monosexuellen « / Monosexistischen, der Umgang damit zwar dem gegenüber außergewöhnlich defizil, jedoch ist die erforderliche Differenzierung und Abgrenzung gegenüber dem Geschlechtswesen allumfassend zu einem unerläßlichen Inbetrachtziehungsgegenstand geworden.

Zur allgemeinen öffentlichen Thematik wurde die Bisexualität zuerst über die Publizität» Sigmund Freud's « Aufbringen, daß alle Menschen (körperlich) geschlechtlich bisexuell seien, dem eine völlige Ablehnung entgegen trat und aufgrund dessen auch regelrecht wieder in der Versenkung verschwand. Seine öffentliche Popularität hingegen, erlangte es in den 1950er Jahren über die » Kinsey-Reports «, welche die Relativität der sexuellen Geschlechtsvereinigungen über statistische Daten darlegten und darüber zur allgemeinen öffentlichen, primär jedoch wieder zu einem Kernpunkt der sexualwissenschaftlichen Auseinandersetzung gelangte. Kinsey stellte die Fragestellung in seinem Report zur Klärung in den Raum, was es damit auf sich hat, daß über ein Drittel offiziell bekundeten, daß sie nicht rein monosexuell orientiert seien. Hierbei blieb jedoch ein wesentliches Detail seines Aufbringens unberücksichtigt, welches sich auf das Differenzierungsverhältnis der Bisexualität gegenüber der Ambisexualität bezieht, dessen Erfordernis der Klärung dieser besonders hervor hob. Vor allem jedoch verschwand im Anschluß daran auch die eigentliche Inbetrachtziehung der Bisexualität und erwirkte das einzig noch anzutreffende Verhältnis von "Bisexualität (eigentlich Ambisexualität)", was bedeutet, daß es sich einzig um das Verhältnis der Ambisexualität handelt und nicht um Bisexualität.

In der Befassung mit der Bisexualität selbst, bedingt es somit auch der Filterung dessen, worin es sich überhaupt um ein solches Verhältniswesen dreht. Aufgrund des weitläufigen Mißverhältnisses des sprach- und sachtechnischen Umganges, führt dies vor allem dazu, daß Bisexuelle sich gerade darüber selbst gar nicht wiederfinden/identifizieren können und dessen Verhältniswesen gänzlich verklärt. Die Selbstfindung wird darüber unmöglich gemacht und so können diese aufgrund dessen auch nicht regulär in Erscheinung treten. Der gravierende Umstand/Mißstand hierin ist, daß sich zwar die Deklaration passenderweise auf das Sexualwesen und eben nicht auf das Geschlechtswesen bezieht, hingegen man jedoch einzig den Geschlechtsverbund in Betracht zieht, sodaß für den ausfüllenden Bestandteil der bisexuellen Dritten sich dies scheinbar als Widerspruch stellt, aufgrund dessen dies auch gar nicht seine erforderliche Erachtung erfährt. In Anbetracht des vollständigen Dreiecks indess, ergibt sich das entsprechende klärende Bildnis hingegen, sogar über das Geschlechtspräsenz, gemäß seiner Besonderheit darin (F↔M↔F/M↔F↔M). Es ist nicht nur das naturgemäße Erscheinungsbildnis, worüber es sich abbildet und daraus ersichtlich ist, sondern auch die Logik kann es gar nicht anders abbilden, als es sich darin verhält. Und doch erfährt es nicht seine Sichtung, worüber sich verdeutlicht, wie es sich damit stellt. Was nicht in Betracht gezogen wird, erfährt als solches auch nicht seine Sichtung - gerade hierüber zeigt es sich mustergültig auf, wie es sich bezüglich der wahrnehmenden Gegebenheiten verhält. Maßgeblicher Bestandteil hierin ist, daß für Bisexuelle einzig in einem zu-Dritt Harmonieverhältnisse entstehen und Bestand erlangen und somit sich nicht nur die begründete Ausbildung ein zu-Zweit, sondern auch die Rückbildung, sich grundlegend als disharmonische Diskrepanz stellt. Da aufgrund der miseren Situation nur bedingt Einzelne überhaupt zu einer Beständigkeit des zu-Dritt gelangen, ist die Entsprechung entsprechend klein, welche dieses Ideal überhaupt als solches widerspiegeln, sodaß dem gegenüber der Rest vielmehr in einem Verhältnis lebt, in welchem dieses Bildnis sich überhaupt nicht ergibt. Darin besteht auch bezüglich der Gaben die Besonderheit, daß sie einem zwar vermitteln, worüber es sich erfüllt, es jedoch einzig Hinweise sind, jedoch nicht die Erfüllung selbst, sodaß sich überhaupt erst über die Ausfüllung im Ideal sich das klare Bildnis über die Gegebenheit nicht nur darlegt, sondern auch überhaupt derart bestätigt.

Während sich die Klarheit des Bisexuellen, als solches, aus dessen Konstruktionswesen heraus gleichermaßen ergibt, wie für die Hetero- und Homosexualität, stellt sich dem gegenüber die Unklarheit als eine scheinbare Unklärbarkeit, für jegliches Verhältniswesen darin. Diese Unklarheit basiert indess auf dem fehlenden Bezugswesen zur substanziellen Präsenz der mentalen Veranlagung, vor allem dem wo und als was es verortet ist und der damit verbundenen fehlenden Inbetrachtziehung der Prägung, zumal der Ausgeprägtheit. Das es das Körperliche nicht aufweist, sich von dem Geschlechtswesen differenziert, jedoch damit verbunden einher geht und sich gerade das Geistige als Verwirrungswesen stellt, darüber ist man sich in sachkundigen Kreisen allgemein einig. Dem gegenüber ist man jedoch zwischenzeitlich in den Entwicklungen über das körperliche Geschlechtswesen ebenfalls zu diesem Desorientierungsverhältnis zur Männlichkeit und Weiblichkeit und dessen Unklärbarkeit gelangt. Was jedoch darin Ermessungsgegenstand geworden ist und darin besteht zumindest ein postitiver Wandel, ist die Ermessung der Prägung des Geschlechtswesens, denn wie sich darüber aufweist, handelt es sich auch darin um keine rein körperliche Präsenz.

Wahrnehmung

Die Erwirkungen der Wahrnehmung zeigen die Abläufe im Innern auf. Jegliche Wahrnehmung wird im Innern reflektiert, sodaß auch das Lichtbildnis, welches unsere Augen vermitteln, darüber seine Anreicherung erfährt und uns nicht einzig das Lichtbild vermittelt. Die physischen Sinnesreize, welche rein die Varianz der Stärke des Reizes beinhalten, erfahren zusätzlich über die Reflektion des Selbst, ein beurteilendes Harmonie- und Disharmonieverhältnis, welches sich als ausdifferenzierende Gefühle äußert. Zusätzlich zu diesen Reflektionen, reflektieren wir all dies zusätzlich noch über die geistigen Erscheinungen, worüber in Verbindung mit der erfahrenen Erinnerung, statische Bildnisse darüber in Erscheinung treten, wohingegen die Wahrnehmung als solche, ein rein fließender Vorgang ist und somit sich darüber vor allem auch das Selbstbewußtsein, über die Selbstreflektion gestaltet. Die Reflektionen begründen sich über die Veranlagung und erfahrene Erinnerung, worüber unser Selbst darüber auch prinzipiell inhaltlich in Erscheinung tritt. Darauf beruht auch die grundsätzliche Subjektivität des Menschen, aufgrund dessen kein Mensch, wie ein anderer das Sein wahrnimmt, sondern dies jeweils auf der Relation seines eigenen Seins beruht, welches sich über die Wahrnehmung, Reflektion und Handlung wiederspiegelt. Nachfolgend eine entsprechende Verbildlichung der Verlaufsvorgänge der Wahrnehmung. Man führe sich hierüber vor Augen, wie es sich stellt, gemäß dem man all dies außen vor stellt und eine reine Inbetrachtziehung der äußeren Sinne und dem Geist/Gehirn stattfindet. Es ergibt sich daraus ein Unbewußtheit über das Selbst, da die Zuordnungen der stattfindenden inneren Wirkungsmechanismen darin nicht Inhalt der Inbetrachtziehung sind und somit über die fehlenden Bildnisse, darüber auch nicht ersehen werden. Um das Inhaltliche des Selbst, welches sich in der bewußtwerdenden Wahrnehmung und auch der Handlung anteilig wiederspiegelt, als solches zu ersehen, bedingt es, daß auch die jeweiligen Wirkungsmechanismen als solche darin ihre Erachtung und Sichtung erfahren.

Die Aufbereitung der ausführlichen Darlegung
der substanziellen Gegebenheiten,
findet parallel hierzu, auf einer separaten Seite statt:

» Die Anatomie der mentalen Organe «

Divider

Kinsey-Reports

Divider


W. B. Saunders Company
» «
Professor of Zoology, India University

S. 641: Individuals who are rated 3's stand midway on the heterosexual-homosexual scale. They are about equally homosexual and heterosexual in their overt experience and/or their psychic reactions. In general, they accept and equally enjoy both types of contacts, and have no strong preferences for one or the other. Some persons are rated 3's, even though they may have a larger amount of experience of one sort, because they respond psychically to partners of both sexes, and it is only a matter of circumstance that brings them into more frequent contact with one of the sexes. Such a situation is not unusual among single males, for male contacts are often more available to them than female contacts. Married males, on the other hand, find it simpler to secure a sexual outlet through intercourse with their wives, even though some of them may be as interested in males as they are in females.

S. 656: Since only 50 per cent of the population is exclusively heterosexual throughout its adult life, and since only 4 per cent of the population is exclusively homosexual throughout its life, it appears that nearly half (46%) of the population engages in both heterosexual and homosexual activities, or reacts to persons of both sexes, in the course of their adult lives. The term bisexual has been applied to at least some portion of this group. Unfortunately, the term as it has been used has never been strictly delimited, and consequently it is impossible to know whether it refers to all individuals who rate anything from 1 to 5, or whether it is being limited to some smaller number of categories, perhaps centering around group 3. If the latter is intended, it should be emphasized that the 1's, 2's, 4's, and 5's have not yet been accounted for, and they constitute a considerable portion of the population.

In any event, such a scheme provides only a three-point scale (heterosexual, bisexual, and homosexual), and such a limited scale does not adequately describe the continuum which is the reality in nature. A sevenpoint scale comes nearer to showing the many gradations that actually exist.

As previously pointed out, it is rather unfortunate that the word bisexual should have been chosen to describe this intermediate group. The term is used as a substantive, designating individuals-persons; and the root mean typical female in the population. Where a single individual combines in its one person the primary sex characters of two sexes (namely, the ovaries and the testes), it is recognized as a hermaphrodite. Where the secondary sexual characters of an individual are in part the unmodified characters of one sex, and in part the characters of the other sex, the individual is known as a gynandromorph.

» Kinsey-Report Skala « https://commons.wikimedia.org/wiki/File:Kinsey-Report_Scale.svg
Kinsey's Beschreibung legt mit diesen Worten die Präsenz und das Differenzierungsverhältnis des Bisexuellen in seiner spezifischen Bezugnahme der 3er gegenüber der Separierung der 1,2,4,5er dar. Er führt dem gegenüber aus, der Begriff sei nie 'streng abgegrenzt' worden und daß es unmöglich sei, zu wissen, ob dies sich auf alle Personen von 1 bis 5 beziehe, oder nur auf Diejenigen, welche der mittleren, die 3er Gruppe Umgebenden angehören. Insofern dies beabsichtigt sei, sollte hervorgehoben werden, daß die 1,2,4,5er bisher darin nicht berücksichtigt seien und diese einen beträchlichen Anteil der Bevölkerung ausmachen. Darüber hinaus hebt dieser hervor, daß die 3er-Kategorisierung von heterosexuell, bisexuell und homosexuell nicht ausreichend sei, um den Umfang der realen Natur darüber wiederzugeben. Wie sich in Verbindung mit den nachfolgenden Absätzen aufweist, verfügt dieser über keinerlei Kenntnisse zur Spezifikation der Ambisexualität, obwohl dieser ausgebildeter Zoologe/Biologe ist und darin grundsätzlich die Bisexualität im Verbund mit der Ambisexualität die Grundlage bildet. In seinem Bericht ist diese Deklaration in keiner Weise anzutreffen. Sein Hinweis, daß die Deklarierung der Bisexualität unpassend sei und die Begründung, legt dar, daß diesem die Bedeutung von Bisexualität gleich gesetzt ist mit dem des Hermaphroditismus. Trotz dieses sprach- und sachtechnischen Fehlstandes, ersieht dieser jedoch die maßgebliche Erfordernis der Ausdifferenzierung des Bisexuellen gegenüber dem Ambisexuellen. Nebenan die im Umlauf befindliche Kinsey-Skala, spezifiziert gemäß seines Aufweisens der aspektierenden Differenzierungen.

Über nachfolgende Inhaltlichkeit Haeberle's Aufbringen, zeigt sich mustergültig die in der Sexualwissenschaft bestehende sprachtechnische Verfangenheit. Kinsey's Aufbringen zeigte seine Wirkung darin. Erachtungsgegenstand sind hierin jedoch, wie dies verdeutlicht, einzig die abweichenden Varianzen (Ambivalenzen) gegenüber den monosexuellen Konstanten der Hetero- und Homosexualität, sodaß sich generell die Inbetrachtziehung der Variante einer Konstanten (der Bisexualität) 'darin' als mißverhältlich stellt. Gemäß dem erachtet man es als Erfordernis, alles miteinander einzig als Ambisexuelles zu kennzeichnen, um zu einer Eindeutigkeit darin zu gelangen.

» Bisexualitäten (1994)«
Bisexualität aus biologischer Sicht
Ideologie und Praxis des Sexualkontaktes mit beiden Geschlechtern
Gustav Fischer Verlag / Archiv für Sexualwissenschaft
» E. J. Haeberle « und » R. Gindorf «

Verhaltensweisen zwischen 1 und 5 wurden von Kinsey und seinen Mitarbeitern als ambisexuell bezeichnet. Die meisten Befragten waren ausschließlich oder vorherrschend heterosexuell oder homosexuell aktiv über Jahre und Jahrzehnte; lebenslanges bisexuelles Verhalten wurde nur von einer Minderheit praktiziert. ... Noch zweideutiger ist der Status und die Etikettierung derjenigen, die sich ambisexuell verhalten. Menschen, die zu beiden Geschlechtern sexuelle Beziehungen oder entsprechende Phantasien haben, betrachten sich selbst oft als heterosexuell oder homosexuell, nicht als beides oder als bi. ... Als der Begriff bisexuell sich allgemein durchzusetzen begann und die Natur der Bisexualität stärker erforscht wurde, etablierten verschiedene Forscher ihre eigenen Definitionen. Während Kinsey et al. (1948, 1953) diejenigen als ambisexuell betrachteten, die zwischen K = 1 bis K = 5 rangierten, sahen Weinberg und Williams (1974, 1975) und Bell und Weinberg (1978) sowie Green (1987) die als ambisexuell an, deren Verhaltensweisen und Phantasien bei Durchschnittswerten zwischen K = 2 und K = 4 lagen. Haeberle (1978) stufte Heterosexuelle bei K = 0-2, Homosexuelle bei K = 4-6 und Ambisexuelle bei K = 2-5 ein. All diese Forscher schlugen sich mit der Realität herum, daß der Begriff oft ebensoviel, wenn nicht mehr, verschleiert wie enthüllt. Es ist äußerst selten, daß jemand ein erotisches Leben mit einer Person führt oder erträumt, die er nicht sexuell erregend findet, dennoch kann es zu gelegentlichen oder selbst längeren «Einbrüchen» kommen. Die Notwendigkeit könnte solche Verhaltensweisen erzwingen. Blumstein und Schwartz (1972) schreiben:

Bisexualität ... führt zu dem Mißverständnis einer Fixiertheit in der sexuellen Objektwahl ... der bessere Begriff (ist) Ambisexualität, mit dem Bedeutungsgehalt der Fähigkeit eines Menschen, unter bestimmten Umständen beide Geschlechter erotisieren zu können.»"

Klarheit erfährt dies noch einmal zusätzlich über Haeberle's Buch, dem gegenüber die Markantz in Betracht zu ziehen ist, daß dieser sich einzig auf 'seine' sexualwissenschaftlichen Kontaktverhältnisse bezieht. Tatsächlich ist nämlich selbst in der Sexualwissenschaft die Ambisexualität weitläufig unbekannt, was man den Ausführungen der Schriftwerke entnehmen kann. Und in der Allgemeinheit ist dieser Begriff gänzlich unbekannt. Jedoch bringt dieser eine sachkundige Erläuterung zu 'dieser' Unterscheidung auf und bildet darüber auch die Grundlage dessen, was man allgegenwärtig in lexikalischen und enzyklopädischen Werken antrifft, über die Ausführung von "Bisexualität (eigentlich Ambisexualität), was darüber auch allseits zur allgemeinen Übertragung und Nachahmung gelangte. Jedoch hat sich nicht übertragen, was es damit auf sich hat. Sämtliche nachahmenden Anwendungen beziehen sich einzig darauf, daß es sich anders nennt, jedoch trifft man nirgends auf eine Beschreibung, worauf dies beruht, noch eine Erläuterung der Unterscheidung. So entstand zwangsläufig daraus auch die Gegebenheit des Wortes ohne Bedeutung, dem man jegliche Ambivalenz zuschreibt.


Handbuch und Atlas
Verlag: Walter de Gruyter
Deutsche Übersetzung der Originalausgabe:
The Sex Atlas, The Seabury Press, New York, 1978
Autor:

Wenn wir uns also von der allgemeinen Diskussion nicht ausschließen wollen, müssen wir uns für das vorliegende Buch zu einem Kompromiss entschließen. Denn diese Sprachgewohnheiten haben, so unpräzise sie auch sein mögen, doch einige Vorteile. Sie können dazu beitragen, bestimmte Auseinandersetzungen zu vereinfachen und dringende soziale Probleme zu artikulieren. Mit anderen Worten: solange ihr willkürlicher Charakter verstanden wird, kann die traditionelle Terminologie einige nützliche Zwecke erfüllen.

In diesem Sinn wird vorgeschlagen:

Es fällt auf, dass sich die dritte Definition mit den beiden anderen teilweise überschneidet. Das heißt, dass die Bezeichnung "ambisexuell" (von lat. ambo; beide) sich auf "Heterosexuelle" und auf "Homosexuelle" beziehen kann. Dieser Widerspruch ist unvermeidlich, es sei denn, man wollte nur solche Personen als ambisexuell bezeichnen, deren erotisches Interesse zu gleichen Teilen auf beide Geschlechter gerichtet ist (Kategorie 3). Dieser Wortgebrauch hat sich jedoch nirgends durchgesetzt. Einige Personen können also in dem einen Zusammenhang als "heterosexuell" (oder "homosexuell" und in einem anderen als "ambisexuell" bezeichnet werden.

Eine spezifizierende Darlegung des Anwendungswesens erfährt man über die Enzyklopädie Human Sexuality. Hierüber erhält man auch die Beschreibung über die anwendende Verdrehung der Gegebenheiten, die auf der unspezifizierten Anwendung der Differenzierung der Ambisexualität gegenüber der Bisexualität beruht. Hierin wird die Empfehlung ausgesprochen, das (ambivalente) 'Kontinuum' des Ambisexuellen als solches in Betracht zu ziehen und von dem des Bisexuellen, dem Verhältnis der Entsprechung des Ebenbürtigen zu zwei Geschlechtern, gemäß der Kinsey-3er, seine entsprechende Inbetrachziehung zu verschaffen.


Verlag: Garland Publishing, Inc.
Artikel: Ambisexuality (S. 26)
Autor:

The term "ambisexuality" was first published by Masters and Johnson in 1979 to describe men and women who had frequent sexual interaction with members of both sexes but who reported absolutely no preference for the gender of the partner. Sexual interaction was viewed as simply a matter of sexual release. They defined the term as "a man or woman who unreservedly enjoys, solicits, or responds to overt sexual opportunity with equal ease and interest regardless of the sex of the partners, and who, as a sexually mature individual, has never evidenced interest in a continuing relationship".

The terms ambisexual and bisexual are used to describe the relationship between heterosexuality and homosexuality. Alfred Kinsey produced a scale that classifies human psychosexual and behavioral response into seven categories ranging from exclusively heterosexual (the Kinsey 0) to exclusively homosexual (the Kinsey 6). The numbers 1 through 5 represent a ratio between homosexual and heterosexual behavior.

The criteria established by Masters and Johnson for the identification of an ambisexual are "(1) that the individual express no preference in terms of sexual partner selection either through personal history or by subjective description, (2) that he or she [is] currently living an uncommitted ambisexual lifestyle and [has] never as an adult evidenced any interest in a continuing relationship, and (3) that the man or woman could be rated close to Kinsey 3 in sexual preference" (this would be the midpoint on the scale). Fantasy patterns were not considered a part of the definition.

After a national search of about eight months in 1968, only six men and six women were found who fit the criteria. They said that their sexual preference was "that of the partner of the moment". These numbers are too small to allow generalizations about ambisexuality.

The term "ambisexuality" is often equated with the term "bisexuality," a designation that has been used in many ways that have very little precise meaning. The true bisexual is equally attracted to both sexes (i.e., a Kinsey 3). This definition incorporates the criteria for ambisexuality. However, in widely accepted use of the term, those classified as Kinsey 1 through 5 could also be identified (or identify themselves) as bisexual with a preference for homosexual behavior (Kinsey 4 and 5) or for heterosexual behavior (Kinsey l and 2).

The original Kinsey sale was established using sexual behavior as the sole criterion. Complicating factors (e.g., love, sexual attraction, fantasy, and self-identification) have only recently been used to enhance it. Using the old scale, it seems easy to determine the exclusive heterosexual (Kinsey 0) or the exclusive homosexual (Kinsey 6); however, when the fantasies of these persons are considered, their orientation may not be so exclusive. The categories between the two extremes represent a continuum, especially when the additional elements are considered, and they have received little research attention. It does seem, however, that when all of the factors are considered, an individual's rating may change over time. That is, the individual may be a Kinsey 2 at one time and a Kinsey 5 at another; the rating should not be viewed as being fixed, describing all behaviors, or predicting fixture behavior.

Given the ambiguities of the Kinsey 1 through 5 definitions, perhaps ambisexuality rather than bisexuality is the better term to use. Ambisexuality would recognize the continuum and be defined as "the ability for a person to eroticise both genders under some circumstances", since equal attraction to males and females is virtually nonexistent. The term "bisexuality" could then be used to describe the Kinsey 3s.

Wie sich hierüber mustergültig aufweist, so hat sich in der Sexualwissenschaft eine Variante der sprachtechnischen Anwendung etabliert, welche die Gegebenheiten gänzlich verklären. Hierauf basiert das, was man allgemeingültig als "Bisexualität (eigentlich Ambisexualität)" antrifft. Tatsächlich handelt es sich jedoch um weder noch, denn das Händling in der Sexualwissenschaft bezieht sich auf Ambivalenzen hetero- und homosexueller Verhältnisse und hat somit gar nichts mit dem deklarierenden Verhältnis der Eigenständigkeit einer davon sich unterscheidenden Veranlagung zu tun. Gravierend hierin ist, daß es sich bei der Ambisexualität tatsächlich um das Verhältnis der Ambivalenz handelt und beruht auf der graduellen Präsenz und Wirkungsintensität der Ausgeprägtheit. Die Ausgeprägtheit ist jedoch nirgends Bestandteil der Inbetrachtziehung. Vielmehr befindet man sich durchweg in der Infragestellung, worauf die antreffenden Ambivalenzen des Hetero- und Homosexuellen beruhen. Entscheidend ist hierin die Graduierung, sodaß sich ab einem gewissen Grad der Unausgeprägtheit, das Verhältnis einer sich eigenständig stellenden Ambisexualität ergibt, indess es sich ansonsten um eine Ambivalenz der jeweiligen anderen Veranlagungen handelt. Die Unterscheidung von ambivalent und ambisexuell ist somit auch maßgeblich. Nachfolgend das Sprachverhältnis, welches man in der Sexualwissenschaft anwendet und alles damit Verbundene durcheinander bringt, da man sich nicht auf die tatsächliche Inbetrachtziehung reiner Ambivalenzen bezieht und die Ambisexualität und Bisexualität davon abgrenzt.

Inbetrachtziehung Geschlechtspräsenz Anwendungsweise
Heterosexualität konstant Heterosexualität
Ambisexualität
(eigentlich Heterosexualität)
ambivalent Bisexualität
(eigentlich Ambisexualität)
Bisexualität
Ambisexualität
(eigentlich Homosexualität)
ambivalent
Homosexualität konstant Homosexualität

Wie die nachfolgenden Worte, veröffentlicht über das » glbtq Encyclopedia Project « beschreiben, so finden in den Ergründungen der Sexualität fast ausschießlich homosexuelle Inbetrachtziehungen statt, worin es sich um das Erkennen der eigenen gleichgeschlechtlichen sexuellen Anziehung dreht, das Finden anderer homosexueller Personen, die Selbstakzeptanz, Bestandteil dieser Gemeinschaft zu werden und letztendlich die Sexualität Bestandteil seiner eigenen sexuellen Identität werden zu lassen. Zwar mögen auch Bisexuelle manche dieser Erfahrungen machen, jedoch sind sie nur geringfügig beteiligt an der Entwicklung von Theorien sexueller Identität. Einige Modelle haben die Bisexualität zwar erwähnt, jedoch einzig im Kontext vorbeugender Regulierung positiver homosexueller Identität.

Einige Forscher haben speziell die Entwicklung der bisexuellen Identität berücksichtigt. Basierend auf den Studien von bisexuellen Frauen und Männern in San Francisco in den 1980er Jahren, entwarfen Martin Weinberg, Colin Williams, and Douglas Pryor ein vier-Stufen-Modell für den coming-out-Prozeß für Bisexuelle: initiierendes Durcheinander, Findung und Anwendung einer Bezeichnung, Festlegung einer Identität und fortsetzende Unsicherheit. Diese letzte Stufe, welche sie als einheitlich ersahen, bezüglich der Erlebnisse von vielen Bisexuellen, resultiert aus dem relativen Mangel bisexueller Gemeinschaft für eine soziale Bestätigung und der hartnäckige Druck, welchen Bisexuelle erfahren von Teilen der homosexuellen Gemeinschaft, sich als homosexuell zu identifizieren.

Andere Theoretiker haben die Ermessung eines linearen Stufenmodells abgelehnt. Paula Rodríguez Rust, eine der führenden Forscher/innen in Bisexualität argumentiert, daß der Prozeß des coming outs aus multiplen Dimensionen geformt sei, nicht nur die sexuelle Attraktion und das Verhalten beinhaltend, sondern auch politische Verpflichtungen, Emotionen und die Gemeinschaftsbeteiligung. Im Studieren selbstidentifizierender bisexueller Frauen und Lesben, hat Rust herausgefunden, daß die Mehrheit beider Gruppen beteiligt waren in andere Geschlechtsbeziehungen und angezogen waren zu beiden, Frauen und Männern, jedoch ihre Erfahrungen in unterschiedlichen Varianten interpretierten und bezeichneten, die oft auch widersprüchlich waren.

» Bisexuality (2004) «
glbtq archive
Brett Genny Beemyn

Like most research on sexuality, models of lesbian and gay identity development have often ignored or dismissed bisexuality. These models characterize the coming out process as a movement that typically involves recognizing one's same-sex attraction, finding other lesbians and gay men, accepting oneself, becoming immersed in the lesbian and gay community, and finally, integrating sexuality into one's selfidentity. While bisexuals may share some of these experiences, they are rarely included in theories of sexual identity development. A number of models do mention bisexuality, but only in the context of forestalling the formation of a positive lesbian or gay identity.

Few researchers have specifically considered bisexual identity development. Based on studies of bisexual women and men in San Francisco in the 1980s, Martin Weinberg, Colin Williams, and Douglas Pryor devised a four-stage model to describe the coming out process for bisexuals: initial confusion, finding and applying the label, settling into the identity, and continued uncertainty. This last stage, which they saw as unique to the experiences of many bisexuals, resulted from the relative lack of a bisexual community for social validation and the persistent pressure bisexuals receive from parts of the lesbian and gay community to identify as lesbian or gay instead.

Other theorists have rejected the appropriateness of linear stage models. Paula Rodríguez Rust, one of the foremost researchers on bisexuality, argues that the process of coming out is shaped by multiple dimensions, including not only sexual attraction and behavior, but also political commitments, emotionalities, and community involvement. In studying self-identified bisexual women and lesbians, Rust found that the majority of both groups had been involved in other-sex relationships and were attracted to both women and men, but interpreted and labeled their experiences in different and often conflicting ways.

Diese Darlegungen heben hervor, daß das Identitätswesen der Bisexuellen grundsätzlich gestört ist, aufgrund des allgemeinen unkenntlichen Präsenzwesens und sich Bisexuelles darin nur ansatzweise begründen, jedoch nicht entfalten kann. Es verdeutlicht die bedingende Erfordernis des Reflektionswesens, woraus das Miteinander sich fundiert. Insofern die Bisexualität nicht als vorausgehendes Abbildnis in Erscheinung tritt, ergibt sich daraus einzig Fragwürdigkeiten und verklärt von Grund auf die Gegebenheiten. Es zeigt auf, daß diese Gegebenheit des Menschen Selbst von Grund auf in Frage stellt, gegenüber den sich darbietenden Regularien des Seins. Das Geistwesen und das Sinneswesen treten hierin aufgrund dessen in Konkurrenz gegeneinander an, worin das jeweilige Ermessungswesen darüber bestimmt, welches das Geleitwerk bestimmt. Und selbst, wenn in den Inbetrachtziehungen einzig die Äußerlichkeiten ihre Aufmerksamkteit erfahren, gelangt darüber das Sinneswesen keineswegs ins Abseits, sondern im Gegenteil, wie es die Beschreibungen der kontrahierenden Gegebenheiten der Worte darlegen. Es verhindert nicht das Sein, jedoch die Erfüllung und gerade darüber entfaltet sich aus diesem Leid der Unerfülltheit die Leidenschaft, welche jedoch verkümmert, insofern es nicht als solches seine regulierende Inbetrachtziehung erfährt. Gerade darin besteht die Besonderheit dieser mentalen Veranlagung, daß es die Erfüllung in sich beinhaltet, es sich daraus selbst jedoch nicht ausfüllt, sondern der Ausfüllung durch das Miteinander bedingt. Und so kann sich auch die darauf fußende Leidenschaft nicht umsetzen, insofern die Kenntlichkeit nicht als solche in Erscheinung tritt. Um sich darin zu finden, bedingt es, einander darin erkenntlich zu zeigen. Und gerade darin besteht die sich aufweisende eigentliche Behinderung, die es zu überbewältigen gilt. Die Sprache bildet hierin den eigentlichen Mißstand und somit bedingt es auch der erforderlichen Aufklärung darüber.

Divider

Der Sexualitätsbegriff

Divider

Die Entstehung des Sexualbegriffes - passender ausgedrückt: des Wortes, denn die geschaffene Definition erfuhr gar nicht ihre umsetzende Bezugnahme, wie nachfolgend dargelegt, findet über die aufkeimenden botanischen Wissenschaften statt und überträgt sich von dort aus auf die gesamte Biologie und das Allgemeinwesen. Aufgrund des Spezifischen seines Ursprunges und den verwickelten Entwicklungen des Bedeutungsinhaltes, bedingt es des Auseinanderhaltens von Wort (abseits seiner Definition als Begrifflichkeit) und Sache, denn sowohl als auch, basieren hierin auf ihrer ganz spezifischen Besonderheit, die es zu verdeutlichen gilt. Maßgeblich ist, daß man sich diesbezüglich in der Botanik noch in einem relativen Niemandsland befand. Man hatte bis zu dem Zeitpunkt zwar Kenntnisse über die stattfindende Vermehrung über den Samen, jedoch wurde es zu jener Zeit überhaupt erst zum Gegenstand der Inbetrachtziehung, wie es sich generell mit dieser Art der Vermehrung verhält - wie es zu dem Samen kommt, war bis dato unbekannt. Dieser Wandel von der reinen Inbetrachtziehung der Vermehrung, hin zum Zusätzlichen der Fortpflanzung, ist somit auch des Wesens Kern, welcher sich hierin vollzieht. Ausschlaggebend wurde das aufbringende Erkennen, daß es zur Entwicklung von Pflanzensamen des hinzufügens von Pollen bedingt - der Befruchtung, ohne das sich Samen nicht entwickeln. Man erkannte hierüber, daß es sich auch bei Pflanzen, um eine Teilung von Männlichem und Weiblichem und der Fortpflanzung, gemäß der Tier- und Menschenwelt verhält. Ausschlaggebend wurden die spezifischen Ergründungen der Befruchtungsvorgänge, was über Camerarius und dessen beschreibenden Erfahrungen seine erstliche populäre Aufmerksamkeit erlangte. Man hatte zwar zuvor Derartiges bezüglich des Bestäubens vereinzelt kennengelernt, jedoch existierte kein allgemeingültige Präsenz an Kenntnissen darüber, zumal die geschlechtliche Teilung als solche darin nicht Inbetrachtziehungsgegenstand war. Was das Männliche und Weibliche überhaupt repräsentiert, erfolgte aufgrund der gänzlichen Unkenntlichkeit dessen somit hierin auch in umgekehrter Weise, was darauf basierte, daß der Sachverhalt von Fortpflanzungsorganen darin zunächst gar nicht nachvollziehbar war, sodaß zunächst die Fortpflanzung ihre Ergründung erfuhr und erst im späteren Verlauf, in Verbindung mit der Erfindung von Vergrößerungsgläsern, eine immer weiter detaillierende Beschäftigung der Fortpflanzungsorgane stattfand.

Das Prädestinierende der Gegebenheiten zeigt sich über ein Gemälde, welches man » Primavera « nennt und » Sandro Botticelli « zuschreibt. Es zeigt das geballte Zusammenwirken dessen, was durch den eintretenden Frühling in der Natürlichkeit des Seins in Kraft tritt - der hervortretende Trieb zur (sexuellen) Vermehrung, wie wir es auch mustergültig in dessen Ankündigung über die Schneeglöckchen erfahren. Hierin erfahren indess die Kenntnis- und Vorstellungswelt der griechischen, römischen, wie auch derzeitigen gegenwärtigen Präsenz, als Patchwork miteinander vereint, ihre Abbildung - und markanterweise gleichzeitig auch das sexuelle Unterscheidungswesen der Pflanzen, Tiere und Menschen. Es handelt sich um ein Abbildungswesen, welches man auf sprachtechnischer Ebene, in seiner Perfektion nicht zu überbieten, in der Enzyklopädie von » Isidor von Sevilla « antrifft. Für sowohl als auch zeigt sich, daß man es nicht zu übersetzen weiß, was der Selbstverständlichkeit unterliegt, daß es gar nicht möglich ist, es zu 'übersetzen', da unsere Sprache nicht über die substanziellen Bestandteile verfügt. Die jeweilige Sprache ist mit der kulturellen Gegebenheit verknüpft, ohne dessen nachvollziehenden Verständnis die Sprache nicht den Sinn vermitteln kann - es bedingt dessen Bezugswesen, um es zu darüber zu entfalten. Ihre Kodierung repräsentiert, wie auch die Bildnisse, einzig einen Hinweis auf das Jeweilige, nicht jedoch den verweisenden Inhalt selbst. In dem gegebenen Bezug bedingt es somit aber auch zunächst einmal der Kenntnis und dem Verständnis darüber, daß die lateinische Sprache und Ideologien - so auch die Mythen - substanziell von den Griechen übernommen wurden. Ihre Wurzeln sind griechisch, jedoch mit einem römischen 'Touch' versehen. Das sowohl als auch - gemäß Isidors Anwendung der Darlegung von griechischer und römischer Sprache, Ideologie und dem repräsentierenden Sein selbst - derart verwoben hierin seine Darlegung erfährt, erschließt sich nicht erst über das Gesamtbild, sondern auch über die Details. Um es sich zu erschließen, bedingt es jedoch der Handhabe gemäß eines Zauberwürfels, denn bereits die anwendende Bezugnahme zur Venus führt in die Irre.

So trägt jedoch auch der Hermes der Römer Merkur zwar dessen Schuhe und den Helm, jedoch haben diese keine Flügel, was vor allem auch auf den Zeitverlauf verweist, denn in seiner Jugend verfügte dieser über seine ausstaffierenden Insignien noch nicht, in seinen römischen Verhältnissen wurde er als Merkur seines inhaltlichen Präsenzwesens beschnitten, wohingegen dieser in der Gegenwart des Verbundes mit der Alchemie, einzig dem einen Nutzen bringt, wer diesen wirklich versteht - prädestinierend somit auch für das Gesamtbildnis. Noch gravierender verdeutlicht es sich jedoch über die personelle Trennung von Chloris und Flora und gerade darin steckt auch der Kern zur Erschließung des Ganzen und begründet die Verbindung des Ursprunges von Hermaphroditos und Aphroditos mit der Gegenwart, dessen Unterscheidung man zwischenzeitlich nämlich gar nicht mehr achtete, sondern einzig den Hermaphroditen, der beides sei - wie es auch Chloris und Flora derart erging. Der Penis der Chloris ist nur im kleinen Bildnis oder aus der Ferne aus der Gewandsformung heraus als solcher ersichtlich - wie im regulären Erscheinungsbild, ersieht man es an sich nicht im Äußeren, hingegen ist herausragend im Detail, die starke androgyne Erscheinung von schwangeren Flora dargestellt, gemäß der regulären äußeren Ersichtlichkeit. Gerade auf der Binärität (0-0/0-1/1-1/1-0!), die sich hierin in herausragender Weise repräsentiert und des Menschen Verdrehtheiten zum Verhältniswesen des Daseins bewirkt, erfährt gerade in diesem Einheitsbezug von Tier- Pfanzen- und Menschenwesen zu jener Zeit, seinen absoluten Höhepunkt der einigenden Gegenüberstellung, dessen Auseinandersetzung sich indess bis heute fortsetzt. Dem gegenüber klärt es sich jedoch gerade über die Evolution auf, daß es sich um ein Verhältniswesen gemäß Rechts und Links handelt, wie es in seinem Ursprung auch seine Erachtung fand. So fand jedoch gerade in der Renaissance das Wesentliche statt, nämlich auch die Entwicklungswesen der menschlichen Kenntnisse, gleichermaßen in ihrem evolutionären Hier und Jetzt zu fassen, um daraus zu schöpfen. REnaissance bedeutete nicht nur Wiedergeburt, sondern eine fortstetzende Wiederbelebung des griechischen Erstrebungswesens, welches man jedoch im Verlaufe wieder dem unterwarf, was sich bereits zuvor etablierte und man gegen diese Umfang ganz einfach nicht ankam.

Zur Erfassung einer endgültigen Beschreibung, zunächst einmal die bestandeilsmäßigen Fragmente. Im Gegensatz zur Anwendung, worin man die Ursprünge dem Bildinhalt zuzuordnen 'verordnet', gilt es hingegen, aus dem Bildnis heraus die Ursprünge zu ersehen. Hierzu auch einmal ein Wesentliches: der rechte Teil, mit Chloris und Zephyr, wurde anschließend dem Bildnis zugefügt, wie man über die Restaurierung heraus fand. Gerade dies ist wesentlich und gerade dies nämlich auch die eigentliche 'Eigenintension' des Botticelli, worüber jedoch überhaupt sich erst das Kernwesen des 'geänderten' Bildnisses darlegt - den Ursprung nämlich mit der Gegenwart vereint. So ist aber auch die sogenannte 'Geburt der Venus' erst später entstanden und die beiden Bildnisse stehen keineswegs im Verbund miteinander - im Gegenteil.

» Primavera (Frühling) «

Primavera (Frühling)

» Fotografisches Archiv «

» Geburt der Venus «

Geburt_der_Venus.jpg

Divider


commonly called Sandro Botticelli, painter of Florence
Neuauflage: Princeton University Press
» () «

Sandro Botticelli and the Florentine Renaissance ()
- » Volume 2 « - » Volume 3 «
Publisher: The Medici Society
» «


mit 91 Abbildungen nach Gemälden und Zeichnungen
Verlag: Velhagen & Klasing


eine Untersuchung über die Vorstellungen von der Antike
in der italienischen Frührenaissance

Verlag: Leopold Voss
» «

Die Erneuerung der heidnischen Antike (1932)
Kulturwissenschaftliche Beiträge
zur Geschichte der europäischen Renaissance

Aby Warburg - Gesammelte Schriften: » Band I « - » Band II «
Verlag: B.G. Teubner
» Reprint: SEVERUS Verlag () «
» «


Verlag: Jstor
» «

But though Guarini was apparently the first man to translate and to bring back from the East Lucian's Calumny, and therefore the most important of the early humanists in connection with our particular study, he was by no means the only humanist who made literary use of Lucian's Dialogue.

» Renaissance (2000) «
Metzler Lexikon Religion
Verlag: J.B. Metzler
A. Imhof

Politisch ist die Renaissance vor allem durch ein Erstarken der italienischen Stadtstaaten unter Söldnerführern (condottieri) und den Niedergang der päpstlichen Autorität gekennzeichnet: Staatsphilosophien wie die von Niccolo Machiavelli (Il Principe, 'Der Fürst', veröffentlicht 1532) thematisieren ein neues Bild vom Herrscher jenseits der religiösen Legitimierung von Macht. Sie, wie auch das von Baldassare Castiglione entworfene Bild des 'Hofmannes' (Illibro del Cortegiano, 1528), sind der politisch-philosophische Ausdruck der zunehmenden Bedeutung des Individuums und der Erkundung seiner eigenen Fähigkeiten und seines Genies (ital. ingegno). Sie verweisen zudem auf das Bemühen, trotz der aufkommenden Zweifel an der persönlichen Unsterblichkeit der Seele, wie sie der christliche Glaube vorsah, durch weltlichen Ruhm eine Art von Dauer zu erreichen und, wenn nicht im Paradies, so doch in der Geschichte weiterzuleben. In diesem Zusammenhang ist der starke Aufschwung der bildenden Künste, etwa des Porträts, in der Renaissance zu verstehen, der bisweilen bis hin zur Bildmagie führt: Nach dem Attentat der Pazzi auf die Medici 1478 im Dom von Florenz wurden die flüchtigen Verschwörer als Gehenkte abgebildet. Sandro Botticelli stellt in seiner Adorazione dei tre Magi Mitglieder der Medici-Familie im Gefolge der drei Weisen dar; sogar er selbst ist zu sehen. Gleichzeitig sind die Künstler an einer idealen Formbildung interessiert. Die Wirklichkeit soll nicht nur abgebildet, sondern 'erhöht' werden. Im gleichen Maße wie die Literatur die Schönheit euphorisch beschreibt, ist auch die Malerei und Bildhauerei bestrebt, Schönheit in Idealform darzustellen. Die Frauengestalten Sandro Botticellis, etwa seine Venus, sind charakteristisch für dieses Ideal, das auf die zunehmende Popularität des Platonismus zurückgeht. Der 'ideale Stil' (ital. buona maniera moderna, 'der gute neue Stil') soll die Antike nicht imitieren, sondern wenn möglich übertreffen. Der Kult der Schönheit und die Begeisterung für die allegorische Darstellung, wobei antike Gottheiten ideale Prinzipien personifizieren, etwa: Venus/Aphrodite für die Schönheit, mündet schließlich im » Manierismus « des 16. Jahrhunderts.


Verlag/Reprint: Harvard University Press
» «

Divider

Zeitgeschehen

» Lorenzo il Magnifico (1449-1492) «
» Clarice Orsini (1453-1488) «
» Giovanni Pico della Mirandola (1463-1494) «
» Marsilio Ficino (1433-1499) « - » Platon's Symposion (Druck: 1484) « - » Plato's Phaidros «
» Angelo Poliziano «
» Leonardo Bruni «
» Hesiod (vor 700 v. Chr.) «
» Lukian von Samosata (120/180)) «

Divider

griechisch   römisch
» Aphrodite «
» Aphrodite Urania (Hesiod Theogonie 187ff) «
» Aphrodite Pandemos (Homer u.a. Ilias 5,370ff) «
» Venus «
Venus Coelestis (Aphrodite Ourania), Venus Vulgaris/Genitrix (Aphrodite Pandemos)
  Amor
Amor Divinus, Amor Vulgaris, Amor Ferinus
 
» Hermes «   » Merkur(ius) «
Chloris   Flora
     

Hesiods Theogonie (1978)
Verlag: Richarz
» Karl Albert «


Inzest in Literatur und Film der Gegenwart
Verlag: Böhlau

» S. 169 « Am Anfang gebahr, von Eros geschwängert, ...

Nachfolgend die lateinische Schrift des Camerarius und dessen deutsche Übersetzung von Möbius, worüber sich die einstige Gegebenheit in seinen Details zeigt. Die Sexualität, in dessen Bezug es später von Sachs seine Beschreibung erfährt, ist hierin noch in keiner Weise Bestandteil der Inbetrachtziehung. Hierzu gilt es zu bedenken, daß bei den Pflanzen, gegenüber den Lebewesen, überhaupt keine 'geschlechtliche Vereinigung' stattfindet, sodaß man darin zunächst rein die Befruchtung der Samen in Betracht zog. Darüber alleine bildete sich auch zunächst das Bildnis über die bedingende Zusammenkunft zweier voneinander unterscheidender Präsenzen, gemäß des Männlichen und Weiblichen. Die Sichtung ist dem gemäß hierin auch rein auf das gerichtet, was sich darüber als Ersichtliches aufweist und so erfährt man mustergültig über Camerarius auch den zu der Zeit bestehenden Kenntnisstand 'in Annäherung' des Nachvollzuges. Gravierend ist somit, dem gegenüber, daß man in späteren Darstellungen, wie nachfolgend über Sachs dargestellt, sprach-, wie sachtechnische Bezugnahmen darlegt, die jedoch darin noch gar nicht bestanden, so auch weder der von diesem angewandte Begriffs- und Sachbezug zur Sexualität.

https://commons.wikimedia.org/wiki/File:Rudolf_Jacob_Camerarius._Line_engraving_by_J._C._Dehne._Wellcome_V0000975.jpg
Line engraving by J. C. Dehne


» «


Übersetzung und Anmerkungen von
De sexu plantarum epistola

Verlag: Wilhelm Engelmann
» «


vom 16. Jahrhundert bis 1860
Verlag: R. Oldenburg
» «

S. 418: Das Hauptwerk des Camerarius über die Sexualität der Pflanzen ist seine vielgenannte, aber wie es scheint, von sehr Wenigen gelesene De sexu plantarum expistola, die er am 25. August 1694 an Valentin Professer in Gießen richtete. Dieser Brief ist das Umfangreichste, was bis dahin und selbst bis in die Mitte des vorigen Jahrhunderts über die Sexualität der Pflanzen geschrieben wurde; er enthält aber auch das bei Weitem Gründlichste in dieser Richtung vor Koelreuter. Die Darstellungsweise weicht sehr zu ihrem Vortheil von der jener Zeit weit ab und ist durchaus im modernen naturwissenschaftlichen Sinn gehalten: eine vollständige Kenntniß der einschlägigen Literatur wird hier mit sorgfältiger Kritik gehandhabt; der Blüthenbau klarer als jemals vorher und lange nach ihm dargestellt und zwar ausdrücklich in der Absicht, den Sinn seiner Experimente über die Sexualität verständlich zu machen. Man sieht es der ganzen Haltung des Briefes an, daß Camerarius von der außerordentlichen Wichtigkeit der Frage durchdrungen war und daß es ihm darauf ankam, die Existenz der Sexualität auf jede mögliche Weise festzustellen.

S. 433: Demnach haben Linné' und seine Schüler in dem Zeitraum zwischen Camerarius' und Koelreuter's Arbeiten zur Begründung der Tatsache, daß es eine geschlechtliche Differenz bei den Pflanzen und eine Bastardirung verschiedener Arten gebe, keinen einzigen neuen oder stichhaltigen Beweis beigebracht und wenn dennoch zahlreiche spätere Botaniker Linné's große Verdienste um die Sexualtheorie gerühmt, ihn als den hervorragendsten Begründer derselben bezeichnet haben, so beruhte das zum Theil darauf, daß sie Linné's scholastische Deductionen von naturwissenschaftlichen Beweisen nicht zu unterscheiden vermochten, zum Theil auf der früher schon erwähnten Verwechslung der Begriffe Sexualität und der auf die Sexualorgane gegründeten Eintheilung der Pflanzen; auf eine solche laufen z.B. auch die Ansprüche hinaus, welche Renzi für Patrizi erhoben, Ernst Mayer jedoch bereits als auf diesem Irrthum beruhend zurückgewiesen hat (Mayer, Gesch. d. Bot. IV p. 420). Noch in unserem Jahrhundert wurde De Candolle von Johann Jacob Römer getadelt, daß er Linné nicht als den Begründer der Sexualtheorie habe gelten lassen.

Über Sachs erfährt man hingegen auf wundersame Weise und in aller Deutlichkeit, einen Überblick über die Verhältnisse zu jener Zeit, vor allem das des zueinander und gerade darin bestand die Problematik, daß viele etwas eigenes praktizierten, jedoch kein Einheitswesen darin bestand. Diese Blütezeit, als das man sie bezeichnet, erweist sich zunächst vielmehr als ein Sodom und Gomorra, welches auf dem bedingenden Streben der Losreißung vom Alten und der unerweichlichenden Bedingung von Neuem fußt und führt auch letztendlich zur völligen Zerrissenheit, indem es letztendlich einzig noch um das Ermessen der Popularität sich dreht, worüber sich auch die Abläufe der Zukunft darin bestimmt. Hierin steckt jedoch auch der Keim dessen, was das Auftreten des Linné bestimmt, in welchem dieser geschickt zu leiten weiß, die diversen Fragmente zu einer Einheit zusammenzuführen und über sein Werken zu einem vereinenden Leitwerk auszugestalten. Maßgeblich ist und dies erfährt man über die späteren Handhabungen nur noch indirekt, daß man über Linnè's Leitwerk auch eine Mauer errichtet, gegenüber dem Vormaligen, sodaß es auch einzig daraus selbst ersichtlich wird. Linné wird zum Reformator, worüber sich alles miteinander koordiniert, jedoch einzig als Leitsystem, nicht jedoch des Einzigen. Maßgeblich ist hierin, daß es sich bei Linné um ein künstliches System der Erfassung und Abbildung handelt. Und wie dieser selbst im Besonderen hervorhebt, so soll es auch einzig derart in Betracht gezogen werden und sich im Weiteren auch eine natürliche systemtische Erfassung entwickeln. Diesem geht es darum, daß die Gegebenheiten einen gemeinsamen Grundstock erhalten, um das Ganze zu vereinen.


vom 16. Jahrhundert bis 1860
Verlag: R. Oldenburg
» «

S. 85: Linnè wird gewöhnlich als der Reformator der beschreibenden Naturwissenschaften bezeichnet, mithin die Ansicht ausgesprochen, daß mit ihm eine neue Entwicklungsreihe in der Geschichte unserer Wissenschaft beginnt, etwa so, wie mit Copernicus eine neue Astronomie, mit Galiläi eine neue Physik begann. Diese Auffassung der geschichtlichen Stellung Linné's, wenigstens soweit es sich um sein Hauptfach, die Botanik, handelt, wird aber nur derjenige hegen können, dem die Werke von Caesalpin, Jungius, Ray, Rifin nicht bekannt sind oder der die in Linné's theoretischen Werken reichlich vorhandenen Citate nicht beachtet. Linné ist vielmehr vorwiegend das letzte Glied der Entwicklungsreihe, welche sich in den eben genannten Männern darstellt; der ganze Gesichtskreis Linné's, der ganze Inhalt seiner Gedanken sind dieselben, die Grundirrthümer jener Zeit theilt Linné ebenfalls, ja er hat ganz wesentlich dazu beigetragen, diese letzteren bis in das 19. Jahrhundert hinein fortzupflanzen. Mit der Behauptung, daß Linné nicht den Anfang einer neuen Entwicklungsperiode, sondern den Abschluß einer älteren darstellt, ist aber keineswegs gesagt, daß seine Wirksamkeit für die spätere Zeit verloren gewesen sei. Linné verhält sich zu den Systematikern der hier geschilderten Periode eben so, wie sich Caspar Bauhin zu den Botanikern des 16. Jahrhunderts verhält; wie dieser alles Brauchbare seiner Vorgänger außer Caesalpin zusammentrug und aus ihm wiederum die Botaniker der zweiten Periode schöpften, obwohl sie von ganz anderen Gesichtspuncten ausgingen; ebenso hat Linné Alles, was die Systematiker des 17. Jahrhunderts auf Grund Caesalpin'scher Ideen geleistet, in sich aufgenommen, es zu einem Ganzen verschmolzen, zu einem Lehrgebäude vereinigt, ohne im Grunde etwas wesentlich Neues hinzuzubringen; in ihm gipfelte Alles, was von Caesalpin bis auf Tournefort an systematischer Botanik sich entwickelt hatte und die Resultate, die er in sehr eigenthümlicher Form aber mit wahrer Meisterschaft zusammenfaßte, blieben für die spätere Entwicklung der Botanik eben so wenig unfruchtbar, wie der Inhalt von Caspar Bauhin's Werken für die Nachfolger des Caesalpin.

Wer die Werke von Caesalpin, Jungius, Morison, Ray, Rivinus, Tournefort mit Linné's Fundamenten der Botanik (1736), seinen Classes plantarum (1738), und seiner Philosophia botanica (1751) sorgfältig vergleicht, muß sich auf das Bestimmteste überzeugen, daß der ideelle Inhalt der Linné'schen Theorien bereits in jenen Werken zerstreut enthalten ist; wer ferner die Geschichte der Sexualtheorie seit Rudoph Jacob Camerarius (1694) verfolgt hat, muß zugeben, daß er jedoch zu ihrer Anerkennung wesentlich beigetragen hat, obgleich nicht geleugnet werden kann, daß er selbst nach den Kölreuter'schen Arbeiten noch höchst unklare, ja mystische Vorstellungen von der Sexualität der Pflanzen hegte.

Was aber Linné dennoch eine so überwältigende Bedeutung für seine Zeit gab, das ist die geschickte Zusammenfassung Alles dessen, was vor ihm geleistet worden war; gerade diese Verschmelzung des bisher Bekannten und Zerstreuten ist nicht nur das Charakteristische bei Linné, sondern auch zugleich ein großes Verdienst.

Caesalpin trug zuerst die aristotelische Denkweise in die Botanik hinein; sein System sollte der Absicht nach ein natürliches sein, blieb aber ein äußerst unnatürliches; Linné, dem man überall den tiefen Eindruck ansieht, welchen Caesalpin auf ihn gemacht hat, behält das Bedeutendste, erkennt aber, was keiner vor ihm erkannte, daß die Art von Systematik, wie sie Caesalpin, Morison, Ray, Tournefort, Rivin getrieben hatten, dem ihm vorschwebenden Zweck, nämlich der Auffindung der Verwandschaften, unmöglich genügen könne, daß vielmehr auf diesem Wege nur eine künstliche und nützliche Anordnung gewonnen wird, während die Darstellung der natürlichen Verwandtschaften auf ganz anderem Wege zu suchen ist.

Was die Nomenclatur der Pflanzentheile betrifft, in welcher sich die damalige Morphologie erschöpfte, so nimmt Linné den ganzen Inhalt der Isagoge des Jungius in sich auf, gibt ihm aber eine übersichtlichere Form und bereichert die Blüthentheorie, indem er ohne zu zögern die damals noch wenig beachtete sexuelle Bedeutung der Staubgefäße verwerthet und so eine bessere Gesammtauffassung der Blüthe gewinnt, die ihrerseits wieder ihre Früchte in einer eben so anschaulichen als bequemen Nomenclatur beiträgt: die noch jezt in der Wissenschaft gebräuchlichen Namen wie diöcisch, momöcisch, triandrisch, monogynisch u.s.w., mittelbar auch die später erfundenen Ausdrücke; dichogamisch, portandrisch, protogynisch u. dgl. verdanken ihre Entstehung dieser richtigen Auffassung der Geschlechtsverhältnisse der Pflanzen.

Aber auch ein großer Irrthum lief mitunter, der nicht wenig dazu beigetragen hat, Linné's Ruhm zu vermehren. Linné nannte sein künstliches auf die Zahl, Verwachsung und Gruppierung der Staubgefäße und Carpelle gegründetes System das Sexual-System der Pflanzen, indem er die vermeintliche Vorzüglichkeit desselben darin fand, daß es auf Organe gegründet sei, deren Function die allergrößte Bedeutung beansprucht. Es liegt aber auf der Hand, daß das Linné'sche Sexualsystem genau denselben classificatorischen Werth haben würde, wenn die Staubgefäße mit der Fortpflanzung gar nichts zu thun hätten oder wenn die sexuelle Bedeutung derselben ganz unbekannt wäre. Denn gerade diejenigen Merkmale der Staubgefäße, welche Linné classificatorisch verwerthet, ihre Zahl und Verwachsungsweise sind für die Sexualfunction selbst völlig gleichgültig.

Wenn daher die Bedeutung dieses künstlichen Systems für die Lehre von der Sexualität der Pflanzen auf einer Verschiebung und Verwirrung von Begriffen beruht, so ist zugleich hervorzuheben, daß überhaupt der Verfolg der Wissenschaft gezeigt hat, wie Linné's Sexualsystem gerade deshalb, weil die von ihm benutzten Eigenschaften der Staubgefäße von ihrer Function ganz unabhängig sind, vielfach zur Aufstellung natürlicher Gruppen führen mußte, denn wir dürfen es als ein wichtiges Ergebnis betrachten, daß den größten classificatorischen Werth diejenigen Eigenschaften der Organismen darbieten, welche von den Functionen der Organe ganz oder zum größten Theile unabhängig sind. Derselbe Irrthum, welcher Caesalpin dazu veranlaßte, die functionelle Wichtigkeit der Fructificationstheile zum Princip der Eintheilung zu machen, kehrt also bei Linné in anderer Form wieder: um ein Eintheilungsprincip zu finden, wendet er sich an diejenigen Organe, deren Function ihm die wichtigste scheint, er nimmt aber die Merkmale nicht etwas von den Verschiedenheiten der Function, sondern von der Zahl und Verwachsungsweise, welche für die Sexualfunction ganz gleichgültig ist. Ganz demselben Irrthum begegnen wir übrigens auch bei Leibniz und Burkhard, die ich hier deshalb erwähne, um Linné gegen den ihm von seinen Zeitgenossen wiederholt gemachten Vorwurf in Schutz zu nehmen, als ob er die Idee seines Sexual-Systems diesen beiden verdanke. Allerdings hatten sie, sowie später Linné, in der großen physiologischen Bedeutung der Sexualorgane irrthümlich den Grund gefunden, aus ihren Verschiedenheiten die Eintheilungsgründe für ein System abzuleiten; aber das war eben der Irrthum in der Sache; das richtige, was nun Linné wirklich that, sich nämlich für den Zweck der Systematik an rein morphologischen Eigenschaften zu halten und diese zweckmäßig zu verwerthen, daß thaten jene nicht.

Das bisher über ihn Gesagte trifft übrigens vorwiegend nur die Art und Weise, wie sich Linné im Einzelnen bethätigte; seinem innersten Wesen nach war er aber Scholastiker, in viel höherem Grade selbst als Caesalpin, welcher nicht sowohl Scholastiker als vielmehr Aristoteliker im strengsten Sinne des Wortes genannt werden darf. Indem ich aber Linné's Denkweise als durchaus scholastisch bezeichne, so ist damit im Grunde schon gesagt, daß er ein Naturforscher im modernen Sinne des Wortes nicht war; ich könnte darauf hinweisen, daß Linné nicht eine einzige irgend bedeutende Entdeckung, welche auf das Wesen der Pflanzenwelt ein neues Licht wirft, gemacht hat; das würde jedoch noch nicht beweisen, daß er ein Scholastiker war.

Das Wesen echter Naturforschung liegt darin, aus der genauen und vergleichenden Beobachtung der Naturerscheinungen nicht nur überhaupt Regeln abzuleiten, sondern diejenigen Momente aufzufinden, aus denen der causale Zusammenhang, Ursache und Wirkung sich ableiten läßt. Indem die Forschung nach dieser Methode verfährt, ist sie genöthigt, die vorhandenen Begriffe und Theorien beständig zu corrigieren, neue Begriffe und neue Theorien aufzustellen und so unser Denken dem Wesen der Dinge mehr und mehr anzupassen; der Verstand hat nicht den Objecten, sondern die Objecte dem Verstande Vorschriften zu geben. Genau in entgegengesetzter Weise verfährt die aristotelische Philosophie und ihre mittelalterliche Form, die Scholastik; bei ihr handelt es sich eigentlich gar nicht darum, durch die Forschung neue Begriffe und neue Theorien zu gewinnen, denn diese stehen ein für allemal fest; die Erfahrung muß sich dem fertigen Gedankensystem fügen; was sich nicht fügt, wird dialectisch so lange gedreht und gedeutet, bis es scheinbar in das Ganze hineinpaßt. Die geistige Arbeit auf diesem Standpunkte besteht ganz wesentlich in diesem Drehen und Wenden der Tathsachen, denn die ganze Weltanschauung selbst ist fertig und braucht nicht geändert zu werden. Erfahrung in dem höheren Sinne der Naturforschung wird dadurch unmöglich gemacht, daß man die letzten Gründe der Dinge sämmtlich zu kennen glaubt; diese letzten Gründe und Principien der Scholastik aber sind im Grunde nur Worte mit äußerst unbestimmter Bedeutung, ihr Sinn besteht in Abstactionen, die aus der alltäglichen, nicht wissenschaftlich geläuterten, daher schlechten Erfahrungen sprungweise abgeleitet sind; und je weiter die Abstraction getrieben ist, je weiter sie sich von der Hand der Erfahrung entfernt, desto ehrwürdiger und wichtiger erscheinen diese Abstracta, über welche man sich schließlich, jedoch wieder nur durch Bilder und Metaphern gegenseitig verständigen kann. Die Wissenschaft nach scholastischer Methode, ist ein Spiel mit abstracten Begriffen, der beste Spieler der, welcher dieselben untereinander so zu verbinden weiß, daß die vorhandenen Widersprüche geschickt verdeckt werden. Wogegen die echte Forschung, sei es philosophische oder naturwissenschaftliche, gerade darauf ausgeht, etwas vorhandene Widersprüche schonungslos aufzudecken und die Thatsachen so lange zu befragen, bis unsere Begriffe sich berichtigen und wenn es nöthig ist, die ganze Theorie, die ganze Weltanschauung durch eine bessere ersetzt wird. In der aristotelischen Philosophie und Scholastik sind die Thatsachen blos Beispiele zur Erläuterung feststehender abstracter Begriffe; für die Naturforschung dagegen der fruchtbare Boden, aus welchem beständig neue Vorstellungen, Gedankenbildung, Theorien und Weltanschauungen hervorwachsen. Zu den schlimmsten Seiten der Scholastik und aristotelischer Philosophie gehört die Verwechslung bloßer Begriffe und Worte mit dem objectiven Wesen der durch sie bezeichnenden Dinge; besonders gern leitete man das Wesen der Dinge aus der ursprünglichen Bedeutung der Worte ab und sogar die Frage nach der Existenz oder Nichtexistenz eines Dinges wurde aus dem Begriffe desselben beantwortet. Diese Art des Denkens finden wir nun bei Linné überall da, wo er nicht blos als Systematiker und Beschreiber thätig ist, sondern über das Wesen der Pflanzen und ihrer Lebenserscheinungen Auskunft geben will, so in seinen Fundamenten, der Philosophia botanica und ganz besonders in dem Amoenitates academicae. Unter zahlreichen Beispielen sei nur die Art hervorgehoben, wie er die Sexualität der Pflanzen zu erweisen sucht. Linné kannte und rühmte die Verdienste des Rudolph Jacob Camerarius, der als echter Naturforscher die Sexualität der Pflanzen auf dem einzig möglichen Wege, dem des Experimentes, erwiesen hatte; dieser experimentelle Nachweis indessen läßt ihn kalt, er erwähnt ihn nur ganz nebenbei, dagegen verwendet er seine ganze Kunst auf eine ächt scholastische Beweisführung an den durch unvollständige Induction gewonnenen Satz Harveys: omne vivum ex ovo, den er offenbar für ein a priori selbststehendes Princip hält und folgert nun daraus, daß auch die Pflanzen aus einem Ei entstehen müssen, indem er übersieht, daß in dem Satze omne vivum ex ovo die Pflanzen ohnehin schon die Hälfte des omne vivum ausmachen; ...

Geschichte der Sexualtheorie (S. 406)

  1. Von Aristoteles bis auf R. J. Camerarius
  2. Begründung der Lehre von der Sexualität der Pflanzen durch R. J. Camerarius 1691-1694
  3. Verbreitung der neuen Lehre, ihre Anhänger und Gegner 1700-1760
  4. Evolutionstheorie und Epigenesis
  5. Weiterer Ausbau der Sexualtheorie durch J. G. Kölreuter und Conrad Sprengel 1761-1793
  6. Neue Gegner der Sexualität und ihre Widerlegung durch Experimente 1785-1849
  7. Mikroskopische Untersuchung der Befruchtungsvorgänge der Phanerogamen; Pollenschlauch und Keimkörper 1830-1850
  8. Entdeckung der Sexualität der Kryptogamen 1837-1860

Was den weiteren Ablauf betrifft, so trifft man auch bei Kölreuter, dem Meilenstein zwischen Camerarius und Linné, auf keine Sexualität, sondern einzig auf ein Verhältniswesen gemäß des Camerarius, jedoch betreibt dieser akribisch Kreuzungsversuche und befördert hierüber das maßgebliche Verständnis über die Fortpflanzung zutage, nicht nur im Bezug auf Pflanzen, sondern über das Generelle dieser Wesensart der geschlechtlichen Vereinigung. Zwar vermischt sich hierin noch der Vergleich des Geschlechts mit dem des Wesens des Organismus, gemäß seiner Anwendung, die sich rein auf die Kreuzungen zweier unterschiedlichen Arten beziehen, jedoch bildet dieser über den chemischen Vergleich, der Vereinigung von Säure und Lauge zum Salz, einen wesentlichen Bestandteil des Wesens Kern ab. Darauf basiert auch die Grundlage der später entstehenden Genwissenschaft, dem gegenüber sich jedoch sowohl Kölreuter, als auch die Genwissenschaft, in der Quantität verlieren, was sie darüber zwar zu reproduzieren wissen, aber doch gelangen sie darüber nicht zu des Wesens Kern, nämlich dem des 'unterscheidenden' Sexual- und Geschlechtswesens. Dieser verdeutlicht sich nämlich gerade über Kölreuters Vergleich, dem gegenüber sich jedoch das Wesen fortpflanzt und nicht das Geschlecht, hingegen pflanzt es sich einzig über die Vereinigung der differenzierenden Geschlechtlichkeit fort. Gerade darin besteht des Wesens Kern des Einheitsverbundes dieser beiden Wesensarten von Sexualität und Geschlecht, denn im Gegensatz zum Geschlecht, bildet hierin nicht das Fortpflanzungsverhältnis und somit die Vereinigung des Männlichen mit dem Weiblichen die substanzielle Grundlage, sondern primär die Einheit des Organismus und das Geschlechtliche ist hierin ein anteiliger Bestandteil. Es handelt sich somit auch nicht, gemäß seines Vergleichs, um das Verhältnis eines Salzes, sondern um das des Synonyms, was sich darüber aufweist. Darauf basiert des Wesens Kern des untrennbaren Verbundes des Sexualitätswesens mit dem Geschlechtswesen. So zeigt sich jedoch auch hierüber, daß nur das Eine seine Inbetrachtziehung darin erfährt und keine davon sich unterscheidendes Sexualwesen. Und so kann man Kölreuter's Fortentwicklung auch bereits erkennen, als ein sich als solches bezeichnendes Erkennen der geschlechtlichen Fortpflanzung.

https://commons.wikimedia.org/wiki/File:Josef_Gottlieb_Koelreuter_(original_upload).jpg

Das Geschlecht der Pflanzen
betreffenden Versuchen und Beobachtungen
()

» Band 2-4 «
Verlag: Gleditschischen Handlung
» «

Band II, § 1: Zu der Erzeugung einer jeden natürlichen Pflanze werden zwey gleichförmige flüßige Materien von verschiedener Art erfordert, die von dem Schöpfer aller Dinge zur Vereinigung für einander bestimmt sind. Die eine davon ist der männliche, die andere der weibliche Saame. Da diese Materien von verschiedener Art, oder ihrem Wesen nach von einander unterschieden sind : so ist leicht zu begreifen, daß auch der Kraft der einen von der anderen verschieden seyn muß. Aus der Vereinigung und Vermischung dieser beyden Materien, die auf das allerinnigste und ordentlicher weise nach einem bestimmten Verhältnisse geschieht, entsteht eine andere, die von mittlerer Art ist, und folglich auch eine mittlere, aus jenen beyden einfachen Kräften entstandene, zusammengesetzte Kraft besitzt : ebenso wie aus der Vereinigung eines sauren und laugenhaften ein drittes, nämlich ein Mittelsalz entsteht. Diese dritte Materie ist alsdenn entweder so gleich nach geschehener Vermischung schon bereits der Anfang oder die feste Grundlage einer belebten Maschine, oder sie bringt sie erst einige Zeit hernach aus sich selbst hervor. Niemals würde dergleichen etwas aus einem von jenen beyden Saamenstoffen allein haben entstehen können : so wenig, als entweder aus einem reinen sauren oder einem reinen laugenhaften Salze allein ein Mittelsalz werden, und sich ein Kristall bilden würde. Auf dieser Grundlage und ihrer wirkenden Kraft, die, nach der verschiedenen Art ihres beyderseitigen Saamenstoffs, bey einer jeden besonderen Gattung einer belebten Maschine, nothwendiger weise verschieden seyn muß, beruhet die ganze allmälig vor sich gehende Bildung der künftigen Pflanze, ihr besonderer organischer Bau oder ihre specifique Natur, wodurch sie sich von allen andern unterscheidet, und die Zubereitung der zu einer neuen ähnlichen Zeugung erforderlichen Saamenstoffe, und, mit einem Worte, alle diejenigen Vollkommenheiten, die zu dem Endzwecke, zu welchem sie bestimmt ist, erfordert werden. Unter diesen Vollkommenheiten ist die Fruchtbarkeit oder die Eigenschaft ihres gleichen hervorzubringen wohl unstreitig eine der vornehmsten, und die jenen Endzweck größtentheils zu erfüllen scheint. Alle Bewegungen und Veränderungen, die von dem Keimen an bis zur Blütezeit in einem jeden solchen Meisterstück der Natur vorgehen, scheinen bloß auf das große Zeugungswerk gerichtet zu seyn, und daran, so zu sagen, mit vereinten Kräften zu arbeiten. Sie zielen alle dahin ab, diejenigen zusammengesetzte Materie, worauf sie gegründet sind, nach und nach aufzulösen, und sie wieder in die zwey ursprünglichen Grundmaterien zu theilen, oder eigentlicher zu reden, diese letztern in einem vollen und, besonders von der einen Seite, in einem ungleich größern Maase, als zu der vorhergegangenen Zeugung erfordert worden, selbst hervorzubringen. Daß es so weit mit diesem großen Werke gekommen sey, verkündiget uns gleichsam der feyerliche Tag, an deme sich die Blumen unserem Auge in ihrer vollen Pracht zeigen. Und eben dieser den Pflanzen heilige Tag ist es auch, da die Natur die letzte Hand an dieses Werk legt, indem sie jene beyde Grundmaterien in einem gegen den ganzen Vorrath oft sehr kleinen, aber bestimmten Maaße an dem gehörigen Orte auf das allerinnigste mit einander vermischt, und dadurch den Grund zu einer neuen Zeugung und einer ähnlichen Pflanze legt.

Band III, § 20, S. 38: Wenn ich meine Leser aus neuern, unzähligemal wiederholten, Beobachtungen versichere, daß die Insekten fast bey allen mir bekannten Gattungen Wollkraut, und vorzüglich bey dem Verbase. Lychnit. nigr. und Blattar. zur Bestäubung das allermeiste beytragen; wenn ich ihnen ferner melde, daß bald diese, bald jene Gattung unserer einheimischen von einer anderen oft kaum einen oder etliche Schuh weit entfernt ist, und durch diese geschäftigen Creaturen täglich solche Vermischungen und Verwechslungen des Samenstaubes bey ihnen bewirkt werden, woraus unter gewißen, aber in der Wildniß nicht Statt findenden Umständen, nothwendigerweise Bastarde entstehen müßten, und doch dem allen ungeachtet weder von mir, noch von so vielen ander Kräuterkennern jemals dergleichen in einem ganz freyen Felde angetroffen worden : so wird man mit mir die weise Einrichtung des großen Schöpfers nicht genug bewundern können, der durch ein gewisses in die Natur gelegtes Gesetz, das bey so mancherley Befruchtungen auf das strengste befolgt wird, allen denen daher zu besorgenden Unordnungen und Verwirrungen vollkommen vorgebeugt hat. Es besteht darinn, daß bey einer zur Befruchtung hinreichenden Quantität von eigenem und fremdem Saamenstaube, wenn beede ungefehr zu gleicher Zeit auf das Stigma kommen, der eigene männliche Saame bey diesem wichtigen Geschäfte nur allein angenommen, der fremde hingegen gänzlich verdrungen, und von der Befruchtung ausgeschlossen wird; eine Wirkung, die ich durch die zuverläßigsten Erfahrungen außer allen Zweifel gesetzt habe. Es ist dieses Gesetz der näheren Verwandtschaft allem Ansehen nach von einem sehr großen Umfange in der Natur, und es gründen sich, wie es scheint, auf eben dasselbe eine Menge schon längst bekannter Erscheinungen, die so wohl in der Chemie, als Physik, täglich vorkommen.

Bei Linné dann folglich angelangt, gilt es sich zunächst zu verbildlichen, was dieser tatsächlich aufbringt, nämlich das 'clavis systematis sexualis'. Maßgeblich hierin ist, daß dieser den lateinischen Begriff 'sexualis' aufbringt und nicht den deutschen Begriff der Sexualität, denn seine Schriften sind in Latein verfaßt. Des weiteren hebt seine Ausführung in Verbindung mit 'systematis' das Wesentliche hervor, daß es sich auf das Sexualsystem bezieht (Ordnungssystem der Sexualität - Bezug: sexus). Dem gemäß bezieht es sich auch nicht, wie man es rückbeziehend ausführt, auf die Geschlechtsorgane, sondern auf Ehemänner (mariti), Ehefrauen (uxores), sowie Männlichem und Weiblichem. Maßgeblich hierin ist, daß weder das lateinische Genus, noch Sexus, sich auf die Genitalien bezog, gemäß dem es sich auch sprachlich voneinander differenziert. Vielmehr hat jedoch in Verbindung mit den botanischen Entwicklungen hierin ein Wandel stattgefunden, worin man dazu überging, die Genitalien als Geschlechtsorgane zu benennen. Wie sich über Linné's Ausführungen verdeutlicht, so ist diesem wohl dieser Sachstand gänzlich nicht nachvollziehbar und hebt indess hervor, wie es sich gemäß seines Bezugswesens des Althergebrachten damit verhält. Des Menschen Bezugsverhältnis war nämlich, gemäß seiner Ausführung, nicht auf die Inbetrachtziehung der Geschlechtsorgane begründet, sondern gemäß des lateinischen Sexus und Genus bezog es sich auf die Gleichen einer Art/Gattung, in Unterscheidung zu den anderen dessen Art/Gattung. Gleichermaßen verhielt es sich mit dem deutschen Geschlecht. Gerade dies tritt über seine Ausführung hervor, was seine Erläuterungen in aller Ausführlichkeit auch beschreiben. Elementar ist somit auch, daß sein Aufbringen des Sexualitätbegriffs nicht dem entspricht, was sich daraus entwickelt, sondern spezifisch darüber die Sexualität deklariert, worin die Geschlechtsorgane einzig anteilig beteiligt sind, jedoch nicht der maßgebliche ermessende Inbetrachtziehungsgegenstand.

Linnae Clavis Systematis Sexualis 1735
» Clavis Systematis Sexualis (1758) «
» Carl von Linné «

Linnaei methodus sexualis 1737
» Methodus sexualis (1737) «

» Carl von Linné «

» Systema Naturae (Erstausgabe 1735) «
Caroli Linnaei


Verlag: G. Reimer
» «


ein Lebensbild
Verlag: J. D. Sauerländer
» «


Verlag: Benjamin Gottlieb Hoffmann

» Linnaeus Link «
Online union catalogue of Linnaean publications

Divider


Übersetzung der lateinischen Ausgabe
der 14. Ausgabe von » Johan Andreas Murray «
von

- Botanische Kunstworte -

Anandrum (Männerloß), Androgynum (halbgetrennt), Decandria (zehenmännige), Defloratio (Entjungferung), Diandria (zweymännige), Diandrum (zweimännig), Digynia (zweiweibige), Disseminatio (Besaamung), Dodecandria (12männiche), Erectum (Aufrecht), Femina planta (weibliche Pflanze), Femineum (weiblich), Fertile (fruchtbar), Folia vaginantia (Scheidenblätter), Folliculus (Fruchtbälglein), Fructescentia (die Fruchtmachung), Fructification (die Befruchtung), Gamnopolyspermae (nakt vielsaamige), Gyandri (eifersüchtige), Gymnodisperae (nakt 2saamige), Gymnospermae (naktsaamige), Gymnotetraspermae (nakt viersaamige), Heptandria (7 männiche), Hermaphroditum (Zwitter), Hexandria (sechsmänniche), Hybrida planta (Bastardpflanze), Hybridum (Bastard), Hysterophorum (gebährmutterähnlich), Icosandria (20männich), Mas (der Mann), Mascula planta (Männliche Pflanzen), Masculae (männlich), Monandria (einmänniche), Monogymnia (einweibige), Monogynum (Einweibig), Octandria (Achtmänniche), Ovarium (Eyerstock), Pentandrum (Fünfmännich), Petiolus vaginans (Scheidenstiel), Planta foeminea (Weibliche Pflanze), Planta hermaphrodita (Zwitterpflanze), Pollen (Saamenstaub/Blumenstaub), Polyandria (Vielmänniche), Polydelphia (Vielbrüdriche), Polygamia (vermengte Pflanze), Polygamum (Vielweibig vermengte), Polygynia (Vielweibliche), Polyspermae (vielsaamige), Propago (Brut), Semen (Samen), Spermaphorus (saamenbringend), Sterilis (unfruchtbar), Stimulans (reizend), Stipulae (Scheidenansätze), Synegenesia (Mitbuhler), Testiculus (Hoden), Tetrandria (4männiche), Triandria (3männiche), Trigynia (3weibige), Trispermum (3saamig), Vagina (Scheide), Vaginales (scheidige)

- Kennzeichen der Klassen -
(anklicken zum vergrößern)

Kennzeichen der Klassen 01 Kennzeichen der Klassen 02 Kennzeichen der Klassen 03

- Schlüssel und Ordnungen -
(anklicken zum vergrößern)

Lippert Schlüssel Lippert Ordnungen

Elementar ist hierin, daß es sich primär um die Fortpflanzung dreht und diesbezüglich fanden diverse ideologische Veränderungen statt bezüglich dessen, was und wie sich das Jeweilige fortpflanzt. Leittragend bezüglich der Sache und somit auch der Ideologie ist hierin jedoch nicht das sachliche, sondern das kulturelle Erbwesen. Und diesbezüglich entstand gegenüber dem Ursprünglichen im Verlauf ein Widerspruch, welcher sich vor allem sprachtechnisch als Hindernis stellte. Die Grundlage der Vererbung bildete sich nämlich auf dem lateinische Gen, dem gegenüber vor allem der aufkommende Erbadel und darüber sich umsetzenden Allgemeinwesens, gemäß dem dies über den erstgeborenen männlichen Erben eingerichtet wurde, sich dies als widersprüchlich stellte, denn dem gegenüber erweist sich das Gen als unpassend, da es auf beiderlei Geschlechtlichem und auch Allumfassenden hin ausgebildet ist (genitalia, genus, generatione, ...). Über die Bezugnahme von Geschlechtsorganen, worüber sich das Geschlecht vererbt, erfährt dies indess seine entsprechende Anpassung daran. Maßgeblich hierin ist, daß es sachtechnisch einzig als Neues hinzutritt, jedoch nicht das Althergebrachte gänzlich ersetzte, sondern es sich als eine Verdrängung stellte, dem gegenüber das Alte jedoch als solches sich bewahrte, gemäß man heutzutage auch die Genitalien, Geschlechtsorgane und Sexualorgane im Nebeneinander antrifft. Bereits im Lateinischen trifft man entsprechendes an, indem darin der Sexus sich zusätzlich zu dem Genus hinzugesellt, sich jedoch substanziell von dem des Genus trennt und man keinerlei darüber hinausgehende Wortbildungen antrifft. So existierte bis dato auch nicht das lateinische sexualis, welches Linné aufbringt und stellt eine neue Wortschöpfung dar, welche auf diesem sexus aufbaut und nicht, wie es allseits in Verbund darstellend und darüber verfälschen dargelegt wird, auf dem des Geschlechts. Im Gegenteil, denn darüber differenziert es sich spezifisch dem gegenüber und verdeutlicht darüber die elementare Unterscheidung. Indess ist es der Samen (lat. semen), welcher sich als abseitiges von all dem stellt und in Einbezug dessen erfährt es auch sein Gesamtwesen in seinem präsenten Nebeneinander. Dies ist es auch, was über die Botanik ihr ganz spezifisches Inbetrachtziehungswesen erfährt.

Sexualwesen ↔ Geschlechtswesen ↔ Fortpflanzungswesen

Linné war Derjenige, welcher dem Sexualsystem seine in Betracht ziehende populäre Bewandtnis verschaffte und darüber wurde auch eingeleitet, was bis heute die grundlegende Auseinandersetzung damit bildet. Nämlich vor allem die Auseinandersetzung des in Betracht ziehenden künstlichen Systems, gegenüber dem des Natürlichen, welches fortwährend den Streitpunkt der Auseinandersetzung begründet. Maßgeblich ist hierin, daß Linné gar besonders hervorhob, daß es sich nur um ein Künstliches handelt und dafür ausgebildet ist, um die diversen für sich stehenen Einzelfragmente zusammenzuführen. Hier ist die Gegegenheit noch eine viel frapierendere, als man bei Kinsey antrifft, worüber man sich jedoch einmal mustergültig vor Augen führen kann, wie es sich damit verhält und worauf es beruht, daß sich die eigentlichen Entwicklungen 'als solche' letztendlich in einer Verklärung verlieren, indem nämlich das eigentlich Wesentliche - das Fundierende - außen vor gerät. Nachfolgend die Darlegung von Rádl, welcher dies einmal aus seiner dazwischenstehenden Zeitepoche heraus beschreibt. Gegenüber seiner, wie auch des Linné's Hoffnung, verändert sich hingegen die Lage durch die neueren Entwicklungen nicht, sondern das beständige Verhältnis von Neuerung und Zerfall setzt sich kontinuierlich fort. Gerade für die Gene und Chromosomen ergibt sich in der Folgezeit somit auch das Gleiche, da sie nicht das alleinige Bestimmende des Seins darin sind, sondern auch anderes daran beteiligt ist, sodaß sich das immer wiederkehrende Schicksal darüber fortsetzt. Von der isolierenden Inbetrachtziehung des Seienden als solches, bewegt man sich kein Stück breit weg, zeigt sich vor allem darüber. Gerade darauf beruhten die Auseinandersetzungen der einstigen beiden Warten der Repräsentanten des natürlichens Systems gegenüber dem des Künstlichen. Nur die Bildnisse haben sich zwischenzeitlich verändert, nicht hingegen der Urkeim der Sache selbst, nämlich das Verhältnis zu dem, daß Bildnisse nicht das Sein selbst sind. Während es die Einen als solches wahrnehmen, ist es hingegen Anderen gar nicht das Leitbild. In diesem Kernwesen trennt sich hierin auch die Spreu vom Weizen.


seit dem Ende des siebzehnten Jahrhunderts
Verlag: Wilhelm Engelmann

Es lag in der philosophischen Richtung jener Zeit, daß man sich bemühte, das Pflanzensystem rationalistisch aufzubauen, d. h. man suchte durch Abstraktion aus dem eben vorhandenen Tatsachenmaterial die wesentlichen Merkmale der Pflanzenwelt zu gewinnen und nach diesen für alle Pflanzen ein für allemal aufgestellten Regeln das System durchzuführen. CAESALPIN glaubte, daß er das natürlichste Pflanzensystem bekommen würde, wenn er die Pflanzen nach den Ernährungs- und Fortpflanzungsorganen (d. i. Samen) einteilte, da er diese Organe für die wesentlichsten hielt.

Durch das Studium der Arbeiten des Camerarius über die Sexualität der Pflanzen gelangte LINNÉ zu der Überzeugung, daß die Sexualorgane für die Pflanzen am wichtigsten sind; er behauptet, daß es keine Funktion der Pflanzen gibt, für welche die Natur so konstante Apparate ausgebildet hätte, wie die Fortpflanzung, und das ist die Ursache, warum er die Antheren und das Pistill als Einteilungsgrund des Pflanzensystems annimmt. Das Prinzip dieses Systems ist also im wesentlichen dasselbe wie bei CAESALPIN, MORISON, TOURNE-FORT und andern seiner Vorgänger. Besonders nahe steht es dem CAESALPINschen Einteilungsprinzip; Caesalpin, der mit ARISTOTELES die Sexualität der Pflanzen bestreitet, hat sein System auf die Früchte aufgebaut, LINNÉ hat nur die neue Entdeckung der Sexualorgane dazu benutzt, den CAESALPINschen Gedanken mehr zu vertiefen. Zwar hat CAESALPIN die systematische Bedeutung der Früchte aus dem Wesen der Pflanze abgeleitet und dabei auf die Funktion (Fortpflanzung), nicht auf die Form der Pflanze den höchsten Nachdruck gelegt, während das von LlNNÉ gewählte Merkmal, die Sexualorgane, bis zu gewissem Grade auch morphologisch wirklich konstant ist. Trotzdem aber ist LINNÉs System wesentlich physiologisch; denn die Funktion, die Sexualität, nicht die Struktur, d. h. das Verhältnis der Teile, gibt ihm die Hauptmerkmale. Der beste Beweis dafür, daß LINNÉ die Sexualorgane aus physiologischen, nicht aus morphologischen Rücksichten als klassifikatorische Merkmale angenommen hat, ist der, daß er auch das System der Tiere auf ihr Sexualsystem aufbauen wollte; er wurde jedoch durch die Rücksicht auf den Anstand - es war ja das 18. Jahrhundert, und die Zoologie mußte salonfähig bleiben - davon zurückgehalten.

LINNÉ wußte, daß sein Pflanzensystem künstlich ist, und hoffte, daß es einmal durch ein natürliches ersetzt werden würde. Charakteristisch ist jedoch, daß er diesen Fortschritt nicht vom Studium der Organisation der Pflanzen erwartete, sondern von der Entdeckung neuer Gattungen; so steht er in dieser Hinsicht in naher Beziehung zu den Darwinisten: von der Erfahrung erwartet er eine tiefere Erkenntnis der Eigenschaften der Art, Gattung usw. nicht, sondern von der Auffindung bisher unbekannter Arten, durch die dann die noch vorhandenen Lücken im natürlichen System ausgefüllt werden sollen.

An LINNÉs System der Pflanzen, welches auf der Beschaffenheit ihrer Sexualorgane aufgebaut ist, können wir eine kurze Übersicht der bis in das 18. Jahrhundert herrschenden Ansichten über die Sexualität anknüpfen. Die sexuellen Unterschiede, die bei dem Menschen eine ausschließlich vitale Erscheinung darstellen - in der anorganischen Natur kommt nichts Ähnliches vor -, an welche sich anatomisch, physiologisch, psychologisch, soziologisch und wer weiß, in welcher Hinsicht noch, eine Reihe der wichtigsten Probleme anknüpfen lassen, reizten die Theoretiker immer wieder, sie durch irgendeine konkrete Auffassung in das Gebiet der Biologie einzuführen. Doch bekenne ich, daß mir auf keinem andern biologischen Gebiete die Theorien, die Versuche zur Lösung des Problems so kläglich, so wenig ersprießlich vorkommen wie in diesem Falle, die modernen Theorien keineswegs ausgenommen. In den Zeiten der deutschen Naturphilosophie hat man in dem Geschlechtsunterschied eines der tiefsten Probleme gesehen; heute ist man dagegen der Ansicht, daß die Chromosomen, Centrosomen und ähnliche Elemente alle Schwierigkeiten beseitigen.

Über nachfolgendem Auszug gilt es, den weiteren sprachtechnisch Vorlauf hervorzuheben, aus dem heraus man sich später mit der Sexualität des Menschen befaßt. Wie sich hierüber verdeutlicht, so gehen in der Botanik die Hetero- und Bisexualität im Nebeneinander einher, dessen differenzierende Deklaration sich auf die Unterschiede der Geschlechtsverhältnisse der jeweiligen Arten bezieht. Beim Menschen erfährt hingegen nur das jeweilige singuläre Geschlecht für sich, im Verhältnis seines vereinigenden Singulären, seine Inbetrachtziehung. Zumindest ist dies der Ausgangspunkt der sachlichen Erwägung. Sprachtechnisch zeigt sich indess hierüber auf, was des weiteren zum zentralen Auseinandersetzungsgegenstand wird, daß sich nämlich fortwährend beides miteinander vermischt, ohne die anstrebenden Erfordernisse der Trennung zu erlangen. Das Gegenteil tritt sogar ein, sodaß umso mehr man sich darin bemüht, die Trennung herbei zu führen, es dies umso mehr miteinander vereint. Das die Bisexualität hingegen, wie es bereits die Botanik beschreibt, vor allem jedoch die Evolution aufweist, auf anderweitigem beruht, grundlegend auch die geschlechtliche Vereinigung (Sprache ↔ Sache), als man es über die Heterosexualität zu erzwingen ersucht, dem gegenüber weigert man sich hingegen anzuerkennen, dies überhaupt in Betracht zu ziehen. Vor allem die Bezugnahme, daß die Sexualität auf dem Geschlecht beruhe, führt dies sogar wortwörtlich vor Augen. Wesentlich ist damit verbunden aber auch, daß die theoretisierenden Anwendungen und Bezeichnungen nicht die Natürlichkeit des Seins repräsentieren, sondern eine chematische Darstellung dessen sind. Was somit überhaupt seine tatsächliche Inbetrachtziehung erfährt, ist sowohl in der Botanik, wie auch beim Menschen, das eigentlich Wesentliche, worüber sich die diversen Aufklärungen ergeben.


oder, Die Kunstausdrücke welche zum Verstehen
der phytographischen Schriften nothwendig sind

E. Schweitzerbart'sche Verlagsbuchhandlung
» «

bisexualis, zweigeschlechtlich, mit männlichen und weiblichen Befruchtungsorganen versehen.

hermaphroditus, zwittrig, wenn Staubgefäße und Pistille in der männlichen Blüthe enthalten sind; daher flos hermaphroditus, eine Zwitterblüthe.

heterogamus, verschiedenehig, wenn in dem nämlichen Blüthenstande Blüthen verschiedenen Geschlechts (weibliche und Zwitter, weibliche und männliche oder geschlechtslose) vorkommen, z.B. bei Inula, Aster, Celendula, Centauren. (Ist gleichbedeutend theils mit polygamus, theils mit androgynus.)

Quelle von Bischof's Ausführungen

Lehrbuch der Botanik - Anhang ()
, » hermaphroditus, heterogamus «
E. Schweizerbart's Verlagsbuchhandlung

Divider


Verlag: Johann Leonhard Schrag

Das Linneische System (S. 87)

Dieses ist das in Deutschland und mehreren anderen Ländern allgmeiner befolgte, und da es zugleich eines der einfachsten, und leicht zu fassenden Systeme ist, so soll dasselbe vorzugweise hier erläutert werden.

Bei diesem Systeme sind die Geschlechtstheile der Pflanzen (nach ihrer Zahl, nach ihren Verhältnissen der Länge, nach ihrer Verwachsung, nach ihrer Trennung in verschiedenen Blumen) das leitende Princip der Anordnung. Es heißt deswegen auch Sexual- oder Geschlechtssystem (Systema sexuale), und ist ein künstliches.

Was die Ergründung des geschichtlichen Verlaufes betrifft, so sind hierin unabdingbar die Originale in Betracht zu ziehen, wie an sich generell einzig darüber die wahre Gegebenheit seine Ersichtung erfährt, sich dies jedoch hierin besonders gravierend stellt, wie Schultes mit nachfolgenden Worten ausdrückt. Maßgeblich ist, und das gilt es im nachfolgenden Abschnitt darzulegen, daß hierin zunächst noch gar keine Kenntnisse, wie auch Sprachschatz für die Gegebenheiten, vorhanden waren und sich aus diesem Verhältnis heraus die Prinzipien, gemäß ihres Entwicklungsstandes entwickelten und teils bis heute Ermessungsgegenstand sind. Über die Sexualität zeigt sich jedoch auf prägnante Weise, daß man speziell in der Geschichtsschreibung nicht in Anbetracht seines Ursprungs, sondern aus der jeweiligen Gegenwartsperspektive die Gegebenheiten ersichtet und daraus die Beschreibungen aufbringt, zumal die meisten auch einzig von anderen abschreiben. Maßgeblich ist dem gegenüber, daß das Kernwesen der jeweiligen Gegebenheit aus seinen Ursprüngen heraus gebildet ist und kein davon unabhängiges Neues, da es sich nämlich über das Sprachliche als solches fixiert, dem gegenüber das Kernwesen dessen jedoch speziell daraus ersichtlich ist, insofern man dessen Ursprung und Entwicklung in Betracht zieht.

So ist auch Schultes Ermahnung nicht ganz ohne des eigenen Mißverhältnisses darin, was man jedoch regulär derart antrifft. Man hat gar nicht im Blick, daß Bücher ursprünglich gar nicht den Lehrgrund bildeten, sondern Schriften entweder die Funktion von Notizen oder Repräsentalien hatten. Aus Büchern lernen ist etwas, was überhaupt erst in Verbindung mit dem Druckerwesen seine allgemeine Umsetzung erfährt, denn das Lehren wurde über die Kundigen vermittelt, dem gegenüber es bereits zuvor als mißverhältlich stellte, wenn die Kundigkeit einzig aus Büchern stammte. Gerade hierin, in der Botanik, gleichermaßen wie auch im Verhältnis der Ärzteschaft, ging es somit auch darum, daß die Kenntnisse mit dem Wesen selbst den Grundstock bilden und vor allem einzig darüber das Kernwesen selbst darüber ersichtlich wird, dem gegenüber die Bildnisse selbst es nicht hervorbringen. Gerade dies war ja auch das Mißverhältnis, was sich bereits über die mittelalterlichen Verhältnisse verbreitete. So war es ursprünglich auch üblich, daß man die Pflanzen trocknete, um sich darüber ein direktes Abbild des Originales zu bewahren. Das gänzliche Übertragen in sprachliche und bildliche Verhältnisse, was man sich nicht nur hierin anmaßt zu bewerkstelligen, ist vor allem das Geleitwerk des daraus Erfolgenden.


» Register «
Verlag: C. Schaumburg und Compagnie
» «

Wir besitzen der Lehrbücher der Botanik so viele, und unter diesen so gute, dass es beynahe eine Vermessenheit zu seyn scheint, wenn man mit einem neuen Lehrbuche dieser Wissenschaft vor der Welt auftritt. Da indessen die meisten dieser Lehrbücher von Professoren geschrieben wurden, und da (wie man bey Vergleichung dieser Werke, insofern sie nicht blosse Compendien sind, deutlicht sieht) die meisten derselben nach mehr oder minder eigenen Ansichten von Seite des Lehrers geschrieben wurden; so ist es vielleicht auch mir, der ich nun 20 Jahre lang Botanik lehre, erlaubt, mein eigenes Lehrbuch herauszugeben.

Ich glaube nähmlich bemerkt zu haben, dass bey den meisten Lerhbüchern der Botanik die Literatur dieser Wissenschaft zu sehr vernachlässigt wurde ; und doch ist bey keiner Wissenschaft Kenntnis der Geschichte und der Literatur derselben so wichtig und wesentlich, als gerade bey der Botanik. Die Vernachlässigung dieses wichtigen Theiles in den meisten Lehrbüchern der Pflanzenkunde scheint mir sowohl in dem Umfane der Literatur derselben, als auch darin zu liegen, dass sie noch in keinem botanischen oder rein literaturhistorischen Werke vollständig und bis auf die neuesten Zeiten durchgefürht worden ist; dass es (man versuche es nur, wenn man daran zweifeln sollte) vielleicht in keiner Wissenschaft schwerer hält, Notizen über die dahin gehörigen Schriftsteller zu sammeln, als gerade in der Botanik, weil die Literatoren, wie es scheint, die Botaniker für keine Gelehrten halten und sich meistens um die genaue Angabe der Titel ihrer Werke ebeb so wenig kümmern, als um ihr Geburtsjahr, ihr Vaterland etc. Man vergleiche hierüber die vortrefflichen Werke unserer grossen Literatoren, Ersch, Meusel und Reuss, denen die Literargeschichte so unendlich viel zu danken hat, und man wird sich von der Richtigkeit meiner Bemerkung überzeugen.

Divider


Verlag: F. A. Brockhaus
» «

» () «

Pline l'Ancien
» Enzyklothek «

Plinus Naturgeschichte

» Caij Plinij Secundi von Veron (1543) «
Natürlicher History Fünff Bücher
Heinrich von Eppendorf

Plinius Naturgeschichte
Übersetzung der Historia Naturalis

» Band 2 (Rostock und Greifswald 1765) «
» Enzyklothek «
» «


Verlag der Mezler'schen Buchhandlung
» «


» «

Die Naturgeschichte des Cajus Plinius Secundus ()

» Dritter Band (XII-XIX. Band) «
» Fünfter Band (XXVII-XXXII. Buch) «
Verlag: Gressner & Schramm

Plinius Secundus der Ältere: Naturkunde / Naturalis historia libri XXXVII
» Sammlung Tusculum «
37 Bücher (und Register) in 32 Bänden (lateinisch-deutsch)
Roderich König, Joachim Hopp, Gerhard Winkler, Wolfgang Glöckler


als Vorläufer einer pragmatischen Geschichte der Zootomie
Verlag: Friedrich Viehweg und Sohn

Geschichte der Botanik

» Zweiter Theil (1818) «
Verlag: F. H. Brockhaus
» «

Geschichte der Botanik

» Zweiter Band (1855) «
» Dritter Band (1856) «
» Vierter Band (1857) «
Verlag: Gebrüder Bornträger
» «


nach ihrer Entwiklungsfolge von Aristoteles bis auf die gegenwärtige Zeit
» «


bis auf Joh. Müller und Charl. Darwin
Verlag: R. Oldenburg
» «

» Bibliografie zur Philosophie und Geschichte der Biologie (2016) «
» Georg Toepfer «

Online-Archive

» Biblioteca Digital Real Jardín Botánico «
» Kurt Stüber's Online Library «
» Bibliotheca Antiqua «
2.500 books of human knowledge on the healing use of plants

Divider

Der Geschlechtsbegriff

Divider

Über Toepfer's nachfolgende Beschreibung erfährt die begriffliche Gegebenheiten ihr antreffendes Sachwesen in seinen verdrehten und widersprüchlichen Beschreibungen und veranschaulicht mustergültig, mit welchen Mißverhältnissen man hierin konfrontiert ist. Hintergrund des Ganzen ist, daß es sich um mehrere Bestandteile handelt, welche gemäß Toepfer's Ausführung, weitläufig ihre dem entsprechende Vermischungen erfuhren, aufgrund dessen es hierin unablässig ist, diese Bestandteile in ihrem jeweiligen tatsächlichen Ursprung in Betracht zu ziehen. Darüber wird dann auch erst deutlich, daß man hierin nicht die Begrifflichkeit selbst verdreht, sondern hingegen eine komplette Neuorientierung stattgefunden hat, auf der Grundlage der wissenschaftlich-biologischen Bildnisse, gemäß dem es sich darin auch als ein absonderndes biologisches Geschlecht stellt, was darin seine Inbetrachtziehung erfährt. Hierbei handelt es sich nämlich keineswegs, wie man allgemeingültig mittlerweile vermittelt bekommt, um die einzige Variante der Bedeutung von Geschlecht. Über die jeweiligen ursprünglichen Begrifflicheiten erfährt dies seine entsprechene Aufklärung und vor allem erfährt dies darüber auch seine Vervollständigung der Präsenz, welche keineswegs verschwunden ist, sondern einzig in den allgemeinen Regularien nicht ihr Erscheinungswesen erfährt. Maßgeblich ist, daß der deutsche Begriff Geschlecht aus dem Althochdeutschen stammt, aus dessen Ursprung sich, in Gegenüberstellung des Lateinischen und Griechischen, die Differenzierungen und Spezifizierungen darlegen. So ergibt sich jedoch auch für den Begriff Sexualität überhaupt erst hierüber die eigentliche Aufklärung über das Verbunds- und Differenzierungswesen, welches zwischen den beiden Sachständen, wie auch Begrifflichkeiten besteht. Elementare Bestandteile hierin sind das Was hierin jeweils der in Betracht ziehende und vereinende Ermessungsgegenstand ist und die Unterscheidung von Gemeinsamkeiten und Ergänzungen, gemäß den regulären Verhältnissen von Synonymen, worauf auch das Gesamtwesen hierin basiert.

» Bibliografie zur Philosophie und Geschichte der Biologie (2016) «
Leibniz-Zentrum für Literatur- und Kulturforschung (Berlin)
Georg Toepfer


Verlag J.B. Metzler

Geschlecht

Das deutsche Wort "Geschlecht" (ahd. "gislahti") gehört dem gleichen Stamm wie "schlagen" an und bedeutet ursprünglich »das, was in dieselbe Richtung schlägt, (übereinstimmende) Art«. Später nimmt es die Bedeutung von »Abstammung, Herkunft« und besonders »(adlige) Familie« an. Es bezeichnet seit dem Mittelalter unter dem Einfluss von lat. "genus" und als geläufige Übersetzung für "sexus" auch das natürliche und grammatische Geschlecht eines Lebewesens bzw. Wortes. Spätestens seit Ende des 15. Jahrhunderts wird das Wort in doppeltem Sinn verwendet: einerseits für eine Gruppe von Organismen eines Typs (z.B. Steinhöwel ca. 1477: »menschlichs geschlecht«; »geschlächt der tieren«), andererseits für einen der beiden Typen von Organismen bei bisexuell sich fortpflanzenden Lebewesen (Brant 1494: »vermyschung beider geschlecht«; 16. Jh.: »weibliches Geschlecht« und »männliches Geschlecht«; »Erbfolge beyderley Geschlechts«. Die zweite Bedeutung verbreitet sich in der Biologie seit Mitte des 18. Jahrhunderts - J.G. Koelreuter handelt in seinem umfangreichen Werk über »das Geschlecht der Pflanzen« (1761-66) von der sexuellen Fortpflanzung bei Pflanzen - und wird bis ins 20. Jahrhundert die dominierende.

Streit um die Geschlechtlichkeit der Pflanzen (I): Mittelalter und Frühe Neuzeit.

Die Kenntnis von der Geschlechtlichkeit der Dattelpalme ist im Mittelalter bei arabischen Gelehrten weiterhin vorhanden. In der Frühen Neuzeit wird wiederholt auf die Zweigeschlechtlichkeit vieler Kräuter hingewiesen. So bemerkt L. Lemnius 1567 (in der Übersetzung von J. Horst von 1575), »das die Kreuter zweyerley sind im geschlecht/ als nemlich menlein und weiblein« (in Original: »sexum inesse stirpibus«). 1592 unterscheidet der böhmische Botaniker A. Zaluziansky à Zaluzian klar zwischen der vegetativen Vermehrung und der sexuellen Reproduktion der Pflanzen (»De sexu plantarum«). Verdeckt wird die Geschlechtlichkeit der Pflanzen durch die weite Verbreitung des Hermaphroditismus bei Pflanzen (s.u.), also das Vorkommen von Blütenorganen mit männlichen und weiblichen Funktion an einem Organismus. In der Zeit nach Zaluziansky beschreibt T. Millington die Geschlechtlichkeit der Pflanzen und sieht die Staubblätter als das männliche Organ, das den Samen erzeugt. Millington veröffentlicht seine Anschauungen offenbar nicht selbst; sie werden erst durch den Botaniker N. Grew bekannt, der die Staubgefäße als »männliche« und den Stempel als »weibliche« Sexualorgane bezeichnet. Im Herbst 1671 liefern sowohl Grew als auch M. Malpighi anatomische Beschreibungen der Sexualorgane von Pflanzen gegenüber der "Royal Society" in London, die wenig später in Buchform veröffentlicht werden. Auf das klassische Beispiel der Dattelpalme gehen beide dabei nicht ein - vielleicht weil diese als Symbol des türkischen Kulturkreises galt und die Türken am Ende des 17. Jahrhunderts eine Bedrohung für das christliche Europa darstellten. Malpighi weist in seinen zoologischen Untersuchungen auch den Hermaphroditismus der Landschnecken nach - in seiner Pflanzenanatomie kommt er auf diese Parallele zu vielen Pflanzen allerdings nicht zu sprechen. Grew nimmt dagegen 1682 die hermaphroditische Geschlechtlichkeit der Pflanzen theoretisch an und vergleicht die Pflanzen in dieser Hinsicht (zu Recht) mit Schnecken. Wohl beeinflusst durch Grew, vergleicht J. Ray den Pollen der Pflanzen 1686 mit dem Sperma der männlichen Tiere.

Wenig später stellt der Tübinger Mediziner R.J. Camerarius (ebenso wie schon zuvor J. Bobart in Oxford) Experimente zu dieser Frage an und veröffentlicht sie 1694 in seinem »Brief über das Geschlecht der Pflanzen«. Diese Experimente bestehen in der künstlichen Isolierung der weiblichen von den männlichen Exemplaren zweihäusiger Pflanzen (z.B. des Bingelkrauts, Mercurialis), so dass jene keine reifen Samenkörner entwickeln. Zuvor hatte Camerarius auch schon bei frei in der Natur stehenden isolierten weiblichen Pflanzen (des Maulbeerbaums, Morus) das Ausbleiben der Bildung reifer Früchte beobachtet. Auch mit einhäusigen Pflanzen führt Camerarius Vesuche durch; er beschreibt den Pollen als das männliche und den Fruchtknoten als das weibliche Organ zur Fortpflanzung der Pflanzen.

Monogamie, Polygamie, Polygynie, Polyandrie

Für den Menschen besteht eine Terminologie zur Beschreibung der quantitativen Verhältnisse bei der Bindung der Partner unterschiedlichen Geschlechts bereits seit der Spätantike: Als Normalfall für den Menschen gilt meist die Monogamie (Tertullian um 200: »monogamia«; Taylor 1612: »monogamy«). Davon unterschieden wird seit dem Hochmittelalter die Polygamie (Sigebert von Gembloux 11 Jh.: »gaudens poligamia secundi tertii et etiam quarti mariti non refutat copulam ex multis maritis«; Petrus Cantor 12. Jh.: »bigamia vel poligamia«; Sarcerius 1538: »Poligamie, that is, the hauing of many wyues to gyther is forbydden«; Madan 1780: »polygamy«: »the having more wives than one«. Daneben steht die Polyandrie, die seit der Spätantike für den Menschen beschrieben wird (Arnobius 4. Jh.: »polyandria« [im Kontext von angeblicher ägyptischer Tempelprostitution]; Grotius 1680: »polyandria«; Lawrence 1680: »polyandry«; Madan 1780: »polyandry«). Von der "Polygamie", die in der legalen oder institutionalisierten Beziehung von einem Mann mit mehreren Frauen besteht, wird die bloß sexuelle Verbindung von einem Mann mit mehreren Frauen als Polygynie abgegrenzt (Madan 1780: »polygyny«: »the having more women than one, without marriage or other obligation towards them«).

Meist stehen diese Ausdrücke im Zeichen der moralischen Abwertung und des Verbots. Erst seit Mitte des 18. Jahrhunderts entwickeln sie sich zu neutralen deskriptiven Termini. C. Wolff gibt 1747 eine definitorische Übersicht über diese Konzepte: »Polygamia dicitur matrimonium personæ unius cum pluribus contractum. In specie Polygynia vocatur matrimonium unius maris cum pluribus fominis contractum; Polyandria vero matrimonium unius fominæ cum pluribus maribus initum. [.] Monogamia, quæ polygamiae opponitur, appellatur matrimonium unius maris cum una fomina contractum«.

Sexualität

Etymologisch geht 'Sexualität' auf lat. 'sexus' 'männliches oder weibliches Geschlecht' zurück, das wiederum von 'secare' ('sectum') 'schneiden' abstammt. Der Wortstamm verweist also nicht auf den Prozess der Verschmelzung, sondern auf die (morphologische) Unterscheidung von Organismen einer Art.

Die Einführung des Ausdrucks erfolgt Mitte des 18. Jahrhunderts. Der frühe Wortgebrauch steht besonders unter dem Einfluss von Linnés Beschreibungen des Phänomens der Sexualität bei Pflanzen und des darauf aufbauenden linnéschen 'Sexualsystems' zur Klassifikation der Pflanzen. Für diese Klassifikation spricht Linné bereits 1735 von einem systematisch-sexuellen Schlüssel ('Clavis Systematis Sexualis').

Das dazu gehörige Substantiv erscheint zuerst auf Latein im Titel einer Dissertation von C.C, Krøyer (1761: 'De sexualitate plantarum ante Linnaeum cognita'). Gut zehn Jahre später verwendet N.J. de Neckar den Ausdruck in einer ebenfall lateinischen Abhandlung über die Physiologie der Moose (1774: 'De sexualitate atque siminalitate muscorum'). In der Übersetzung dieser Arbeit taucht der Ausdruck ein Jahr später im Französischen auf (1775: 'la sexualité & la séminalité des mousses & des plantes pérennelles, I'existence des sexes & des oufs dans les polypes & les reptiles'; 'contre le systéme d'une sexualité universelle'). Bis zum Ende der 1780er Jahre sind es aber nur wenige Autoren, die das Wort verwenden (Lefebvre des Haies 1787: 'la sexualité [von Käferschnecken, Chitonen aus Santo Domingo]'). Auf für das Englische finden sich keine Nachweise vor dem Ende der 1780er Jahre, der erste stammt aus der Rezension eines Gedichts von E. Darwin über die 'Lieben der Pflanzen' (P.P. 1789: 'it is on their [flowers'] sexuality that he has built his poem'; vgl. auch Walker 1797: 'The Linnaean system [...] is founded on the sexuality of plants'. Seit den 1790er Jahren finden sich Nachweise aus dem Deutschen, die die umstrittene Geschlechtlichkeit der Pflanzen betreffen (Anonymus 1790: 'Zweifel [...] gegen die Sexualität der Pflanzen'; Anonymus 1792: 'die Sexualität der Moose'). In den späten 1790er Jahren wird das Thema von vielen Autoren aufgegriffen und der Ausdruck verbreitet sich allgemein (Schelling 1799: 'die allgemein Sexualität in der organischen Natur'; Anonymus 1799: Es werde von J. Gärtner 'den meisten der Gewächse, die unter Linne's Cryptogamie einregistriert sind, theils die Sexualität, theils die Bisexualität abgesprochen'; Anonymus 1799: 'Sexualismus der Pflanzen'). Die Übertragung des Ausdrucks 'Sexualität' auf den Menschen erfolgt erst im 19. Jahrhundert.

Zwitter

Der bereits im Althochdeutschen erscheinende Ausdruck "Zwitter" (ahd., mhd. "zwitarn") bezieht sich anfangs auf genealogische Verhältnisse und bezeichnet ein Wesen von gemischter Rasse, einen Abkömmling von Eltern verschiedener Sorte (»Bastard«). Vereinzelt bereits im 13., verbreitet aber erst seit dem 16. Jahrhundert tritt die genealogische Bedeutung in den Hintergrund und das Wort bezeichnet ein zweigeschlechtliches Wesen, d.h. einen Menschen, ein Tier oder eine Pflanze, die sowohl weibliche als auch männliche Geschlechtsmerkmale aufweist. Als biologischer Terminus, der auch auf Pflanzen und Tiere bezogen wird, erscheint der Ausdruck in der zweiten Hälfte des 18. Jahrhunderts. Bei B. Erhart heißt es 1759: »Diejenigen Pflanzen also, deren Blumen diese beyderley Geburts-Glieder haben, nennet man Hermaphroditen oder Zwitter. Sie machen den größten Theil aus«.

Der ältere Ausdruck zur Bezeichnung zwittriger Wesen lautet Hermaphrodit. In Bezug auf Abnormitäten beim Menschen findet er sich bereits bei Plinius im ersten nachchristlichen Jahrhundert (»Gignuntur et utriusque sexus quos Hermaphroditos vocamus, olim androgynos vocatos et in prodigiis habitos«). Der Ausdruck geht auf die griechische Sagengestalt Hermaphroditos zurück, einen Sohn des Hermes und der Aphrodite, der mit der Quellnymphe Salmakis verschmolz und ein androgynes Wesen bildete. Die Verwendung im biologischen Zusammenhang etabliert sich seit dem Hochmittelalter. Bis zur Neuzeit bildet "Hermaphrodit" aber eine Kategorie zur Bezeichnung von Abnormitäten und Monstrositäten. Als neutraler biologischer Terminus verbreitet sich der Ausdruck erst seit Beginn des 18. Jahrhunderts. S. Vaillant spricht 1718 von hermaphroditischen Blüten (»Flores hermaphroditi«); 1745 bezeichnet dann Bonnet die Blattläuse, bei denen er ihre parthenogenetische Fortpflanzung nachweist, als "Herma phroditen". Im Deutschen erscheint der Ausdruck "Hermaphrodit" in einem neutralen biologischen Sinn Mitte des 18. Jahrhunderts (vgl. das Zitat von Erhart oben).

Linné bezeichnet eine Pflanze, die über männliche und weibliche Blüten verfügt, als androgyne Pflanze (»planta androgyna«) - er nimmt dabei ebenfalls eine Bezeichnung auf, die sich schon bei Plinius fin det (s.o.). Daneben ist außerdem der Terminus Gynandromorphismus verbreitet, um das Phänomen des Vorhandenseins von sowohl männlichen als auch weiblichen Geschlechtsorganen an einem Organismus zu bezeichnen (Wesmael 1836: »gynandromorphisme«; dt. Übers. 1837: »Gynandromorphismus«; engl. 1840: »gynandromorphism«).

Den Hermaphroditismus der Weinbergschnecke beschreibt 1694 der englische Arzt M. Lister. Seit Beginn des 18. Jahrhunderts werden Organismen der verschiedensten Arten als Hermaphroditen erkannt. E. Chalmers führt in seiner Enzyklopädie Insekten, Reptilien, Würmer, Schnecken und auch Pflanzen an. Bei den Pflanzen werden allgemein diejenigen als "Hermaphroditen" bezeichnet, in deren Blüten sowohl Staubblätter (Stamina) als auch Stempel (Pistill) vorhanden sind.

Das Phänomen des Hermaphroditismus zeigt, dass die Trennung der Geschlechter nicht immer mit der Trennung von Individuen zusammenfällt. J. Müller formuliert 1840: »Der Dualismus der Geschlechter ist also nicht nothwendig Dualismus der Individuen. Vielmehr kann die geschlechtliche Zeugung so gut, wie die Knospenbildung und Theilung, von einem einzigen Individuum geschehen«.

  • Hermaphrodit (Plinius um 79) S. 83
  • Monogamie (Tertullian um 200) S. 75
  • Polyandrie (Arnobius 4. Jh.) S. 75
  • Kopulation (Augustinus 418) S. 73
  • Polygamie (Sigebert von Gembloux 11. Jh.) S. 75
  • Zwitter (Anonymus 13. Jh.) S. 83
  • Geschlecht (15. Jh.) S. 72
  • Begattung (Horst 1592) S. 73
  • Polygynie (LaMettrie 1748) S. 75
  • Sexualität (Krøyer (1761) S. 80
  • Konjugation (Treviranus 1804) S. 82
  • Geschlechtsbestimmung (Reil & Autenrieth 1815) S. 84
  • Geschlechtsverhältnis (Memminger 1824) S. 84
  • Gynandromorphismus (Wesmael 1836) S. 84
  • sekundäre Geschlechtsmerkmale (Bennett 1836; Yarrell 1836) S. 75
  • Parasexualität (Pontecorvo 1954) S. 82

Im Nebeneinander der beiden nachfolgenden Inhalte verdeutlicht sich, daß gerade Linnè einst genau auf diese Gegebenheit eingegangen ist, indem dieser eben nicht die aufbringende Anwendung des Geschlechts des Kölreuter übernimmt und somit sich auch nicht auf sexus bezieht, sondern gar demonstrativ das Ermessungswesen des Ganzheitlichen hervorhebt und darüber vermittelt, wie sich diese Andersartigkeit dem gegenüber stellt. So verdeutlicht sich vor allem hierüber auch, daß dieser gar hervorhob, daß sexus sich nicht auf die Geschlechtsorgane bezog, gemäß dem seine Anwendung von sexualis, ohne Bezugnahme zu sexus dies spezifisch ausdrückt. Wie man diversen Schriften entnehmen kann, so ersieht und händelt man seine Ausführung als metaphorisch, ist es jedoch in keiner Weise, sondern im Gegenteil dessen, repräsentiert es das damalige sarkastische Verhältniswesen dieser Gegenüberstellung, das sich als unvereinbar miteinander stellt. Gemäß dem repräsentiert auch Jode über die inhaltliche Darstellung seines Kurpferstichs den vorherrschen makabren Sarkasmus bezüglich der sich überschneidenden Gegebenheiten. Dieses neue Geschlecht basiert nämlich auf der völligen Umkehr der Ermessung, dem gegenüber die Ursprungsbedeutung aus dem Ganzen sich auf das Gemeinsame des Jeweiligen bezieht, hingegen im Neuen aus dem Einzelnen das Gesamte seine Beschreibung erfährt. Das in weder noch die Sinnlichkeit überhaupt Inbetrachtziehungsgegenstand sind, zeigt sich hingegen nicht nur darüber, daß das Wort Liebe nirgends seine Erwähnung findet, sondern vielmehr erweist sich gerade darüber die Beschränkung auf reine Sachlichkeiten. So zeigt sich jedoch hierüber, worauf der weitere Wandel beruhte, daß nämlich beides weder im Nebeneinander, noch Miteinander, seinen Bestand bewahren konnte, da es die darüber auftretenden Widersprüchlichkeiten unübersehbar verdeutlichte, sodaß sich mit den Neuerungen zwangsläufig das Neue als solches bedingendes Einziges umsetzte und das Alte verdrängte, um dies überhaupt etablieren zu können. Gerade hierüber zeigt sich wiederum die klare Ausdifferenzierung von Geschlecht und Sexualität, gemäß dem es bei Linné seine demonstrative Darlegung erfährt und das Geschlechtsorgan als ein Anteiliges, jedoch nicht als Fundierendes darlegt. Man bedenke hierzu die Bemühungen der Gegenwart, das englische Gender in den deutschen Sprachgebrauch zu etablieren, worüber genau dies auch zum Ausdruck gebracht wird, was dem Deutschen heute in der reinen Bezugnahme des biologischen Geschlechts substanziell fehlt. Im Verhältnis der althergebrachten Anwendung ergibt sich hingegen genau das, was man darüber zu integrieren sucht. Über den Geschlechtsbegriff ist dies nach wie vor präsent. Diese ergibt sich jedoch nicht über den Geschlechtsbegriff, sondern über dessen abgrenzende Differenzierung gegenüber dem Sexualbegriff. Darin besteht die eigentliche Veränderung, welche sich unmerklich in dem Wandel vollzieht, indem nämlich im Verlaufe die Vermischungsverhältnisse darin klärten, jedoch sich dies einzig sachlich über das Wirken der Gegebenheiten als solches zeigt, jedoch die Sprache noch im Werden ist, gemäß dem seine anpassende deregulierende Ausbildung zu erfahren.

Linnae Clavis Systematis Sexualis 1735
» Clavis Systematis Sexualis (1758) «
» Carl von Linné «
Nobilium in Belgio Utriusque Sexus Ornatus
» Nobilium in Belgio Utriusque Sexus Ornatus«
» Variarum Gentium Ornatus (1605 - 1610) «
(Costumes of Different Nations)

» Pieter de Jode (der Ältere) «

So ergibt sich primär auch eine spezifische Klärung über den Begriff Sex, welcher ursprünglich in keiner Weise Bestandteil der bezugnehmenden Anwendung war und das Geschlecht sich auch nicht auf die Geschlechtsorgane bezog. Auch dies wiederum verdeutlicht sich über Linnè's Darbietung, wie überhaupt über die Darlegung aus dem Botanischen, worin dies gar nicht Bestandteil des Daseins ist. Betrachtet man sich dem gegenüber die heutige Anwendung, so bildet sich der anwendende Geschlechtsbegriff aus dem des Geschlechtsorgans heraus und wird weitläufig dem gar gleich gesetzt. Maßgeblich ist, daß sich der Sexualitätsbegriff aus dem von Linné aufgebrachten lateinischen sexualis heraus bildete und auf dem sexus beruht, dem gegenüber dieser sich jedoch nicht auf den Sex(ualakt) bezieht, sondern beim sexus gar das Gegenteilige dessen die Grundlage bildet. Tatsächlich handelt es sich beim Sex um einen Slang, welcher sich gegenüber dem Ursprung des Dialekts aus der Hochsprache heraus bildet und somit Sex(ualität) terminologisch gar nicht existiert, sodaß spezifisch hierüber alles durcheinander gerät, gleichzeitig sich darüber aber auch die Aufklärung ergibt. Sprachtechnisch bezeichnet sich dies nämlich, angemessen auch der sachlichen Regularien, terminologisch als Geschlechtsverkehr. So erweist sich jedoch spezifisch die Vermischung des Lateinischen mit dem Deutschen als wesentliches Übel, indem es darin des Trennungswesens entbehrt. So ist 'sexualis' ein neu entstandener Begriff des Lateinischen, welches jedoch das lateinische 'sexus' gar nicht beinhaltet, sowie auch die Sexualität nicht den Sex beinhaltet. Maßgeblich ist dem gegenüber, daß die Darstellungswesen, wie nachfolgend aufweisend, nicht nur nicht auf die Sache, sondern auch gar nicht auf die sprachlichen Regulatoren achten, sodaß sich darüber auch diese Willkürlichkeiten darbieten, wie man sie nachfolgend mustergültig antrifft und darüber ein völliges Unverständnis fördern. Man erklärt ein Wort durch ein anderes und verweist einzig auf 'linguistische' Wortbezüge, sodaß man sich darin einzig im Kreise bewegt und dabei auflöst, was zu trennen ist, sodaß es keine eigentliche Erklärung liefert, sondern einzig verklärt. Dies wird vor allem jedoch potenziert über die Inbtrachtziehung der Vergangenheit aus der Gegenwartsperspektive heraus und der Undifferenziertheit gegenüber der Kulturbezüge, sodaß gerade hierüber die ursprüngliche Bedeutung gar seine gänzliche Umdeutung erfährt.


Band 2 (S. 1328)
» «

sexus_klotz.jpg


Verlag: B.G. Teubner (S. 169)
» «

sexus_vanicek.jpg


Carl Winter's Universitätsbuchhandlung (S. 707)
» «

sexus_walde.jpg

Hierzu einmal die Gegewärtigkeit, wie man sie lexikalisch antrifft:

» Sexualität « (sinngemäß "Geschlechtlichkeit", von spätlat. sexualis; aus lateinisch sexus "Geschlecht"; vgl. Sex) bezeichnet im engeren biologischen Sinne die Gegebenheit von (mindestens) zwei verschiedenen Fortpflanzungstypen (Geschlechtern) von Lebewesen derselben Art, die nur jeweils zusammen mit einem Angehörigen des (bzw. eines) anderen Typus (Geschlechts) zu einer zygotischen Fortpflanzung fähig sind.

Unter » Sex « (englisch für den lateinischen Begriff sexus, deutsch: "Geschlecht") versteht man die praktische Ausübung von Sexualität (Kurzform: Sex) als Gesamtheit der Lebensäußerungen, Verhaltensweisen, Empfindungen und Interaktionen von Lebewesen in Bezug auf ihr Geschlecht.

Im Bezug auf » Geschlecht « trifft man hingegen einzig eine Bezugnahme zu dem grammatikalischen Genus an. Nachfolgend hierzu eine Ausführung bezüglich des lateinischen Genus von Vaniček. Dieser Begriff basiert auf dem Grundstock des altlateinischen gen und in dessen Bezugsverhältnis zeigt sich auch das Gesamtspektrum dessen überhaupt erst auf. Hierzu gilt zu bedenken, daß die lateinische Sprache eine künstliche Sprache ist, worin gerade das grammatikalische Konstrukt die Grundlage der Sprachbildung begründet, wohingegen in den regulären Dialekten die Laute das sind, worüber sich Verbundspräsenzen bilden. Über das Latein und damit verbunden auch dessen wesentlicher Ursprung, dem Griechischen, woraus der weiträumig Grundstock des Lateinischen stammt, zeigt sich somit aber auch unser damit verbundenes Anwendungswesen, welches heute nicht mehr nach den Lauten, sondern nach diesen grammatikalischen Regeln das Maß des Händlings wäre. Das es dem gemäß jedoch nicht gehandhabt wird, zeigt nicht nur die Anwendung von Sex, sondern generell in der grammatikalischen Gegenüberstellung, welche eine ganz andere Norm aufweist, worin vor allem jedoch die neu entstandene biologische Ideologie zur Grundlage der Anwendung des Wortschatzes geworden ist und darüber sämtliche anderen Regularien außen vor stellt, gar die der Grammatik. Hierin hat man neben den neuen Bezeichnungen, die Übernommenen dessen Bedeutungsgehalt angepaßt. Das sich hierin diese gegenüber dem Ursprünglichen gänzlich umkehren, ist das eigentlich Markante darin. Gerade aufgrund dieser Unangemessenheit ist es hierin auch unumgänglich, Sprache und Sache gänzlich voneinander getrennt in Betracht zu ziehen und daraufhin erst beides im Gegeneinander, worüber sich die Gegebenheiten klären, ansonsten hingegen unerklärlich bleiben.


Verlag: B.G. Teubner (S. 48)
» «

genus_vanicek.jpg

ambi 10, uterus 24, gen 48, homo 56, penis 96, vulva 155, sec/sac/sexus 168, sex 206, vagina 149/212, Register 223

Zu beachten ist, was Vaniček's Aufbringen darbietet, nämlich die etymologische Erfassung der Kernstämme der Begriffe und dessen Verbundenheit der darauf aufbauenden Anwendungen. Regulär trifft man hierin, gar im Etymologischen, einzig auf ein rein lexikalisch, nach Buchstaben Orienteres, sodaß darüber auch die Zusammenhänge nicht ersichtlich sind, da der Stamm nicht grundsätzlich die Anfangsbuchstaben begründet, sodaß gerade darüber auch die weiträumig Verlustigung der Worte und deren Verständnis einher geht. Maßgeblich setzte sich jedoch hierüber überhaupt die stattgefundene Veränderung der Umkehr der Bedeutungen um, da es der Bezüge entbehrt, worüber ein solches dies regulär auch verhindert. Auch hierin ist es jedoch wiederum beschränkt, sodaß über den gen-o-Typus nicht das Verbundswesen zum sexus in Erscheinung tritt. Wesentlich ist dem gegenüber jedoch, daß Genus und Sexus sich dem entsprechend grundlegend voneinander unterscheiden. Sie sind keine Einheit. Und so erwirkte sich gerade in dem Bezug auf doppelte Weise die Isolierung des sexus aus, den man zwar noch zum genus die Verbindung aufzeigt, jedoch nicht das dahinterstehende Kompendium zur Inbetrachtziehung gelangt. Wie man daraus ersehen kann, greift hier eines ins andere, dem gegenüber es jedoch dem gegenüber der lateinischen Sprache Ungebildeten jeglichen Nachvollzug überhaupt verhindert, sodaß gerade diesem gegenüber Jegliches in die Begriffe hinein interpretiert werden kann, ohne das diesem auch nur im Ansatz darüber etwas über das Mißverhältnis in Erscheinung treten könnte. Und wenn diese Begriffe dann auch noch von denen ausgebildet werden, welche dafür präsent sind, um die Korrektnes zu gewährleisten, dann wird dies auch regulär gar nicht in Frage gestellt, da man davon ausgeht, daß die Voraussetzungen zur Richtigkeit über das Reglement begründet sind. So haben sich gerade im Bezug auf das Sexualwesen zwar fortwährend die Auseinandersetzungen darauf begründet, zu klären, wie es sich darin verhält, jedoch ist darin einzig die Inbetrachtziehung, daß die Sprache nicht zum Ausdruck bringt, was das Wirk- und Handlungswesen vermittelt. Das man jedoch von Grund auf mit Verfälschungen hantiert, tritt dabei jedoch nicht in Erscheinung. Und somit auch nicht, daß es an des jeweiligen Sprachverständnis hapert - das ersieht man nicht. Vielmehr ist man dabei, noch weitere Worte zu begründen, zur Klärung der Verklärtheit, sodaß sich das Ganze einzig weiter potenziert.

Begibt man sich in den Bezug unserer ursprünglichen Sprache, so erfährt man darüber die Abstammung des Geschlechtsbegriffs, dem gegenüber die Bezeichnung für die Genitalien, das » Gemäscht « nicht übernommen wurde in die hochdeutsche Sprache, hingegen jedoch das damit verbundene » Vermächtnis «. Markanterweise ist jedoch das Gemäscht ebenfalls nach wie vor noch in seiner Anwendung präsent, wie das » Wortschatz-Portal « der Uni Leipzig aufweist. Maßgeblich ist hierin der Fortbestand der Dialekte, worüber auch unsere Ursprachen in ihrem Bestand weitläufig über die verbale Anwendung erhalten blieben. Den Verlauf des allgemeinen Verlustes dessen in der hochdeutschen Sprache, erfährt man hingegen mustergültig über die » Heraldik «. In diesen Verhältnissen verdeutlicht sich dann auch das stattgefundene Ineinanderwirken der Sprachen, wie auch der Bedeutungen. In den Entwicklungen gab es diverse Veränderungen, dem gegenüber man jedoch in der Medizin, gleichermaßen des Rechtswesens, welche maßgeblich unser Wortschatz des Geschlechts- und Sexualwesen prägt, im Verlaufe sich gänzlich im Deklarationswesen lateinisierte, gemäß dem man darin auch eine ganz eigene Sprache anwendet, worin von Grund auf auch die deutsche Sprache nicht beinhaltet ist, sodaß gerade aufgrund dessen es der zweifachen Inbetrachtziehung bedingt, nämlich welcher Sprachgebrauch darin das Jeweilige abbildet und aussagt, was es besagt, wie auch dem des Sprachunkundigen darin, dessen Sprachgebrauch sich aus der Umgangsprache ergibt. Auch dies wiederum führt zu einer weiteren Vermischung, worüber sich jedoch ein ganz Spezielles darüber darlegt, daß man nämlich bewußt das sprachtechnische Einheitswesen darin von Grund auf übergeht. Maßgeblich hierin ist darüber hinaus, daß innerhalb der Wissenschaften noch nicht einmal eine Interdisziplinarität gegeben ist und zwar nicht nur sprachtechnisch, sondern vor allem auch sachtechnisch. So trifft man gar im Sexualbezug auf eine Sexualwissenschaft, welche instituionell gar nicht existiert. So findet jedoch gerade darüber eine Sprachanwendung statt, welche noch einmal dem biologischen Sprachegebrauch entspricht, wie im Einstieg dieser Ausführung dargelegt.

» Mittelhochdeutsche Sprache «

Als mittelhochdeutsche Sprache (Abk. Mhd.) bezeichnet man sprachhistorisch jene Sprachstufe des Deutschen, die in verschiedenen Varietäten zwischen 1050 und 1350 im ober- und mitteldeutschen Raum gesprochen wurde. Damit entspricht diese Zeitspanne in etwa dem Hochmittelalter.

» Mittelhochdeutsches Wörterbuch «
Mainzer Akademie der Wissenschaften und der Literatur
Akademie der Wissenschaften zu Göttingen

» 1gemächt « das; -s/-e auch -Ø, auch die; -(e)s/-e, auch -Ø; zu mhd. gemaht 'testiculi, genitalia'. 'Zeugungskraft; (männliches) Zeugungsglied, Geschlechtsteil, Penis; Unterleib'. do quam ein ander ind stach in in sin gemecht bis hei doit was; geleyt vff den buch zwischen den nabel vnd dem gemechte benympt groß lenden wee; wer geletzt were an dem gemecht / der neme diß puluers; das achte die scorpio, kalt unde nass, wirket an das gemechte; die [mvniche] volgeten des heiligen ewangelien lere mit vnbescheidenlicher vernunft vnd sniten in selben ir gemecht uz vmbe das himelriche; daz pflaster ist gut, wolcher zuprochen ist zu dem gemecht; der Smalnstain stach den Sekendorfer unter dem gemecht ein, das er herab viel und starb; welicher der jüngst unter seinen brüdern seinem vatter das gemächt mit einer sichel außschnitt.; den stach er peim hals in die pruest, darnach ins gmecht und in die stirn;ie adern seiner gemechte die seint verworren; der ließ im ain keil in gemächt schlachen; so war doch die sichtbarlich straff Gottes da, das er ain giftigs geschwer an gemechten bekam; dasselbig [kneblein] auch bey seiner gemecht gestochen, das ime die derm sind drungen; von wunden, von gleichwunden, von geederwunden, von hauptwunden, von gemechtwunden; Halsstich, gemechtstich, zerstich est una cura und habet aliam curam ab aliis; legg das krut denne v́ber die gemaͤht; wjlt du das das har an den gemaͤchten [...] abgange [...] so nim kalch; der meister synne ouch wol geualt das man yme truke gar senfteclich Sin gemächte das es sich Beharnen möge; die Gemaͤcht an einem menschen / die scham; der alt Moyses nam ein messer [...] und offnet da zum ersten dem chindt sein gemacht; also gesoten vnd zerbrochen mit weyn vnd gerüret, würt eyn gut pflaster für die apostem vnd geswulst des gemächts; der priester lag tod, dem warn sein gemácht hoden gar verprant; da geschach an sein gemáchten ain solich zaichen, das ich vor scham nit nennen wil.

» geslaht Adj. « 1 'geartet, geformt, beschaffen', oft in Verbindung mit wol: dâ mite der satel was bedaht, / daz was ein phelle wol geslaht; noch wîzer danne ein snê / ir lîp vil wol geslaht; umb dînen dienest wol geslaht. – vil ~ (häufig bei Konrad von Würzburg): ein spîse cleine [...] nam diu frouwe vil geslaht / und az ir friundes herze gar; diu selbe decke vil geslaht / was über sînen schilt gezogen; ouch hete er [ der künic ] einen turn gemaht / ûz marmelsteine vil geslaht. – subst.: man sach den vil geslahten / ûzerweltiu cleider tragen 2 'jmdm. eigen, gemäß' (mit Dat.): er sprah ze den obezpovmen / selbe habet samen / daz si obez pâren / also in geslaht ware; nû ist mir der touf niht geslaht; diz cleit enwær im [dem Hirten] niht geslaht; mit iuwerm urloub spriche ich daz: / ir tuot als iu wol ist geslaht! – mit Präp. von ‘von jmdm./ etw. angestammt, angeboren' wan daz was im niht geslaht / von vater noch von muoter; im wære ez von dem vater geslaht, / daz er mich solte minnen; sitz ebene und swende sô den walt, / als dir von arte sî geslaht 3 'edel, fein' der getriuwe Tinas, / von arte edel und geslacht. – subst.: ich weiz ir zucht so vil, / der geslachten, wandelvrîen

geslahte stN.geslehte

» 1geslehte « stN. auch geslahte 1 'Abstammung, Herkunft, Art' 1.1 speziell auf den Menschen bezogen 1.1.1 'Familie, Geschlecht' si was von Aarones geslahte; nâch dem geslähte der muoter sîn; wand ime ist von geslehte / nieman sô nâhe sippe als ich; daz er noch enhein daz mensche, daz von sime gislehte iemer giborn wirt, niemer enhêin ansprach sol giwinnen wider daz closter ze Gv́nterstal; ich und du [Symeu und Lancelot], wir sint beide eins geslechtes, ich bekenne dich baß und din macht dann du selber tuͦst; von fast hohem geschlecht; van gueder art gesleichte; von kunichlichem geslâht. – Verwandte einer des byschofis knehte, / der ym an horte von geslete, / an dem doch Petrum vngefug / det vnd daz ore ym abe geslug; miner muoter, / minen swestren, minen bruoderen / unde anderme mime geslehthe; Conrat vnd Matze Eppelins kint vnd alle die geslechte, die dar nach ze rechte gehorent. - 'Volk, Stamm' da waren diu edeln geslæcht [Stämme] diu von Juda geborn waren; diͤ in al den jüdschen geslechten / engein kint zuͦr werld enbrechten; die / geslecht der Israhelen– in dimme [Abrahams] geslæhte wirt gesegenot allez irdiscez geslahte; mænnschleich gesleht [Menschheit] zergænchleich ist 1.1.2 'Generation' von erbe und von aigen, wi iz erbe von vater und von mueter auf daz ander geslecht 1.1.3 Gesamtheit von Personen mit einer bestimmten Eigenschaft, 'Typ, Menschenschlag' ûz der tjoste geslehte / wârn si bêde samt erborn; es ist ainerlai pillde der pösen und von dem geschlächt der übeln [de genere malorum]; vir geslechte [genera] sint der muneche; wer in dem schütz sich birt, [...] hat zu jegerie phlicht, / von sim geslecht er sere ficht 1.2 allg. auf Tiere, Pflanzen u.a. bezogen 1.2.1 'Sorte, Typ' schaw, wie iesleich gesläht der visch sein besunder lant hât; daz ist ain mervisch und ist der sneken geslähtes; der wurm ist âmaizen geslähtes, er ist aber vil grœzer denn ain âmaiz; wurze unde sâmen nâch iegelicheme geslahte; in dem [Garten] sind mißlich geschlächtt fruchpär paum. – 'Beschaffenheit' von Steinen: des steines geslehte, / sîne lîhte und sîne swâre; ez [das Bett von Anfortas] was tiwer unde wæhe / von der edeln steine geslehte; granât ist von des jâchants art und ist seines geslähts 1.2.2 lexikogr. Sachverhalt: auf die Herkunft eines Wortes bzw. auf dessen Wortfamilie bezogen: scandalum ist ein fromedez wort. nehat eigines gediutes niht. also gniugiu wort endriu dei anegenges unde geslahtes nihne habent 2 'Sexus, Geschlecht' uon wiplicheme geslahte / so geshiht dir uil rehte; der part an dem menschen bedäut mannes gesläht

» 2geslehte « stN. zu slahte 'das Geschlachtete' dem probst von Gysenvelt git man [...] zwo schultrig vnd zwo hammen von dem geslaehte [de duplici mactatura] (13. Jh.); daz hovpt vnd daz inner gslæhte (13. Jh.); würste und hammen, guot geslechte / ouch in rechte herbest birt

» geslehtebuoch « stN. 'Ahnentafel, Stammtafel' von der maget Marîen swestern und von ir sünen. / von dien zwelven, sô ich nû / genant hân, der wârn Jêsû / fünve sippe, als üns saget / daz geslähtebuoch der maget

» geslehtede « Subst. 'Verband, Geschlecht, Stamm' tribus: geslehtede

» sleht « (Belegarchiv - Liste textualer Vorkommnisse)

Wie man dem Mittelhochdeutschen entnehmen kann, so besteht bezüglich des Geschlechtsbegriffs eine nahe Verwandschaft zum Anwendungswesen des lateinische Genus. Und über die nachfolgende Frühneuhochdeutsche Ausführung erfährt man auch das spezifizierende jeweilige Bezugswesen. Wie stellt sich dies jedoch gegenüber der heutigen Anwendungspräsenz? Hierüber verdeutlich sich nämlich, daß es bei dieser Anwendung gar nicht um eine fixierende substanzbezogene Bedeutung handelt, sondern um ein Prinzip. Die Substanz selbst erfährt darüber gar nicht sein Abbild, was sich über die Vielfalt der diversen Anwendungen verdeutlicht, worin die Bezugnahme jeweils gar nichts mit dem eines anderen überhaupt etwas gemein hat. Was sich hierüber aufzeigt ist, daß es sich bei der ursprünglichen Anwendung um ein Adjektiv handelt, dem gegenüber es sich jedoch bei der neuerlichen Anwendung des biologischen Geschlechts um ein fixierte Substanbezogenheit und somit um ein Substantiv handelt. So wird darüber dann auch ersichtlich, worin die sprachtechnische substanzielle Veränderung beruht und man in dem Neuerlichen den bedingenden Bezug zu den Geschlechtsorganen pflegt, was die Substantivierung nämlich bewirkt. Gleichzeitig verdeutlicht sich aber auch hier wiederum, warum das Alte mit dem Neuen im Nebeneinander gar nicht funktionieren konnte, denn hierbei handelt es sich nicht um eine reguläre Synonymität eines Gleichen oder Ähnlichen, sondern um ein gänzlich anders, einander widersprechendes, welches jedoch in der rein sprachtechnischen Unterscheidung als solches gar nicht ersichtlich ist und sich einzig in und über die Anwendungsform unterscheidet. Vielmehr führt dies jedoch im Nebeneinander dazu, daß in der Inbetrachtziehung des Einen zwangsläufig auch das Andere darüber in Erscheinung tritt, dessen bedingende Trennung jedoch sich als voraussetzende Grundlage der Anwendung erweist.

» Frühneuhochdeutsche Sprache «

Als frühneuhochdeutsche Sprache, kurz Frühneuhochdeutsch (Abk. Fnhd. oder auch Frnhd.), bezeichnet man die älteste Stufe des Neuhochdeutschen, die zwischen dem mittelalterlichen und neuzeitlichen Deutsch angesiedelt ist. Die Periode der frühneuhochdeutschen Sprache wird ungefähr von 1350 bis 1650 angesetzt. Beispiele für Textzeugnisse dieser Sprachstufe sind die Schriften von Paracelsus ab 1529 und Luthers Bibelübersetzung von 1545.

» Frühneuhochdeutsches Wörterbuch «
» Mitte des 14. Jahrhunderts bis zum beginnenden 17. Jahrhundert «
» Akademie der Wissenschaften zu Göttingen «
» Alphabetischer Einstieg «

» geschlecht «

das;-(e)s/-e, -er, auch -Ø. - 1 generisch auf Untergliederungsverhältnisse bezogen, 3-9 auf Gruppen von Menschen, davon 7-9 auf Abstammungs-, Verwandtschaftsverhältnisse, 10 daran metonymisch anschließbar, 11 und 12 für Pflanzen- bzw. Tiergruppen.

1. >diejenige Gruppe, Art, Spielart, Untereinheit von Gegenstandsklassen (Konkreta, Menschen, Handlungen u.ä.), die durch Gliederung, Einteilung gewonnen wurden und dementsprechend durch ein Differenzkriterium von einer anderen Untereinheit derselben Gegenstandsklassen unterscheidbar sind<.

2. >Art, Wesen, Substanz<; in beiden Belegen auf Gott bezogen.

3. >menschliches Geschlecht, Gesamtheit aller Menschen, wie sie von Gott geschaffen, durch Eva in Sünde gefallen und von Christus erlöst worden sind<, überwiegend negative Sicht.

4. steht mit vorangehendem Adjektivattribut oder einer funktional ähnlichen, oft quantifizierenden Bestimmung für den Inhalt des Attributes oder der attributähnlichen Bestimmung, z.B. das auserwälte geschlecht >die Auserwählten<, alle geschlechte >alle Menschen, alle Völker<; in Beispielen dieser letztgenannten Art auch an 7 anschließbar.

5. >Geschlecht, Sexus des Menschen<.

6. >Großgruppe von Menschen, die geschichtlich, kulturell, religiös, sprachlich wie in ihrem jeweiligen zeitgenössischen Handeln als relative Einheit auftreten oder wahrgenommen werden, die man wohl auch an bestimmte geographische Räume bindet, insofern Nähe zu heutigem Volk im nicht terminologischen Sinne<; offen zu 7.

7. >Geschlecht, Familie in der Regel adligen, vereinzelt bürgerlichen Standes mit hoher administrativer / politischer Funktion in einem Gemeinwesen oder Herrschaftsgebilde; zum Patriziat einer Stadt gehörende Adelsfamilie<; offen zu 8; 9; 10.

8. >Geschlecht, Familie, Sippe, Stamm als Gesamtheit aller von einem Stammvater hergeleiteten Angehörigen / Blutsverwandten<; vielfach auf die 12 Stämme des alten Israel bezogen; im Unterschied zu 7 eher die Familienzugehörigkeit als die administrative / politische Funktion meinend.

9. >(meist) hohe Abstammung, Herkunft, Geburt e.P. oder seiner Familie<; eng an 7 und 8 anschließbar, im Unterschied zu diesen mit Betonung des Herkunftsgedankens; zu dessen Rolle im Prozeß der Bildung und Sicherung von Erinnerung s. Müller, Gedechtnus.

10. >Generationenfolge eines Geschlechtes; Generation; Nachkommenschaft<; ütr. bzw. generalisiert: >Trieb (eines Gewächses)<.

11. >Gruppe, Familie einer übergeordneten Klasse von Pflanzen<.

12. >Gruppe, Untereinheit, Familie einer übergeordneten Klasse von Tieren<.

Was weitläufig in etymologischen Ausführungen keinerlei Beachtung findet ist, daß es sich bei den aufzeigenden Anwendungen, so auch bei 'geslehte', um diverse Flexionen/Deklinationen/Schreibweisen handelt. Maßgeblich hierin ist, daß es zuvor gar keine Einheit gab, es sich um unterschiedliche Kulturkreise, wie auch diverse Lebenskreise handelte und auch die Schreibweisen, wie eben auch im Lateinischen anzutreffen ist, nicht einheitlich ist, da der Grundstock die Verbalsprache ist und nicht die Schrift, sodaß beim Herauslesen von Bedeutung und Schreibweise die zu differenzierenden Verhältnisse und Vermischungen zu berücksichtigen sind. Umso weiter zurückliegend, umso vielfältiger ist auch das Antreffen. Über das » Bayerische Wörterbuch « von Schmeller erhält man einen spezifischeren Ausblick darauf, worüber die unterschiedlichen kulturellen Herkünfte auch deutlicher hervortreten. Des weiteren zeigt sich gerade hierin, daß man sich einzig auf Rückläufiges bezieht, ohne die Entstehung des Geschlechtsbegriffs als solchen spezifisch in Betracht zu ziehen. Jeder einzelne Begriff hat eine eigene Geschichte und gerade dies wird in den Etymologien rein maschinell übergangen. Wie die Ausführungen darbieten, so betrachtet man die Gegebenheiten aus dem Verhältnis neuerlicher Händlings, vor allem weitläufig auch im Prinzip reiner Grammatik, wobei gerade diese doch erst über das entstandene Hochdeutsch seine regulierende Präsenz erfuhr.

In Anbetracht der Gegenüberstellung des lateinischen Wortstammverhältnisses von genus zeigt sich indess, daß sich für geslehte eine Besonderheit ergibt, welche sowohl bei diesem, wie auch beim Geschlecht, die Grundlage bildet und sich darin verbindet, nämlich der gebildete Wortstamm auf dem Gegensatz von sleht/schlecht. Die Etymologien besagen, daß der Ursprung 'slahte' sei, was sich jedoch als eine Vermischung aufweist, vor allem jedoch als eine vergleichende Bezugnahme zum lateinischen 'genus'. Gravierend hierin ist, daß 'sleht' und 'geslehte' sich in ihrem Bedeutungsgehalt substanziell derart gravierend unterscheiden, gegenüber dem Verbund von 'slaht' und 'geslaht', sodaß es sich in seiner Bedeutung gar nicht in Verbindung bringen läßt (sleht ↔ slaht). Vielmehr legt sich darüber dar, daß sowohl 'geslehte', wie auch 'Geschlecht' selbst ein Wortstamm sind und 'geslehte' sich als Vorstufe des Geschlechts erweist. Im Gegensatz dazu sind es nämlich anderweitig im alt(hoch)deutschen Wortstämme, worauf dies jeweils aufbaut, gemäß 'slaht(e/a)' präsent (slahte, slahta, gislaht/ungislaht, gaslati, geslaht, ...).

Als leittragendes Kriterium erweist sich darüber hinaus indess das untrennbare Verbundswesen mit Gesinde, gemäß dem es das Eine nicht ohne das Andere gibt. Dies geht im Alt(hoch)deutschen u.a. als gisindi neben gislahti einher. Und über diesen Verbund legt sich dar, daß hierin eine andere substanzielle Grundlage die Wesensart bildete, wie es beim lateinischen genus der Fall ist. Gerade der Verbund mit dem Gesinde ist, was beim lateinischen genus nicht existiert, sich hingegen darin gemäß des nobilitas als solches separiert. So ist es hierin auch das Verhältnis von Gesinde zu Gesindel, worüber sich die diversen Vermischungen und Wandel entsprechend darlegen.

» Mittelhochdeutsches Wörterbuch «
Mainzer Akademie der Wissenschaften und der Literatur
Akademie der Wissenschaften zu Göttingen

» gesinde «
stN. auch gesint, aus ahd. gasindi.

1 'Gefolgsleute, Begleiter, Gefährten' (s.a. ingesinde stN.): wer leitet nu die lieben schar? / wer wîset diz gesinde?; Irmschart und Heimrîch / dâ kômen mit grôzem gesinde: / vier vürsten, ir zweir kinde, / siben tûsent ritter oder mêr; darnach solt ir myn [der Königin] ritter sin und von mym gesinde; der tiuvel unde die gîtigen unde die ketzer unde die wider den heiligen geist dâ sündent, daz ist allez éin kumpanîe und éin gesinde; ‘ich urteile, als ich vinde’, / sprach er zu sim gesinde [Jünger Jesu] , / mit sant Johannes ich ez wol beziugen. – in Verbindung mit himelisch: [Maria] is ruom allis himiliscis gisindis; in den alten zîten / vor aller slahte liuten / do erwelete im daz gotes kint / in sîn himelischen gesint / ein juncfrowe guote, / sante Margarête. – im Kampf oder Streit (s.a. vuoʒgesinde , reitgesinde ): dô was ouch daz gesinde ze strîte hêrlîchen gar; die von ir gesinde dâ / ze velde lâgen erslagen, / die hiezen si ze grabe tragen; weliche stat die andern also manti umbe ein gesinde, die sol dem gesinde halben kosten und schaden geben, die wil ez in irme dienste ist. – übertr.: der tôt der suochte sêre, dâ sîn gesinde was. / der von Bechelâren dô langer einer niht genas; der jeger [...] gesach zehant dar inne / daz gesinde der minne: / niwan ein wîp und einen man; galander unde nahtegal / die begunden organieren, / ir gesinde salûieren; füeret in eht gegen dem galgen unde gegen des galgen gesinde [ die erhangenen unde die erslagenen ]. – Paarformel: dû erlâst dîns nîdes niht / daz gesinde noch die geste; von gesinde noch von gesten / wart geherberget / sô wunneclîchen alse hie

2.1 Familie: in der arche obene was mit sinem gesinde Noe / er und sine gemahele, sine snur und ir winige; die dritten die dir bî den füezen sint bezeichent, daz ist dîn gesinde, daz under dir ist: kint und hûsfrouwen

2.2 Dienerschaft, Gesinde: der butil der in sal abir nicht gebietin deme gesinde in irs herrin hus; vil grôze klage man dâ vant / under dem gesinde; leigen unde alle der gesinde [ familia ] , dî dâheime wonent; von dem erbe sol man alrêrste gelten dem gesinde ir verdientez lôn; man sol daz gesinde behalten biz zem drizegesten, daz si sich die wile besteten; des vicetuͦms gesinde, die zu irme brode gen und die in irme huse slafen, uber die sulen si richten

» gesinde, gesint «
stswM. aus ahd. gasindo und gasint.
'Angehöriger eines Gefolges, Diener, Begleiter' (s.a. ingesinde swM.)

der tiufel durch ubermuot wesen wolte same got, / unt er in verwiez daz er in ab deme himele stiez, / jouch sîne gesinden alle sant in die helle; pharao daz zeichen gesach, ez doͮhte in ungemach, / er hiez im gewinnen di zwene gotes gesinde; sît daz ich [ Eckewart ] alêrste iuwer gesinde wart, / sô hân ich iu mit triuwen gedienet; der wirt, der danne des badhovses phleger ist, sol chainen christen baden ze chainer stunde, der niht ir [der Juden] gesinde ist, burger noch gast noch ledigen man. – er hiez in geben wagene mit guote geladane, / dâ man ûffe fuorte wîb unte chint jouch anderen gesint. – übertr.: der tievel [...] fuoret di [Verdammten] mit grimme zuo anderen sinen gesinden / in den ewigen tot; fröiden schîn treit ûzzerthalb der welte vor mîn lîb [...] [während innerlich Trauer herrscht] sô bin ich der welt gesinde

Divider

» Frühneuhochdeutsches Wörterbuch «
» Mitte des 14. Jahrhunderts bis zum beginnenden 17. Jahrhundert «
» Akademie der Wissenschaften zu Göttingen «
» Alphabetischer Einstieg «

» gesinde «

Bedeutungsverwandte: geschlecht (das) 8; sipschaft, stam 3

1. >Familie, Stamm, Geschlecht (als Familienverband gedacht)<; die historische Tiefe des Geschlechtes und die Zugehörigkeit der Ehefrau werden in den Belegen nicht angesprochen.

2. >zu einem bäuerlichen, handwerklichen Haushalt bzw. einer als Haushalt gesehenen kleineren Wirtschaftseinheit gehörende Personen; Gesamtheit der Familienangehörigen, Dientboten, Knechte, Mägde, näheren Verwandte< ; vereinzelt ütr.: Christi gesinde ; teils bildlich gebraucht.

3. >Gruppe von Menschen, die einen Wirtschaftsbetrieb (z. B. einen landwirtschaftlichen Hof, ein Bergwerk, eine Bank) oder einen einem Wirtschaftsbetrieb ähnlich gedachten Hofstaat in dienender, helfender, allseitig unterstützender Funktion aufrechterhält<; je nach Art der Einheit im einzelnen: >Dienerschaft; Belegschaft; Arbeiterschaft<; >Hofstaat<; mit dem Blick auf Himmel und Hölle: >Gott umgebende Schar der Engel oder herausgehobener Himmelsbewohner< bzw. >Dienerschaft, Handlanger des Teufels<; vereinzelt ütr. im Sinne von: >helfende Seelenkräfte< eng an 2 anschließbar, im Unterschied dazu aber mit schwächerer Ausprägung des Familien- und Haushaltsgedankens.

4. >Gruppe von Menschen, (vereinzelt: von Tieren), die sich mit jm. auf einer Reise, auf Wanderschaft o.ä. befinden, (auch:) die js. Lebensgang teilen, Begleitschar, Begleitung (kollektiv)<; speziell: >Jüngerschaft Jesu<; auch: >einzelner Begleiter<

5. >militärische Gefolgschaft, Truppe, Truppenteil; Häscherschar; als militärisch organisiert gedachte Gruppe von Helfern<; auch bildlich gebraucht.

6. >Gesindel, Pack, diejenigen Schichten und Gruppen von Menschen, die man am Rande bis außerhalb der Gesellschaft situiert sieht, denen man (berechtigterweise oder zur Herausstellung der eigenen Ordnungskonformität) alle möglichen Vergehen (z.B. Diebstahl, Betrug, sittenloses Verhalten) zuschreibt und die man der Agitation gegen herrschende Überzeugungen, der Unterminierung des gesellschaftlichen Zusammenlebens verdächtigt<; teilweise Bezug auf Herrschaftsfunktionäre (cardinäle, juristen, richter, des babstes gesinde, pfaffen), sofern sie ihre Position zur Bereicherung nutzen; in gesinde (das ) 6 überlagern sich soziale, sozialkritische, armuts- und fremdheitsbezügliche mit religiös-konfessionellen Einstellungen; mehrfach: >fahrendes Volk<; auch >Teufelspack<

So erweist sich sowohl 'geslehte', wie auch 'Geschlecht', als eine vereinheitlichende Eindeutschung, dem gegenüber sich über die diversen Anwendungen zeigt, daß hierüber einzig die Wortwahl weitläufig und auch nicht generell, eine einheitliche wurde, indess die diversen Herkunftsunterschiede der Bedeutungen sich neben dem und auch darin erhielten, sodaß gerade darüber auch jegliches damit Verbundene ineinander und somit durcheinander geriet. Gerade dies verdeutlicht sich speziell an dem Muster von Gesinde und Gesindel, was sich nämlich auch auf die gleichen Personen bezog, aus unterschiedlichen Warten heraus in Betracht ziehend. Hierüber wandelte sich vor allem die Spezifizierung der Gegegebenheit zu der der gänzlichen Relativität dessen, indem nicht mehr die geschlossene Einheit des Subjekts als solche ihre entsprechende Inbetrachtziehung erfuhr, sondern die von Außenstehendem als Objekt dem gleichzeitig gegenüber steht. Maßgeblich ist somit auch, daß sich sowohl geslehte, wie auch Geschlecht als ein neuer Wortstamm aufweist, worin gar nicht dessen Bezug des Stammes (sleht/schlecht) seine Anwendung und Inbetrachtziehung erfährt. Und darüber zeigt sich auch, daß es sich dabei nicht um einen Begriff handelt, sondern um eine Benamung. Der Bezug des Ursprunges ist hierin überhaupt nicht gegeben und so führt gerade dieses Gegenüberstehen zur allgemeinen Verwirrung, mustergültig u.a. bei Linné, da hierin ein völlig anderes Bezeichnendes dem Verbundswesen der Begrifflichkeit gegenüber steht - ein Bezeichnendes, welches der des Begreifens entbehrt. Es repräsentiert etwas völlig anderes und ist fundiert auf einer Inhaltslehre, welche sich erst erfüllt durch das, was es befüllt.

Und so bestand auch die eigentliche Misere darin, daß sich beides miteinander vermischte und darüber bewirkte, daß beides miteinander in dem Gemeinsamen des Maßnehmens sich vereinigte, dem gegenüber sich darüber zunächst klärte, daß auch das Gemeinsame des gleichen Geschlechts gar nicht als Substanz eine Gegenheit ist, sondern sich überhaupt erst durch die substanzielle Befüllung ergibt. Dem gegenüber hat man jedoch dem eigenen Geschlecht eine Substanz zugesprochen, worüber sich erst in der Gegenwart bewahrheitet, daß auch dieser diese Substanz gar nicht als solche gegeben ist, sondern erst über die Erfüllung zu einer solchen wird. Gemäß dem stellt es sich indess gleichermaßen auch mit der Begrifflichkeit, daß sie sich einzig durch dessen Definition befüllt und einzig gemäß dem repräsentiert, was es ist. Sprache und Sache gehen hierin Hand in Hand, dem gegenüber es die einen Menschen gibt, welche dies achten, hingegen andere Substanzen bilden, die gar nicht sind. Über den Begriff des Geschlechts zeigt sich dies in seiner allseitigen Umfänglichkeit, wie es sich damit verhält. So bildet man in der Biologie auch zunächst den Grundsatz, daß sich das Geschlecht über die Geschlechtsorgane definiert, dem gegenüber man in dem Ursprünglichen des Begriffs an den Grundsätzen des Seinsverhältnissen der substanziellen Begrifflichkeit festhielt und darüber das Gemeinschaftswesen sich auch nach wie vor gestaltet, nur das man dies anders und differenzierender benennt. Über die Fortpflanzung erfährt dies jedoch kontinuierlich sein Dereglement, gemäß dem sich auch die kulturellen und sprachlichen Wandel ergeben.

Dem gegenüber besteht jedoch bis heute nicht nur ein gänzliches Unverständnis diesem Sachstand gegenüber, sondern man trifft auch auf eine systematische Ausgrenzung des Realwesens, was sich mustergültig über Pfeifer's Etymologisches Wörterbuch darlegt, worüber sich die konkretisierende Aufklärung der Geschicht' in seiner Umfänglichkeit beschreibt. "Geschlecht (eigentlich Geschlechtsteil)" lautet dort die indirekte Aussage, welche sich über das Lemma » Geschlechtsteil « darbietet, dem gegenüber der Artikel über das » Geschlecht « markanterweise den identischen Text beinhaltet und auch die Ursprüngsbezüge mit beinhaltet. Der Sachstand ist der, daß man ursprünglich in der Biologie sich von dem Ursprung abwandte und dem gegenüber das Geschlecht über die Geschlechtsteile bestimmte, hingegen dies zwischenzeitlich eine Veränderung erfuhr und man dies mittlerweile über die Gene bestimmt. Jedoch ist dies wiederum nicht identisch mit dem, was die Geschlechtsteile besagen. Es handelt sich hierbei um eine völlig andere Bezugnahme. Dies verdeutlicht sich im Umgang mit Hermaphroditen, welche man dem gemäß auch umbenennt in Intersexuelle und man diesen die 'Geschlechtsteile' entfernt, welche nicht der genetischen Aussage über das Geschlecht entsprechen. Hierüber konkretisiert sich auch der Sarkasmus, welcher bereits seit seinen Ursprüngen die Auseinandersetzung zwischen der Abbildung der künstlichen und natürlichen Systeme begründet, daß nämlich die künstlichen Systeme nicht die Natürlichkeiten abbilden. Daraus entsteht augenscheinlicherweise die Gegebenheit, daß sich der Mensch anmaßt, die Natürlichkeit der Dinge bestimmen zu können, jedoch irrigerweise aus Gegebenheiten, woraus es sich einzig anteilig bestimmt. Die Entfernung der Bestandteile führt indess nicht zur Abbildung des Ganzen, sondern im Gegenteil, führt dies überhaupt erst zur Erwirkung und darüber auch der Darlegung seiner Unvollständigkeit. Dies bezeugt vor allem auch über das Äußerliche, über das sich äußerende Wirken dessen, über das Verhältnis beiderlei Wirken, da es sich nämlich nicht nur in des Jeweiligen Selbst als solches äußert, sondern auch anderen gegenüber ersichtlich ist. Darüber ist es auch zur allgemeinen Auseinandersetzung damit gelangt und begründet die neuzeitlichen Genderdebatten. Die auseinandersetzende Grundlage hierin ist, daß sich über die Gene eben nicht bestimmt, wie es sich mit dem Geschlecht verhält und auch nicht alleine über die Geschlechtsteile, sondern daß darin mehr als das das Sein bestimmt und dies entsprechend zu achten ist. Die Sachlage bestätigt hierin auch die Sprachlage, die es gleichermaßen besagt über den Umfang seiner Präsenz und gerade darüber läßt es sich auch daraus herauslesen, wie es sich damit verhält. Und markanterweise verfügen wir über keinen deutschen Begriff für Gene und auch der Geschlechtsbegriff ist nicht darauf bezogen und darüber ergibt sich auch der Hinweis darauf, wie sich dies abseits dessen fundiert.

» Etymologisches Wörterbuch des Deutschen (DWDS - 1993) «
Wolfgang Pfeifer

» Geschlechtsteil «
(identisch mit » Geschlecht «)

Geschlecht n. 'Gesamtheit der Merkmale, die ein Lebewesen als männlich oder weiblich bestimmen, Familie, Generation, Art, Genus', ahd. gislahti n. (um 1000), mhd. gesleht(e) n. 'Geschlecht, Stamm, Abkunft, Familie, Gattung', mnd. geslechte, mnl. gheslachte, gheslechte, nl. geslacht steht als Kollektivum neben gleichbed. ahd. slaht n., slahta f., slehti n., mhd. slaht(e) f., slehte n. Beide Abstraktbildungen gehören zu dem unter schlagen (s. d.) behandelten Verb (mit grammatischem Wechsel von g und h) in seiner Bedeutung 'sich in einer bestimmten Richtung entwickeln, nach jmdm. geraten, jmds. Art haben, nacharten'; vgl. nach jmdm. schlagen 'geraten' (bereits ahd.), aus dem Geschlecht, aus der Art schlagen (16. Jh.). Geschlecht bezeichnet die blutsverwandte (vornehme) Familie, Nachkommenschaft, die (vornehme) Abstammung, das Volk, die Menschheit (entsprechend lat. genus); dann (im Spätmhd.) auch das natürliche (männliche oder weibliche) Geschlecht (entsprechend lat. sexus) und (seit etwa 1400) das grammatische Geschlecht (lat. genus). geschlechtlich Adj. 'das Geschlecht betreffend, sexuell' (Anfang 19. Jh.). geschlechtslos Adj. 'zu keinem Geschlecht gehörend' (18. Jh.). Geschlechtsteil n. (18. Jh.), Übersetzung von lat. pars genitalis. Geschlechtstrieb m. 'Fortpflanzungstrieb' (18. Jh.). Geschlechtswort n. 'Artikel' (17. Jh.), Verdeutschung von lat. articulus.

» Gesinde «
(Vielfalt an Kulturbezug gegenüber Geschlecht)

Gesinde n. 'Gefolgs-, Kriegsleute, Hausdienstleute, Knechte und Mägde eines Bauern-, Gutshofes', ahd. gisindi (9. Jh.), asächs. gisīði, mhd. mnd. gesinde, (mit Assimilation) gesinne 'Begleitung, (Kriegs)gefolge, Dienerschaft' (germ. *ga-sinþja-) sind Kollektivbildungen zu stark flektiertem ahd. gisind (9. Jh.), mhd. gesint, asächs. gisīð, aengl. gesīþ (germ. *ga-sinþa-) und schwach flektiertem ahd. gisindo (9. Jh.), mhd. gesinde, aengl. gesīþa, got. gasinþa, anord. sinni 'Gefährte, Weggenosse, Gefolgs-, Dienstmann, Hausgenosse' (germ. *ga-sinþan-). Die Personenbezeichnung ist ein Präfixkompositum zu ahd. sind 'Weg, Richtung, Seite', mhd. sint, auch 'Reise, Fahrt', asächs. sīð, aengl. sīþ 'Weg, Gang, Reise', anord. sinn 'Gang, Fahrt', got. sinþs 'Gang' (germ. *sinþa-) und meint ursprünglich den, 'der den Weg, die Reise gemeinsam mit (einem) anderen macht', das Kollektivum Gesinde dagegen die 'Gesamtheit der Begleiter, Gefährten auf dem gemeinsamen Weg, auf der Reise'. Zur Bildungsweise s. Bauer3, Genosse, Geselle, Gefährte; zur Etymologie des Grundworts s. senden. Dazu die Deminutivbildung Gesindel n. 'kleines Gefolge', mhd. gesindelin, dann 'Hausleute, kleine Dienerschaft', vor allem jedoch pejorativ 'heruntergekommenes, sich herumtreibendes Volk, Pack' (16. Jh.).

Elementar in dem Wandel, hin zur neu bildenden, alles miteinander verbindenden Hochsprache, sind zwei sprachtechnische Bestandteile, wie nachfolgend beschrieben, nämlich zum Einen der Wandel in eine Sprache, welche aus der Grammtik heraus gebildet wird, während zuvor diese nur indirekt überhaupt Bestandteil war. Zum Anderen, damit verbunden jedoch, findet darin eine Atomisierung des Jeweiligen statt, gemäß der erforderlichen Erfüllung der Funktionsweise der Grammatik, die sich aus ihren isolierten und darüber individualisierten Fragmenten zusammensetzt, dem gegenüber zuvor eine solche Isolierung von Einzelnem ebenfalls nicht existiert. Dies geschieht über eine mathematisch systematische Ordnung des Konstrukts. Maßgeblich ist darüber hinaus vor allem, daß dies darauf basiert, das Subjekt aus den Bestandteile heraus zu eliminieren und dies separierend als grammatikalisches Subjekt dem wiederum zuzufügen, sodaß jedoch das Jeweilige dem gegenüber als Neutrum darin präsent ist. Dies verdeutlicht sich vor allem über den noch heute präsenten Dialekt, in welchem in der Artikulierung grundsätzlich die Wiederspiegelung des Selbst, die Grundlage der Bezeichnungen und Aussagen bildet. So existiert darin z.B. auch nicht das Neutrum 'Hund', sondern dieser erfährt nicht nur davon sich unterscheidende Bezeichnungen, sondern die Jeweiligen Gleichen sind jeweils wiederum subjektiviert, entsprechend des Aussagenden und seiner Bezüge. Im sich neu bildenden Slang hingegen praktiziert man dem gegenüber eine Um-, bzw. Rückbildung aus dem hochdeutschen Sprachschatz heraus, worüber dies gleichermaßen in Erscheinung tritt. Wie Viti hervorhebt, erfährt das Einheitswesen, so auch der Kontext, gar nicht seine Inbetrachtziehung in der Sprachforschung. Darüber hinaus trifft man jedoch generell einzig auf ein lexikalisch Begründetes, gar in der Etymologie, worüber das alte Konstrukt somit auch gar nicht gemäß dem in Erscheinung tritt, da darin einzig die isolierten Fragmente des grammatikalischen hochdeutschen Verhältnisses abgebildet sind. Und selbst im Falle des Geschlechts, wo dies absolut nicht übersehbar ist, gelangt dies nicht zu seiner erforderlichen Sichtung. Hierzu gilt es anzumerken, daß Diejenigen, welche über einen Dialekt verfügen, auch andere Dialekte, ohne sie speziell zu erlernen, nachvollziehend in Sprache und Inhalt verstehen können, hingegen Diejenigen, welche ohne Dialekt aufgewachsen sind, in keiner Weise auch nur im Ansatz Dialekte nachvollziehen können, da das Kernwesen ein völlig anderes ist.

Elementar bezüglich der Entwicklung und Anwendung dieser künstlichen Sprache, gegenüber der Natürlichen, ist darüber hinaus vor allem, was über De Saussures Aussage zum Prinzip dieser Arbitrarität, wie es sich bezeichnet, dargelegt wird, daß es sich hierbei nämlich primär um das erforderliche Prinzip der Sprachübertragbarkeit handelt. Hierzu gilt es zu bedenken, daß dies auf dem lateinischen Anwendungsprinzip basiert, welches sich darin gegenüber dem griechischen abgehoben hat, indem zwar die Begriffe, aber nicht die Funktionalität der Sprache übernommen wurden. Maßgeblich hierin ist, wer die Lateiner überhaupt waren, was den Umstand erklärt, denn sie waren fast gänzlich keine entstammenden Römer, sondern in anderen Kulturen Befindliche und aus anderen Kulturen Stammende, wie auch die Sprache in seinem Grundsatz zu einem generellen Kommunikator zwischen den Sprachkulturen fungierte (relativ dem des heutigen Englisch). Aus dem Grund bedingte es auch dieser speziellen Sprachbildung, die nämlich nicht als reguläre Sprache fungiert, sondern eine auf einem 'Sprachkode' basierende Formalsprache, gemäß dem sie sich grundsätzlich von der Umgangssprache unterscheidet. Hierzu gilt es ebenfalls auf die Gegenwart des Dialektes und Slangs hinzuweisen, dem gegenüber das Hochdeutsche den Anwendenden rein als Formalsprache fungiert und somit auch grundsätzlich die Sprachverhältnisse im Nebeneinander einher gehen. Dies übertrug sich einst vor allem auch auf das Neulatein, welches man dem entsprechend auch als Vulgärlatein bezeichnet, da es sich mit der Vulgärsprache vermischte. Hingegen ist die Vulgärsprache eine Vermischung des Dialektes mit der Hochsprache, gemäß dem diese auch entsprechend überhaupt erst als solche in dessen Verbund in Erscheinung tritt. Dem gegenüber stellt die heutige Umgangssprache, abseits dessen, eine Verwillkürlichung des Bezugsverhältnisses dar, was darauf beruht, daß man die elementaren Unterschiede der Herkünfte der Anwendung gar nicht kennt, was jedoch erst ersichtlich wird, indem man dieser eine der spezifizierten Anwendungsformen gegenüber stellt, sodaß sich darüber die Vermischung auch entsprechend überhaupt erst zeigt.


Narr Francke Attempto Verlag

Die Ikonizität tritt in den frühen Phasen einer Struktur oder eines Sprachwandels klarer hervor als in den späteren. De Saussure (1916) bemerkte, dass die Wörter mit der Zeit immer arbiträrer werden, sodass ein fast onomatopoetisches Nomen wie Lat. pipio-onis "Piepvogel, Täubchen" im Französischen zu pigeon wird, wo die ursprüngliche Motivation weniger ersichtlich ist. Die diachrone Tendenz von ikonischen zu arbiträren Formen kann konsequent mit dem Prinzip der "Grammatikalisierung" (grammaticalisation) von Meillet (1912) in Verbindung gebracht werden, wonach autonome, lexikalische Wörter, die ursprünglich eine konkrete Bedeutung haben, später eine abstraktere Funktion entwickeln und zu grammatischen Wörtern werden (vgl. auch Kurylowicz 1965; zu früheren Hinweisen auf den Wandel von konkreten zu abstrakten Wörtern vgl. Hagège 1993: 170; Heine 2003a: 575-576). Ursprünglich wurde das Konzept der Grammatikalisierung entwickelt, um die Entstehung neuer Formen zu beschreiben, und deshalb betraf sie am Anfang mehr die Morphologie bzw. Wortbildung als die Syntax: nach Meillet werden neue Wörter entweder durch Analogie oder durch Grammatikalisierung gebildet. Aber er zeigte auch Fälle von Grammatikalisierung, bei denen ganze Konstruktionen einbezogen werden, z.B. Verben, die ursprünglich "fangen" oder "fassen" bedeuteten, dann Besitz ausdrückten und schließlich als Auxiliarverben in analytischen Präteritalformen benutzt wurden. Denn de facto betrifft die Grammatikalisierung eher Wörter in einem bestimmten Kontext als einzelne Lexeme (Traugott 2003).

Es gibt eine Klasse von Wörtern, welche zwischen Substantiven und Akjektiven in der Mitte stehen. Man mag sie 'attributive Substantiva' nennen. Den Grundstock derselben bilden Wörter, welche als Attributa zu Personalbegriffen angefügt werden können. Sie bezeichnen Menschen nach dem Alter, dem Stande, der Beschäftigung, irgendeiner hervorragenden Eigenschaft. Bald sind sie als Substantiva empfunden, und kommen nur ausnahmsweise als Adjektiva vor, bald sind sie mehr adjektivistisch, so dass sie von den Grammatikern als Adjektive einer Endung bezeichnet werden pflegen. Dem entsprechend ist auch ihre Motionsfähigkeit verschieden (Delbrück 1893: 420 ff).

Also darf der Vergleich zwischen den alten idg. Sprachen und dem 'Standard Average European' im Bereich der Koordination nicht so hoch eingeschätzt werden, weil Koordinatinatoren in den beiden Bereichen eine sehr unterschiedliche Verteilung haben. In den alten idg. Sprachen erlaubte die Verbindung von Wörtern oder Sätzen viel mehr Variation in Asyndeton, lexikalischer Wiederholung und Gebrauch grammatischer Konnektoren. Einerseits hatte das Asyndeton einen viel breiteren Umfang in den frühesten Sprachstufen des Indogermanischen (Viti 2010 a), andererseits waren Koordinatoren den Adverbien viel ähnlicher, und wie von Dunkel (1979; 1982) gezeigt konnte die Iteration der Präverbien dieselbe Funktion wie eine koordinierte Konjunktion haben. Wegen der oft noch transparenten adverbialen Funktion hatten die Konjunktionen der alten Sprachen auch eine ziemlich freie Stellung, und sie konnten auch selektive Beschränkungen in Bezug auf die verknüpfenden Elemente haben, während in den modernen idg. Sprachen Adverbien und Koordinatoren meistens morphologisch und syntaktisch voneinander unterschieden werden.

Syntaktische Funktionen wie 'Subjekt' (subiectum) und 'Prädikat' (praedicatum) wurden von den klassischen Grammatikern eigentlich noch nicht anerkannt: Aristoteles, der eine erste Anschauung davon hatte, verstand darunter eher logische als linguistische Einheiten, und Sytaktiker wie Dionysios Thrax und Apollonios Dyskolos ignorieren sie völlig; in der westlichen Tradition geht die Anerkennung der syntaktischen Funktionen auf die Scholastik und Modistik zurück (13.-14. Jh., vgl. Vineis & Maieru 1994: 134; 151). Denn trotz der typischen Beziehungen zwischen Subjekt und Nomen bzw. zwischen Prädikat und Verb müssen syntaktische Funktionen von syntaktischen Kategorien unterschieden werden mittels des Begriffs der Relationalität bzw. Nicht-Relationalität, und das wurde erst in moderner Zeit, besonders von Chromsky herausgearbeitet. Syntaktische Kategorien sind nicht relational, weil sie ohne Rücksicht auf den Satz oder Kontext anerkannt werden können; so ist der Ausdruch 'das Pferd' immer eine NP. Dagegen sind syntaktische Funktionen relational, weil sie nur anhand eines bestimmten Satzes identifiziert werden: 'das Pferd' ist kein Subjekt per se, sondern kann nur das Subjekt eines Satzes wie 'das Pferd läuft' sein.

» Das Menschenbild bei den Indogermanen (2017) «
Studien zur historisch-vergleichenden Sprachwissenschaft
Carlotta Viti

De Saussures (1916) Prinzip der Arbitrarität des sprachlichen Zeichens, nach dem keine natürliche Beziehung zwischen dem Bezeichneten (signifié) und dem Bezeichnenden (signifiant) in den Sprachen besteht, stimmt mit dem Gebrauch einer einzelnen Benennung für einen außersprachlichen Referenten überein. Denn indem die Benennung arbiträr ist, gibt es keinen Grund dafür, dass die Sprache über mehrere Benennungen für denselben Referenten verfügt, vielmehr wird erwartet, dass synonyme Ausdrücke wegen der Ökonomie des sprachlichen Systems synchron eine geringe Rolle spielen und diachron verloren gehen. Auch das gelegentliche Auftauchen onomatopoetischer und phonosymbolischer Formen unterminiert die grundsätzliche Arbitrarität des Zeichens nicht, so dass Ikonizität im Kommunikationssystem nur ganz marginal im Vergleich zu Arbitrarität auftritt. Ein solches Prinzip war aber in der Antike so nicht bekannt, als eine hitzige Debatte zwischen der Hypothese einer Benennung nach arbiträrer Unterscheidung des Sprechers und der nach der Natur des bezeichneten Referenten stattfand. Das können wir in Platons Kratylos nachlesen, einem Dialog, der genau diesem Problem der Richtigkeit der Namen gewidmet ist.

Als weiteres zeigt sich mustergültig, über das neue biologische Geschlecht, der zunächst stattfindende Wandel vom Adjektiv zu dem eines Nomens, als was es sich erweist und nicht, wie man angibt, als ein Substantiv. Hierzu gilt es den Ablauf dazu in Betracht zu ziehen, daß zunächst gar nicht klar war, was 'das Geschlecht' überhaupt als solches bestimmend repräsentiert und zwar nicht nur in der Botanik, sondern generell, es sich jedoch um eine substanzielle Bezugnahme handelte, worin man der Substanz die Ermessung dessen zusprach und sich im Verlaufe dies nicht nur immer weiter spezifizierte, im Verhältnis des Ganzen, auf Einzelnes sich verlagernd, sondern sich darüber gleichzeitig in seinem Bezug immer weiter eingrenzte, sodaß man letzendlich bei den Genen angelangte, worüber diesen die Bestimmung zugeprochen wurde, was jedoch wiederum sich verflüchtigte, aufgrund dessen man erkannte, daß auch darüber die Bestimmung der Ausbildung des Geschlechts nicht erfolgt, sodaß man es darin an sich gar mit einem Namen zu tun hat, für etwas, dessen Inhalt man gar nicht fassen kann. Hierüber zeigt sich jedoch, womit man es darin zu tun hat, nämlich daß sich die Eigenschaft nicht aus der sich darbietenden Substanz heraus ergibt, sondern es sich umgekehrt darin verhält. Es handelt sich somit, um ein als solches 'statuiertes' Substantiv, was es jedoch aufweisenderweise gar nicht ist, sondern es sich auch darin, gemäß seines begrifflichen Ursprungs verhält, aufgrund dessen dieser sich auch von Grund auf davon differenzierte. Als maßgeblich erweist sich hierin, daß man in der Grammatik, gegenüber dem Latein, worin das Nomen den Überbau bildet und sich darin in 'nomen substantivum' (Person) und 'nomen adjectivum' (Mensch) unterschied, sowohl im Deutschen, Englischen und Französischen hingegen stattdessen einzig das Substantiv in Anwendung ist, in welchen man zwar in den Fachterminas noch 'chematische' Untergliederungen antrifft, jedoch in keiner Weise in der regulären Anwendung.

Diese Entwicklung fundiert sich jedoch aus der ideologischen Entwicklung heraus, in Verbindung mit dem Aufkommen derer Repräsentatoren der Wissenschaften, welche man spezifisch in dem Wandel von Leib (nomen substantivum) und Seele (nomen adjectivum), gegenüber dem des Körpers (substantivum) antrifft. Gemäß dem, daß die Seele nicht als Substanz, sondern als das, was das Leben ausmacht, in Betracht gezogen wurde, verhielt es sich generell gegenüber dem Relativum des Seins und fand in der Sprache sein entsprechendes Abbild. Die aufkommenden Wissenschaften sind indess völlig neu in ihren aufbringenden Bildnissen, nicht nur gegenüber den alten griechischen Verhältnissen, sondern auch gegenüber den bestanden Lokalen, was sich über dessen systemtischen Substantivierung der Adjektive darlegt. Dieses Bildnis hat sich systematisch im Verbund des Aufkommens der diese bildenden hochdeutschen Sprache,über das gesamte Sprachwesen ausgebreitet und darüber sämtlichen alten Bezüge, gemäß dem es auch dem alten Geschlecht erging, verdrängt. Die Grammatik ist hierin das fundierende Maßregelwerk dazu. Damit verbunden ergeht es auch der ursprünglich zunächst noch im Verbund der deutschen Sprache aufblühenden, jedoch nicht weit gelangenden Philosophie, da gerade die Sprache ihr Werkzeug ist und sie sich darin verfängt. Ihr Enden in der Phänomenologie des Geistes, was im Verbund mit dem Leib-Seele-Problem einher geht und seit Jahrhunderten nicht heraus gelangens, basiert auf dieser sprachsubstanztechnischen Verschiebung, dem gegenüber jedoch der Geist gleichermaßen auch die Substanz repräsentiert, aufgrund dessen das Verhältnis zur Seele sich darüber noch relativ bewahrte. Zunächst vor allem noch über das Parallelverhältnis zur Theosophie, wie überhaupt dem Christenverhältnis. Heute hingegen jedoch einzig noch als ein schwacher Gegenpol zu der wissenschaftlichen Monopolpräsenz, als ein Bestandteil dessen seiend deklariert.

Hierzu gehört auch die Verlustigung des Verhältnisses zu den Begriffen, denn in diesem wissenschaftlichen Verhältnis ist alles einzig noch ein Bezeichner für die Substanz, welche gemäß deren Ideologie die Eigenschaften enthält und somit dies eine Einheit bildet. Gemäß dem bildet man heute auch Verben einzig noch aus Substantiven heraus. Dem gegenüber ist im Ursprung des Vorstellungswesens, die Präsenz des Jeweiligen in seinem Bestand einzig, aufgrund des darauf Einwirkungen und dies Bewirkenden, sodaß man spezifisch über die Begriffe auch das Verbundswesen des Seinsverhältnisses darüber abbildet. Zumal man in diversen Verhältnissen alter griechischer Philosophie die Begriffe über das Wahrnehmungsverhältnis stellte und gar als das Einzige, worüber sich das wahre Sein abbildet. Auch diesbezüglich ist die Gegebenheit zum Geschlecht ein mustergültiges Beispiel, wie es sich generell darin verhält, zumal man doch in der Physik eingestehen mußte, daß es das materielle Atom gar nicht gibt, welches das Sinnbild dieser Grundlage darstellte. Trotz dessen setzt sich nach wie vor diese Ideologie fort, da sie in ihrer Art, vor allem auch aufgrund des entstandenen Kompendiums, gar nicht wandelbar ist.

Was die Vorlagen des Lateinischen betrifft, so gilt es, nachfolgende Ausführung von Döderlein zu berücksichtigen. Wie dieser verdeutlicht, so hat man es im Latein mit zwei zentral zu achtenden Gegebenheiten zu tun: zum Einen wurde die lateinische Sprache weiträumig vom Griechischen übernommen, sodaß sich auch darüber wiederum Kollidierungen ergeben, wie man sie gegenüber dem Deutschen antrifft. Des weiteren bestehen nicht nur örtliche Unterschiede, wie dieser hervorhebt, sondern vor allem auch zwischen dem ursprünglich gebildeten Altlatein und dem Neulatein, welches im Verfall des Alten und darüber hinaus, weiträumige Neuerungen und Änderungen erfahren hat. Bezüglich des Jeweiligen sind somit diverse Rücksichtnahmen unerläßlich. Das Latein war nicht nur als Staatssprache in Anwendung, sondern war vor allem auch Handels- und Kolonialsprache, sowie sich auch die gebildeten Stände fremder Kulturen damit ausstatteten. Dem gegenüber erklärt man die lateinische Sprache sogar als tote Sprache, was sich auf die Zeit nach dem römischen Reich bezieht, was in keiner Weise der Fall ist, vielmehr diese nach wie vor noch sehr lebendig ist und nicht nur über dessen Anwendung in diversen Fachbereichen, sondern aufgrund lateinischer Übernahmen in die Landessprache, worüber sich gerade aufgrund dessen, daß sie nicht mehr über die ursprünglichen Regularien der kulturellen Präsenz des Römertums noch gravierendere Rückkoppplungen ergeben. Wie es sich damit verhält, erfährt man auf außergewöhnliche Weise über den Begriff des Genus, worüber sich demonstativ darlegt, wie es sich damit verhält. Man hat es somit generell mit Mischwesen zu tun, worin es somit auch, gemäß Döderlein's Hervorhebung, der spezifischen Trennung bedingt, um darüber zu Klarheiten zu gelangen. Gerade dies findet, wie sich über den Begriff Geschlecht darlegt, nur ansatzweise und vereinzelt überhaupt seine erforderliche Berücksichtigung.


Die lateinische Wortbildung
Verlag: F. C. W. Vogel
6 Teile u. Beil. in 6 Bänden. 1826-1839
Nachdruck: Scientia-Verlag
» «

Das Latein eine Mischsprache

33. Ich halte gegenwärtig das Latein für eine recht eigentliche Mischsprache, und habe sie nach dieser Voraussetzung behandelt. Um irgend eine Sprache als Mischsprache ansehn zu dürfen, müsschen sich etwa folgend Merkmale vereinigen.

a) Historische Spuren, dass die Bevölkerung das Land aus verschieden redenden Nationen entstanden und zusammengewachsen ist.

b) Inconseuquenz des Lautsystems bei seinem Zusammenhalt mit andern Sprachen, und in deren Folge die Coexistenz einer ansehnlichen Zahl von Wörtern, welche den Charakter von blos dialektischen Verschiedenheiten tragen.

34. An historischen Spuren fehlt es bekanntlich nicht; weder durch die Darstellung des Livius, noch die Untersuchungen Biehuhrs und O. Müllers lassen einer andern Vorstellung Raum, als dass in Rom verschiedene italische Völkerschaften und Sprachen zu einer neuen Nation zusammengewachsen sind. Nur habe ich keine absolute Nöthigung gefunden, einen griechischen und einen ungriechischen Bestandteil in der lat. Sprache zu unterscheiden. Denn den glänzenden, von Biebuhr angeregten, von O. Müller weiter ausgeführten Gedanken, dass die meisten Landwirthschaftlichen Wörter der lat. Sprache griechisch, die politischen, militärischen, juridischen dagegen ungriechisch seien, habe ich jüngst einer besonderen Prüfung unterworfen, und dadurch, dass ich auch die als ungriechisch angesehenen politischen und militärischen Ausdrücke auf griechische Formen oder Wurzeln reduzierte, wie ich hoffe, etwas wankend gemacht.

35. Als Beispiel, wie einfach sich nach gehöriger Forstellung der Lautveränderungsgesetze das Latein in allen seinen Erscheinungen theils mit dem Griechischen parallelisieren, theils aus dem Griechischen ableiten lässt, folgt hier ein Uebersicht der handgreiflischsten Concordansen: Jupiter , Janus, Juno, Diana, Minerva, Laverna, Caras, Venus, Frutis, Neptunus, Apollo, Aperia, Vesta, Orcus uragus, Libitina, Feronia, Manes, Vulcanus, Mulciber, Mars, Marmar, Mavors, Liber, Loebasius, Mercurius, Tellumo, Pilumnus, Picumnus, nebst einigen Andeutungen und Vergleichungen aus dem Gebiet der römischen Topographie, Antiquitäten und Geschichte: Aventinus, subura, velabrum, acamenta, naenia, optio, ferentarii, Salii, inqilinus, vindicta, lictor, proletarii, Ancus, Porsena, Vellejus, Vallaeus, Vespasius, Vitellius, Atilius, Egnatii.

36. Aber auch im allgemeinen sind mir so wenig lat. Wörter überig geblieben, dass nach meiner Ueberzeugung, eine fortgesetzte Vergleichung der lat. und gr. Sprache, nach vollständiger Ergründung und Begründung ihrer verschiedenen Lautsysteme auch jenen Rest in Null auflösen wird.

37. So sehe ich also in der lat. Sprache ein Mixum compositum aus lauter altialischen Dialekten, in diesen wiederum nichts als griechische Dialekte. Es entstand erstens durch die früheren und ununterbrochenen Einwanderungen von eigentlich griechisch redenden Völkern, dann zweitens durch Roms Verkehr mit dem gräcisierenden Hetrurien, mit Grossgriechenland und den Sikelioten, und endlich drieens durch die Adoption der griechischen Literatur. Die altialischen Sprache, von denen wir Proben theils in ganzen Monumenten, theils in einzelnen Wörtern haben, die sikelische, die oscische, die sabinische, die umbrische Sprache enthalten so viele auf den ersten Blick erkennbar griechische Elemente, dass der Schluss, eine weitere Forschung werde auch für den noch nicht entzifferten Theil die griechische Verwandschaft nachzuweisen vermögen, gewiss nicht voreilig ist.

Fremdwörter

Bei diesem Charakter der lat. Sprache, als einer Mischsprache, ist es ein äusserst schweres und missliches Geschäft zu bestimmen, welche Wörter als Fremdwörter, als erst in der historischen Zeit entlehnt, anzusehn seien; denn darf auch Niebuhrs hingeworfene Behauptung, dass man von jeher in Rom griechisch verstanden habe, für annoch unerwiesen gelten, so ist doch der Einfluss griechischer Sprache auf Rom so alt und so vielfach und so ununterbrochen, dass man um die Grenze verlegen sein muss, die zwischen der Urverwandtschaft beider Sprachen und ihrer erst durch den Verkehr herbeigeführten Uebereinstimmung zu ziehen wär.

47. Gegen die Ansicht von der allmählichen Bildung der lateinischen Sprache, demnach sie in Folge des vielerlei Einflusses von aussenher und namentlich Griechenland sich zu dem Griechischen nicht viel anders verhält, als das Französische zu dem Latein, hat sich mein Gefühl und meine Vorliebe zum Latein lange gesträubt. Vormag sich sie aber bis auf einen gewissen Grad von dem Charakter eines Jargons nicht freizusprechen, so darf ich mir auch Worterklärungen erlauben, vor welchen man bei Behandlung einer selbständigen durchaus organisch entwickelten Sprache erschrecken müsste.

Damit verbindet sich noch eine andere auffallende Erscheinung. Die Lateiner selbst hatten ein so tiefgegründetes Gefühl und Bewusstsein von der Unselbständigkeit ihrer Sprache, dass sich die Bedeutungen eines lateinischen Wortes veränderten oder vermehrten, wenn dasselbe aber einem heterogenen aber ähnlich lautenden griechischen Wort verglichen wurde.

Dieses Verhältnis entbindet nun einerseits keineswegs von der Verpflichtung, eine Gesetzmäßigkeit auch in der lat. Wortbildung vorauszusetzen, anderntheils berechtigt es aber auch, Anomalien und Willkührlichkeiten und inconsequenzen gelten zu lassen, welche bei der Behandlung einer andern Sprache den Sprachforscher denklich machen müsste. Noch weniger soll dadurch dem Latein das ihm von den neuern Sprachforschern vindicirte Lob streitig gemacht werden, dass es in vielen Fällen, in einzelnen Wörtern wie in der Grammatik, die ursprüngliche Form treuer bewahrt habe als die Griechen und in hundert Wortformen, die das folgende aufzählen wird. Jedenfalls wird dadurch mein Unternehmen, das Latein vor allem und einseitig, ausschliesslich mit dem Griechischen zu parallelisieren, sich als nicht unnütz darstellen. Der weitern Vergleichung mit den in aufsteigender Linie verwandten Sprachen sind, wie oben gesagt, ihre wohlbegründeten Rechte vorbehalten.

In der Ergründung des Ursprungs von genus/sexus stößt man darüber hinaus noch auf einen anderen Gegenstand, welcher nirgends seine Inbetrachtziehung erfährt, nämlich den des grammatikalischen Duals, welches in der Überführung in die Hochsprachen nicht übernommen wurde. Hierin gibt es einzig noch das Singular und Plural und verdeutlicht darüber noch einmal spezifizierend die Mißlichkeiten der Inbetrachtziehungen und Anwendungen, gegenüber der Gegebenheit, daß es das Eine ohne das Andere gar nicht gibt - das Jeweilige kein Singuläres ist und wo es zur Einheit wird, darin gleichermaßen wiederum die Zusammengehörigkeit die Grundlage bildet. Darauf fußt auch der Ursprung, welcher aus der Einheit des Ganzen die Einheit des Jeweiligen zu begründen suchte, dies jedoch der Voraussetzung des grammatikalischen Duals zur Benennung dessen als solches und somit auch der übertragbaren Anwendung entbehrt. Somit ergibt sich gerade darüber auch ein grundsätzliches sprachtechnisches Mißverhältnis, welches das Abbildungswesen zu Ideologien darüber umgestaltet, über die bedingende Umgehung dieses Übels. Über dieses Sprachverhältnis läßt sich weder abbilden, noch darstellen, was diese Tatsachen darlegen. So ist denn auch der Verlauf darüber in seiner Deutlichkeit ersichtlich, daß man zunächst über das Plural (der Einheit) ersuchte, die dualen Bestandteile daraus zu benennen und zu beschreiben, hingegen dies im Verlaufe zum Singular verfiel, aus dessen Verhältnis man es forthin beschrieb. Dem gegenüber ist zu bedenken, daß das Dual die Grundlage der getrenntgeschlechtlichen Fortpflanzung bildet und somit, gemäß dem die Sprache dies selbst nicht beinhaltet, es dieser hinzugefügt werden muß, um eine naturgemäße Abbildung darüber zu ermöglichen. Dies ist möglich und bildet sich über das dem entsprechende Naturverständnis heraus aus. Inwiefern es des Duals bedingt, hängt somit auch damit zusammen, inwiefern das Naturverständnis selbst die Grundlage bildet, in der Ersichtung des Seins, wohingegen es in Separierung dessen spezifisch über das Jeweilige selbst der sprachbildenden Mitteilung bedingt. Man bedenke hierzu als Musterbeispiel, daß in dieser Handhabe das Links bei L anzutreffen ist, separiert von dem Rechts bei R, dem gegenüber beides nicht getrennt voneinander existiert. Hierüber werden nicht nur die sich darüber aufweisenden Grundlagen des Seins außen vor gestellt und erfahren darüber auch nicht nur eine gänzlich Veränderung, sondern darüber eliminiert sich das 'an sich' aufweisende Verständnis und auch dessen Wesensart.


Verlag: Heinrich Ludwig Brönner
» «

sexus, us, m- secus, n. das Geschlecht. (scheint von secere, secare, schneiden, theilen, in der Bedeutung von Abtheilung, Theil, zu kommen, wozu dann virorum, mulierum zu denken wäre. Unwahrscheinlicher wäre die Ableitung von secere, sequi, in der Bedeutung von secta, obgleich secta mulierum vorkommt, denn in dieser Zusammenstellung ist es nur von secta im Allgmeinen einmal speciell eintlehnt).


Verlag: Hahn'sche Buchhandlung
» «

sexus, -us ist sicherlich von den hier angeführten Wörtern dasjenige, wo die Entstehung des u-Stammes aus einem alten Dual am wahrscheinlichsten ist. Die Erklärung aus *sec-tu- (sec-are "Abteilung", Vaniček a. a. O. 292) ist durch die bekannten lautgesetzlichen Verhältnisse ausgeschlossen; sexu- kann nur auf älterem sec(qu)-su- beruhen, da kein Anlass vorliegt dasselbe aus *sect-tu- zu erklären. Entweder muss also sexu- ein secundärer, aber ursprünglicher, vom s- Stamm seques- (secus) abgeleiteter u-Stamm sein, wofür mir jedoch keine Analogien bekannt sind, oder seine u-Flexion ist von der bezeichneten hysterogenen Art. Der Ausgangspunkt dieser Umbildung wäre, wie im vorigen Beispiele, der Gen. Du. gewesen: *sequ(e)s-ous = sexus "der beiden Arten" z. B. virilis et muliebris sexus (unbelegt), welche Form dann bei dem Zugrundegehen der Dualkategorie zum Singular (utriusque sexus) überführt wurde.

Man wird vielleicht gegen diese Etymologie einwenden, dass die dabei im Gen. Du. *sequ(e)s-ous anzunehmende Synkope des Stammsuffixes auffällig sei; denn so häufig diese Synkope in den Ableitungen der s-Neutra ist (anxius : angor augustus, saxun : sac(e)sna etc., s. Brugmann K. Z. XXIV, 10 f., Joh. Schmidt K. Z. XXV, 26), so selten erscheint sie im Paradigma selbst, so dass man sogar die Regel aufgestellt hat, dass in der Deklination der Vokal des Suff. -es gar nicht schwinden dürfe. Indessen, da es wohl nunmehr ausser Zweifel steht, dass auch diese Stämme von Haus aus den freien indog. Accent besessen haben (s. Möller Paul-Braunes Beitr. VII, 503 f., Osthoff M. U. IV, 182 m. d. Anm.), so wird diese an sich sehr verdächtige Verschiedenheit der Derivation und der Deklination auf sekundärer Uniformierung der letzteren beruhen. Sollte es übrigens, was ich nicht glaube, durchaus nötig sein, den alten Gen. Du. von seques- mit vollem Stammauslaut als *seques-ous anzusetzen, so könnte man in dieser sehr leicht als isoliert zu denkenden Form eine vor dem Rhotazismus liegende einzelsprachliche Synkope des mittleren e annehmen.


Max Niemeyer Verlag

» Immanuel Johann Gerhard Scheller «
» Ausführliches und möglichst vollständiges lateinisch-deutsches «
und deutsch-lateinisches Lexicon oder Wörterbuch

dritte Auflage von 1804/05
» lateinisch-deutsch - Erste Abtheilung A - C «
» lateinisch-deutsch - Zweyte Abtheilung D - K «
» lateinisch-deutsch - Dritte Abtheilung L - O «
» lateinisch-deutsch - Vierte Abtheilung P - R «
» lateinisch-deutsch - Fünfte Abtheilung S - Z «
» deutsch-latein - Erste Abtheilung A - L «
» deutsch-latein - Zweyte Abtheilung M - Z «


» Fünfter Band - Bibliographie, Quellenübersicht und Register «
Verlag: C.H. Beck

» Thesaurus Linguae Latinae «
Erfassung der gesamten Latinität von ihren Anfängen bis Isidor von Sevilla


(Lingua Historica Germanica 16)
Texte - Termini - Interpretationen
Verlag: De Gruyter
» «


Band 1 - Untersuchungen
Verlag: Walter de Gruyter
De Gruyter
» «

» Thesaurus linguae Latinae «
Schatzhaus des antiken Lateins
Bayerische Akademie der Wissenschaften

Der Thesaurus linguae Latinae ist das maßgebliche Wörterbuch des antiken Lateins: Als einziges Lexikon bezieht der Thesaurus alle überlieferten lateinischen Texte von den Anfängen bis 600 n. Chr. ein, berücksichtigt also neben der klassischen Latinität auch ausführlich die Besonderheiten der spätantiken und christlichen Texte. Untersucht werden nicht nur literarische Werke, sondern auch juristische und medizinische Gebrauchstexte, Inschriften, Graffiti und vieles mehr.

Die wissenschaftliche Zuverlässigkeit des Thesaurus konnte nicht durch die Revision bewährter Wörterbücher erreicht werden: Denn jahrhundertelang dienten Lateinlexika im Wesentlichen zur Verbesserung der aktiven Sprachbeherrschung, die nur an den besten Stilvorbildern (vor allem Cicero) geschult werden sollte. Um diese einseitige Sprachdarstellung zuverlässig korrigieren zu können, wurde ein Neubeginn nötig.

Basis des Wörterbuches ist das Zettelarchiv, wo der Schatz von rund 10 Millionen Zetteln gehütet wird: Die Texte ab dem Beginn lateinischer Schriftlichkeit bis einschließlich Apuleius (2. Hälfte des 2. Jahrhunderts n. Chr.) wurden vollständig verzettelt, jene der späteren Zeit von Spezialisten exzerpiert. Diese sinnvolle Beschränkung dämmte die Materialmenge auf ein beherrschbares Maß ein. Im Prozess der Ausarbeitung wird nun jeder Beleg für ein Stichwort hinsichtlich Bedeutung, Schreibweise, Prosodie etc. untersucht, bevor Gruppen ähnlicher Belege gebildet werden. Diese Gruppen werden nicht in Form von Listen mit Übersetzungsmöglichkeiten aneinandergereiht, sondern die Bedeutungsentwicklung wird in einem sich verästelnden Schema dargelegt. So wird die Geschichte jedes Wortes beschrieben, und zwar in der Ausgangssprache Latein.

» Allgemeine Theorie der Schönen Künste (1771) «
» Johann Georg Sulzer «

» Idiotismen (Redende Künste) «

Wiewohl dieses Wort aus der griechischen Sprache zuerst in die Lateinische und danach auch in die neueren kritischen Sprachen übergegangen ist, so hat es seine Bedeutung ganz geändert. Die lateinischen Grammatiker, die dieses Wort von dem Wort Idiota (welches einen ganz gemeinen Menschen bedeutet) abgeleitet hatten, nannten einen mit guter Überlegung gewählten, niedrigen, recht einfältigen und naiven Ausdruck, einen Idiotismus. Jetzt aber bedeutet es, das, was die Griechen und Römer durch das Wort Idioma ausdrückten; eine Redensart, einen Ausdruck oder eine Wendung, die einer Sprache so eigen ist, dass es nicht möglich ist, in einer anderen Sprache auf eine ähnliche Weise, dasselbe zu sagen. Doch kann man die Bedeutung des Wortes auch noch auf das ausdehnen, was die Sprache einzelner Menschen charakteristisches hat; das persönlich eigentümliche in der Sprache gewisser Dichter und Redner. Es gibt demnach nationale und persönliche Idiotismen. Beispiele der ersteren hat man an vielen Sprüchwörtern und Metaphern, die sich schlechterdings nicht übersetzen lassen. Wenn der gemeine Mann in Deutschland sagt: von Ort zu Ende, so kann man zwar den Sinn dieses Ausdrucks in jeder Sprache geben, aber nicht mit dem eigentümlichen desselben. Wenn ein Italiener sagt: Dall' un' all' altr' Aurora, so kann man zwar in jeder Sprache den Sinn dieser Worte angeben, aber nicht in jeder auf die Art, dass nur ein Substantivum, wie im Italienischen gebraucht werde.

Die eigentümlichen wahren Idiotismen sind bloß grammatisch und das Idiomatische liegt nicht in den Gedanken oder in den Bildern. Denn eine Metapher, die wir nur darum nicht übersetzen können, weil wir das Bild, worauf sie sich gründet nicht kennen, ist so wenig ein Idiotismus als ein griechisches Wort, dessen Bedeutung wir nicht mehr wissen. Darum muss man Ausdrücke, die ihren Grund in einem Bilde, Gebrauch oder in einer Vorstellung haben, deswegen noch nicht für Idiotismen halten, weil sie in gewissen Sprachen so häufig vorkommen, dass man sich des Grundes, worauf sie beruhen, kaum mehr bewußt ist. Bei solchen Ausdrücken, sie seien in der römischen, griechischen oder in einer morgenländischen Sprache, kommt es darauf an, ob das Bild uns bekannt sei, und, wenn dieses ist, ob es bei uns, auf der Stelle, da es vorkommt, seine Wirkung tue.

Divider


Band 4 - II. Brüder-Grimm-Symposium zur historischen Wortforschung
Verlag: de Gruyter
Herausgeber: ,

Günter Bellmann

Dem Wandel der Sprache ist üblicherweise der Wandel des Sprachverhaltens der Sprachteilnehmer vorgeordnet. Allerdings: mancher sich anbahnende Sprachwandel kommt über das Stadium des Sprachverhaltenswandels nicht hinaus, sondern begründet lediglich einen langandauernden oder überhaupt dauerhaften variativen Zustand, der durch sprachpragmatisch, sprachsozial und womöglich stilistisch unterschiedene Verwendung von Varianten gekennzeichnet ist. Beispiele dazu fallen uns sogleich aus dem Bereiche der Syntax ein, so etwa die (synthetische) Genitivform der normativen Typen der volkstümlicheren (analytischen) Genitivperiphrase. Variative Zustände dieser Art machen es der sprachhistorischen Forschung schwer, anzugeben, wann und wo ein punktueller Sprachwandel zum Abschluß gekommen ist, oder überhaupt von Wandel zu sprechen, solange statt diesem der variable Zustand dominant hervortritt.

Sprachverhaltenswandel heißt, daß die Sprachteilhaber einen anderen Gebrauch von der Sprache machen. Dieser läßt sich dann bestenfalls statistisch messen. Die Sprache selbst bleibt dieselbe. Gewandelt werden dabei hauptsächlich die Normen, die die Variantenverwendung und dann vor allem auch das Zusammentreten und die Frequenz der häufig und typischerweise gebrauchten (freien) Wortgruppen (Kollokationen) regeln, und zwar gilt dies für die Normen des mündlichen und des schriftlichen Sprachverhaltens. Sprachwandel hingegen erfaßt die Inventare und die Regelsysteme der Sprache selbst. In einem weiteren Sinne wird man dabei auch die Konstitution neuer und die Modifikation bestehender lexikalischer Felder einbeziehen müssen.

Denn wenn man nicht grammatische Elemente, sondern, wie es auf diesem Symposium geschieht, den Wortschat und dessen historische Dimension zum Thema macht, liegen die Dinge ein wenig anders. Um den wesentlichen Gedanken sogleich vorauszunehmen: Wortschaftswandel scheint gerade nicht notwendigerweise über einen langwierigen Sprachverhaltenswandel zu verlaufen. Statt dessen verschafft sich - von heut auf morgen - das aktuelle Kommunikations- und Benennungsbedürfnis der Sprachteilhaber Geltung. Mit anderen Worten: Hier spielt es keine Rolle, daß wir vermittels der Lexikoneinheiten (LE) auf die Dinge der Welt referieren, daß wir mit ihnen semantische Information (Bedeutung im engeren und im weiteren Sinne) transportieren und daß sie es sind, die uns als Vehikel, als die auditiv und/oder visuell wahrnehmbaren Stellvertreter der Begriffe, dienen. Ergibt sich durch die zivilisatorische, politische, technische oder sonstwie geartete Entwicklung eine Lücke im System der lexikalischen Mittel, so wird diese unmittelbar und ziemlich unvermittelt gefüllt, etwa nach der Regel: Null → LE. Es versteht sich, daß die Füllung lexikalischer Lücken, die Null-Substitution also, ebenfalls als eine Form des Wandels anzusehen ist. Neben dieser Erstbenennung steht als sprachliche Eins-zu-eins-Substitution die Umbenennung nach der Formel (LE)1 → (LE)2, die aus verschiedenen Gründen stattfinden kann.

Der Innovation steht als Pendant das Zurücktreten von Wortschatzeinheiten - gewissermaßen die Negativform des innovativen Wandels - gegenüber. Ich spreche absichtlich von Zurücktreten, denn eine lexikalische Einheit wird - in der Umkehrung des Innovationsprozesses - kaum jemals auf Null zurückgeführt. In der pluralistischen Gesellschaft, die zumindest von Staats wegen keinen gravierenden lexikalischen und begrifflichen Tabus unterworfen sein sollte, bleibt auch der Wortschatz von vorgestern in den Zeitungsarchiven, Lexika und Geschichtswerken sowie in anderen Formen des kollektiven Gedächtnisses erhalten und greifbar. Der Vorgang ist also nicht der einer Eliminierung, sondern vielmehr der einer Archaisierung nach der Regel: LE → (LE)Arch.

Divider

» Zur Entstehung eines Wörterbuchs der mittelalterlichen medizinischen (Fach-)sprache (2010) «
» Jörg Riecke «

Das Verzeichnis bietet insgesamt mit 359 lateinischen und 884 althochdeutschen Verwendungsweisen ein deutliches Übergewicht des Althochdeutschen. Statistisch gesehen stehen damit jeder lateinischen Bezeichnung etwa 2,4 Übersetzungsversuche gegenüber. Lässt man den seltenen lateinischen Wortschatz einmal außer Acht, der in althochdeutscher Zeit jeweils nur ein einziges Mal übersetzt worden ist, so gelangt man für den Rest der häufiger bezeugten Belege zu einem durchschnittlichen Wert von vier althochdeutschen Bezeichnungen pro lateinischem Lexem.

Auch wenn man davon ausgeht, dass in Einzelfällen vergleichbare Bildungen in anderen Einzelsprachen nur zufällig nicht überliefert sind, so ändert dies doch nichts Grundsätzliches an diesem eindeutigen Befund. Die althochdeutschen Krankheitsbezeichnungen sind fast ausnahmslos nicht alt, sie wurden erst in germanischer und vor allem althochdeutscher Zeit neu gebildet. Einen den Körperteilbezeichnungen vergleichbaren größeren Kernbestand und eine Kontinuität der schrittweisen Wissensaneignung in der Volkssprache gibt es hier nicht. Krankheiten wurden in älterer Zeit, etwa aus Gründen des Sprachtabus, in Folge einer veränderten Wahrnehmung, oder schlichtweg aus mangelnder Kenntnis, entweder gar nicht bezeichnet oder die Bezeichnung geschah unter Umständen auf eine Weise, die in christlicher Zeit nicht mehr akzeptabel erschien. Alle Sachbereiche sind durch im Althochdeutschen erstmals bezeugte Lexeme geprägt, sie sind größtenteils als Neubildungen anzusehen.

Von diesen 566 erstmals bezeugten Verwendungsweisen haben nur 60 eine Fortsetzung in neuhochdeutscher Zeit gefunden. Dies entspricht einem Anteil von 10,7 %. Allerdings sind nicht wenige dieser Lexeme heute, wie etwa wewo : Weh oder unheil : Unheil, nur noch eingeschränkt (etwa in Kopfweh, Zahnweh) oder gar nicht mehr in medizinischen Kontexten verwendbar. Der größte Teil der länger haltbaren Verwendungsweisen stammt aus dem insgesamt umfangreichsten Bereich von Wahnsinn und Besessenheit. Hier ist die Zahl der heute noch alltagssprachlich gebrauchten Bezeichnungen wie hirnwütig(hirnwuotig), Narrheit (narraheit) oder Tobsucht (tobasuht) besonders hoch. Letztlich bestätigt aber auch dieser Befund, dass die althochdeutschen Krankheitsbezeichnungen mehrheitlich nicht bis in die Neuzeit überdauert haben.

In den drei Bereichen verläuft die Entwicklung annähernd gleichartig. Die Haltbarkeit des ältesten medizinischen deutschen Wortschatzes nimmt in allen Bereichen und in allen Sprachstadien deutlich ab. Etwas stabiler ist der anatomische Wortschatz, im Bereich von Krankheit und Heilung vollzieht sich der Wortverlust etwas schneller. Im Mittelhochdeutschen sind, je nach Sachgebiet, immerhin noch 40 bis 50 % der aus dem Althochdeutschen überkommenen medizinischen Verwendungsweisen bezeugt. Im Verlauf der frühneu- und neuhochdeutschen Zeit gehen dann aber weitere 5 bis 10 % des Wortschatzes verloren. Erst in der Sprache der Gegenwart scheint die überwiegende Mehrzahl der Lexeme endgültig unterzugehen. Es bleibt schließlich nur ein Rest von ca. 20 % im Bereich des Körpers, 15 % im Bereich von Heilung und Gesundheit und sogar nur 10 % bei den Krankheitsbezeichnungen. Es zeigt sich also ein fortschreitender Wortschatzverlust, der aber, sofern die Angaben des DWB., gepaart mit der eigenen Sprachkompetenz, repräsentativ sind, erst im 20. Jahrhundert geradezu dramatische Formen annimmt. Eine jahrhundertelange Kontinuität geht schließlich zu Ende. Und auch die vergleichsweise wenigen Lexeme, die sich mit einer medizinischen Verwendungsweise bis in die Gegenwart gehalten haben, gehören nicht mehr alle dem einheimischen Fachwortschatz der Medizin an.

Divider

Anatomie

Divider

Die kulturelle Entwicklung, das körperliche Geschlecht gemäß der Neuzeit, als 'formelles Ermessungswesen' der Geschlechtlichkeit in Betracht zu ziehen, vollzieht sich zwar über die Botanik, jedoch findet die augenscheinliche Repräsentanz dessen bereits in der frühen Neuzeit im » 16. Jahrhundert « statt. Bis zu diesem Zeitpunkt war es nicht 'augenscheinlicher' Ermessungsgegenstand, sondern einzig männliche und weibliche Erscheinungsformen des Äußerlichen(den). Maßgeblich hierin ist die Unterscheidung, daß man in seinem Ursprung das Geschlechtswesen als ein Resultierendes in Betracht zog und grundsätzlich der Bezug die Ursachen des Erwirkten waren, aufgrund dessen man das Jeweilige in seiner Präsenz erfuhr. Somit war hierin auch das Ermessungswesen gegenüber den Geschlechtsorganen ein daraus Resultierendes und es drehte sich um die Männlichkeit und Weiblichkeit, zumal damit verbunden auch die Wesensart der Fortpflanzung die Grundlage dazu ausbildete. Dem gegenüber ist gerade die Anatomie ein demonstratives Muster für erneuerende Ideologie der aufkommenden Wissenschaften, worin das Jeweilige aus dem Selbst heraus seine Bestimmung und Erklärung erfährt. Hierin erfährt das Selbst eine isolierte Inbetrachtziehung, auf der Grundlage, daß aus der substanziellen Präsenz heraus die Eigenschaften hervor gehen.

In jener Zeit vollzog sich im medizinischen Verhältnis dieser Teil des grundsätzlichen kulturellen Wandels, welcher sich zumal über das damit verbundene Öffentlichkeitswesen erwirkte. Maßgeblich hierin ist, daß man selbst heute, gar nicht erkennt, wie gerade hierüber eines ins andere greift, denn was man wahrnimmt, ist der Enthusiasmus gegenüber dem Neuen, worüber Gegebenheiten in Erscheinung treten, welche man zuvor nicht kannte. Konkreter ausgedrückt, handelt es sich jedoch um ein 'derart' nicht kannte. So wurde auch das Geschlechtsorgan vorher gar nicht derart in seiner Eigenständigkeit in Augenschein genommen. Auf gravierende Weise verdeutlicht sich dies über das weibliche Geschlechtsorgan, welches bei demjenigen, welcher einst über sein Aufbringen, den stattfindenden Umschwung überhaupt erwirkt, nämlich Andreas Vesalius. Dieser hatte mit seinen erneuernden Schriftwerken vor allem auch Bildnisse geschaffen, welche in einer solchen Klarheit zuvor noch nicht existierten. Und hierin trifft man bei der Darstellung des weiblichen Geschlechtsorgans auf einen invertieren Penis. Elementar ist, daß man nämlich bis dato das weibliche Geschlecht, nicht nur auf das Körperliche bezogen, sondern generell gar nicht aus diesem selbst heraus in Betracht zog, sondern einzig das männliche Daseinswesen ergründete und daraus Rückschlüsse auf die Weiblichkeit zog. Einzig daraus ergaben sich die Bildnisse über die Weiblichkeit. Und eines dieser Bildnisse beruhte auf dem Verhältnis des herausragenden männlichen Penis gegenüber dem Gegensatz dessen beim Weiblichen. Und somit ersah man auch, in diesem spezifizierenden Bezugswesen, das Weibliche generell als ein Invertiertes des Männlichen und somit auch diesen Teil des Geschlechtsverhältnisses, gemäß dem es Vesalius das Vaginale der Frau als einen invertierten Penis darstellt.

Humanis Corporis Fabricia weiblich
» weibliches «
'invertiertes' Geschlechtsorgan
(Ausgabe 1555)

Humanis Corporis Fabricia männlich
» männliches «
Geschlechtsorgan
(Ausgabe 1555)


Erstausgabe in Basel
» «


An Annotated Translation of the 1543 and 1555 Editions
of De Humani Corporis Fabrica Libri Septem

by D.H. Garrison and M.H. Hast. Basel, Karger

A Translation of

Book V
The Origins of Nutrition and Generation

Verlag: Norman Publishing
by
Department of Classics University of Auckland
in collaboration with

Department of Anatomy University of Auckland


Verlag Georg Reimer
» «

Im Vorwort zur Fabrica übte er vehemente Kritik an Galen, der selbst nie ein Hehl daraus gemacht hatte, nur Tierkadaver seziert zu haben. Dieses sorgfältig typographisch ausgestattete Lehrbuch zeigt rund 200 zum Teil ganzseitige Illustrationen. Darin vertrat Vesal entgegen der allgemeinen Überzeugung die Ansicht, allein der menschliche Leib sei der zuverlässige Weg zur Erkenntnis des menschlichen Körperbaus. Mit seinem revolutionären Werk und der Lösung von den Lehren Galens war Vesal der Hauptbegründer der neuzeitlichen Anatomie.


Vierter Teil, S-Z, S. 1553
Hrsg.: » Christian Gottlieb Jöcher «

Vesaluis (Andreas), ein Doctor Medicina und Anatomicus, war den 30 April 1514 zu Brüssel gebohren. Er studirte zu Löven, und hatte schon in der zarten Jugend eine so grosse Lust zur Zergliederungskunst, daß er sich nicht scheuete, des Nachts allerhand Menschen-Knochen von den Gottes-Aeckern, ja so gar die Gerippe der Delingventen von Galgen und Rade herab zu holen, bekam aber dieserwegen das Consilium ebeundi, gieng also von hier nach Paris. An 1537 wurde er Professor Anatomices zu Padua, und machte sich durch seine Wissenschaften in der Anatomie sehr berühmt. Hernach wurde er verschiedener grosser Herren, sonderlich Caroli V und Philippi II Leib-Medicus, hatte eine Xantippe zum Weibe, reisete endlich vermöge eines gethanen Gelübdes nach Jerusalem, und wurde in der Rückreise, auf die Insel Zante verschlagen, woselbst er 1564 den 15, Oct. in elendem Zusande starb. Thuanus erzehlet, daß der Maximiliano von Egmont, Gragen von Buren in Gelderland, den Tag und die Stunde seines Todes zuvor gesagt, welches auch richtig eingetroffen. Seine Schrifften sind de humani corporis fabricia libb. 7, so er im 28sten Jahre geschrieben; eorundem eptome, welches rare Buch Mic. Fontanus 1642 mit Anmerckungen zu Amsterdam edirt, Alb. Corinus aber 1543 ins Deutsche übersetzt; anatomicarum Gabrielis Fallopii observationum examen; Epistola docens venam axillarem dextri cubiti in dolore laterali secandam; de radice chinae epistols; paraphrasis in librum IX Rhazae ad regem Almansorem de affectuum singularum corporis partium curatione; Consilium pro Terrae-novae ducis sistula; consilium pro visu partim depravato parim abolitio; de arthiritide consilis; chirugia magna in 7 libros digesta, die Prosper Borgarutius 1569 verbessert heraus gegeben; exercitat. de-ossibus ad Galeni doctrinam; emendationes ad Jo. Guinteri institutiones anatomicas; de loxo incidendae venae in pleuritide; de venarum arteriarumque sectione; verbesserte auch die Uebersetzung einiger Bücher des Galeni; Consilia medica. Seine versprochene anatomia practica ist so wenig, als sein Tractat des formatione fortus zu Vorschein gekommen. Er hat übrigens nebst dem Alb. Corino und Gerh. Toletano unterschieene Wercke des Rhazis aus dem Arabischen ins Lateinische übersetzet, die zu Basel 1544 in folio unter dem Titel Rbaza opera exquisitiora gedruckt worden. Ob ihn Mic. Massa mit Recht eines Plagii beschuldigt, ist noch nicht ausgemacht. Die Ursache seiner Wallfahrt nach dem gelobten Lande soll diese gewest seyn: Es war in Spanien ein vornehmer Herr, bey dem er curirt hatte, nach seiner und anderer Einbildung gestorben. Weil er nun gern die Ursache des Todes wissen wolte, bat er um Erlaubnis den Körper zu seciren, fand aber, als er ihn öffnete, daß das Herze noch schlug; daher er von dessen Freunden vor der Inquisition als ein Mörder angeklagt wurde, und auf den Scheiter-Haufen solte gesetzt werden. Allein der König brachte es durch viel Mühe dahin, daß die Straffe auf diese Weise mitigirt wurde : wiewohl andere die ganze Sache leugnen. Seine sämtlichen Schrifften haben Boerhave und Albinus 1725 zu Leiden sehr schön, nebst Vesalii Lebens.Beschreibung heraus gegeben.


Janus - Archives Internationales
pour l'Historie de la Médicine
et la Géographie Médicale

F. M. G. de Feyfer

Die Schriften des Andreas Vesalius Grafik
» Iconographische Tafel «
Reproduktionen und Verbreitung seiner Werke

In Valverde's Ausgaben der Übersetzungen von Vesalius' Werken hingegen, trifft man auf die Auslassung der Darstellung dieser Invertiertheit, wohingegen man in der lateinischen Übersetzung seines Werkes dieses Bildnis hingegen wiederum einbringt, was jedoch nicht von diesem selbst stammt. Maßgeblich hierin ist, daß die Spezifikation der weiblichen Anatomie, wie auch in seiner Unterscheidung zur Männlichen, zu jener Zeit überhaupt erst zu seiner effektiven augenscheinlichen Ergründung gelangte, während vor allem das Weibliche, gemäß der antreffenden Bildnisses darüber, maßgeblich noch über die althergebrachten Ideologien ausgeprägt waren. Gerade dies demonstrieren diese Verbildlichungen und Hervorheben das weibliche invertierte Geschlechtsorgans, denn die tatsächlich Ergründung war noch gar nicht vollzogen und stand überhaupt erst noch aus und gerade darüber ergaben sich auch die aufreibendsten Auseinandersetzungen, in der Ergründung dessen, wie es sich denn tatsächlich verhält, mit dieser neu auftretenden anatomischen Bildnisse. Darin bestand auch der Grundsatz des Gegenübertretens gegenüber dem Althergebrachten, nämlich in dem Zerwürfnis, welcher sich darüber zwangsläufig darüber einstellte. Maßgeblich ist somit auch hierin, daß sich über diese isolierten Ausschnittsbetrachtungen, was es gegenüber dem Alten ist, ein völlig anderes Erscheinungsbildnis ergibt und selbst wenn dies augenscheinlich zu ersichten ist, doch die Vorstellung darüber erst einmal seiner Ausbildung bedingt, um es als solche wiederzugeben. Gerade dies spiegelt sich in den folgenden Entwicklungen vor allem über das weibliche Geschlechtsorgan wieder, worüber reichlich Auseinandersetzungen darüber stattfanden, wie es sich denn tatsächlich damit verhalten würde. So ist denn auch die Folgezeit zunächst einmal recht fragil, was die diversen Aufbringungen hervorbringen, dem gegenüber jedoch ein wesentliches Handikap der Anatomie entgegen steht, nämlich daß ihr Grundstock der Ergründung tote Leiber sind und diese entbehren nun einmal ein wesentliches: das Leben. Es ist eine Sache, darüber den Knochenbau zu ergründen, jedoch ein ganz anderer Sachverhalt, ein lebendiges Gewebe darüber zu ergründen, welches überhaupt erst 'in seiner Lebendigkeit Erfüllung' wahrlich in Erscheinung tritt.

Anatome_corporis_humani-männlich (Hamusco)Anatome_corporis_humani-weiblich (Hamusco)
links » männliches «, rechts » weibliches «
'invertiertes' Geschlechtsorgan
(lateinische Ausgabe 1607)


Vierter Teil, S-Z, S. 1437
Hrsg.: » Christian Gottlieb Jöcher «

Valverde (Johnnes), ein spanischer Medicus im 16 Seculo, wird gemeiniglich de Amuseo, oder im Lateinischen Hamuscenus beygenannt, weil er an einem Orte dieses Nahmens in der Diöces von Palencia in Alt-Castilien gebohren war. Weil er von dem Cardinal Johanne von Colet zum Leib-Medico erwehlet worden, folgte er demselbigen nach Rom, wo er sich mit vielem Eifer der Anatomie befliß. Als er von dannen zurück nach Spanien kam, und dieser Wissenschaft auch gern in seinem Vaterlande aufhelfen wolte, erklärte er anfänglich des Vesalii Anatomie einigen Studierenden, befand aber hernach, daß solches Werck vor Anfänger zu schwer sey, und verfertigte deswegen selber einen Tractat de compositione corporis humani, den er erst in spanischer Sprache 1556, nachhero aber auch in seiner eigenen italiänischen Uebersetzung 1560 zu Rom drucken ließ, und den Realdus Columbus, des Valverda Lehrmeister in der Anatomie so hoch ästimirte, daß er selbst nach einiger Zeit eine lateinische Uebersetzung davon verfertigte, die zu Venedig 1589 in folio heraus gekommen.


Verlag: Routledge

In den spanisch/kastillischen und italienischen Werken von Valverde ist die weibliche Darstellung des invertierten Geschlechts nicht enhalten. Auch nicht in der niederländischen Version, jedoch in der lateinischen Version des Buchdruckers (ursprünglich Buchbinder) » Christoph Plantin «.


spanisch/kastilisch - Erstausgabe 1556 - Rom


italienisch - Erstausgabe 1559
In Venetia - nella stamperia de Giunti


lateinisch - Erstausgabe 1566
Hrsg.: Christopheri Plantini


niederländisch - Erstausgabe 1568
Hrsg.: Christoffel Plantinijy

» Plantin-Moretus Museum «

Und somit wird dies vor allem jedoch zu einem Schauspiel des Sensationellen, um darüber die Popularität zu erlangen, welche die Entwicklungen fördern. Vaselius ist hierin formaler Wegbereiter, nicht nur in seinen publizierenden Kunstwerken, sondern auch in seinem künstlerisch inszenzierenden Handeln. Zwar führt dies, nicht unerwartet, zu vielfältigen Auseinandersetzungen, vor allem auch über die kollegialen Übereinkünfte und nicht nur, was die anatomischen Kenntnisse betrifft, jedoch bildet gerade auch dies einen wesentlichen Beitrag zur Ausbreitung der beschäftigenden Aktivitäten. Und so erkennt man auch, daß hierin die Übertriebenheit, nicht nur, aber vor allem über die Bildnisse, ihre demonstrative zur-Schau-Stellung erfahren. Es stellt dar, was es zu erlangen gilt und doch nicht das Tatsächliche ist, wie es gegeben ist. Es entwickelte sich jedoch in Folge dessen auch zunächst derart, wie es Vesalius gemäß seiner Bildnis vorausschickte. Die anatomischen Veranstaltungen wurden sogar öffentlich zugänglich gemacht, um dafür Sorge zu tragen, das die Bildnisse sich auch erfüllen, welche man geprägt hatte. Es wurde zu wahren Inszenarien an Showdarstellungen. Eindeutigerweise ging es Vaselius darum, daß dieser Entwicklung ihr wahrer Wert entsprechend ermessen wird und dies gelang ihm auch auf eindrucksvolle Weise. Es gab viele Nachahmer, welche in seine Fußstapfen traten und brachte den Motor auch entsprechend zum Laufen.

public domain from https://commons.wikimedia.org/wiki/File:Fabrica_title_pg_UMich_frc.png
Titelbild von Andreas Vesalius'
De humani corporis fabrica libri septem
Erstausgabe 1543

» Die frühe Baseler Anatomie (2010) «
» Auszug der Universität Basel «
» Michael Stolberg «

Für die Entwicklung der frühneuzeitlichen Medizin und Naturwissenschaft ist die Anatomie von überragender Bedeutung. Zusammen mit der Botanik wertete sie die empirische Beobachtung zum vorherrschenden erkenntnistheoretischen Ideal auf. Dabei half sie, so manchen «Irrtum» der überlieferten, vielfach auf Tiersektionen gegründeten Anatomie zu korrigieren. Doch diese Korrekturen betrafen mit wenigen Ausnahmen Details: Das Wissen um die einzelnen anatomischen Strukturen des Menschen veränderte und differenzierte sich zunächst nur geringfügig.

Für die medizinische Praxis war das neue Wissen zunächst wenig bedeutsam. Die zahlreichen inneren Krankheiten, mit denen sich die akademisch gebildeten Ärzte befassten, wurden vor allem auf krankhaft veränderte bewegliche Säfte und Dünste im Körper zurückgeführt, nicht auf Veränderungen der einzelnen Organe, Gewebe oder Zellen. Für die grobe Lokalisierung und gegebenenfalls gezielte Entleerung solcher Säfte und Dünste reichte ein ungefähres Wissen über die Lage der einzelnen Organe im menschlichen Körper völlig aus.

Die neue, auf persönliche «Autopsie» gestützte Anatomie zeigte jedoch die Möglichkeit und Notwendigkeit, die überkommenen Lehren der Autoritäten kritisch zu hinterfragen und zu korrigieren. Die Anatomie eröffnete für die Ärzte zudem ganz neue Möglichkeiten der professionellen Selbstdarstellung. Lange hatten sie ihren Anspruch, die geheimnisvollen Vorgänge im Körperinneren ihrer Patienten ergründen zu können, vor allem auf ihre Fähigkeiten in der sogenannten Harnschau gegründet, dem überragenden Diagnoseverfahren der mittelalterlichen Medizin. Doch hier waren sie zunehmend gegenüber den ungelernten Heilern ins Hintertreffen geraten. Die öffentlichkeitswirksame Inszenierung anatomischer Kenntnisse war dagegen weitgehend den studierten Ärzten vorbehalten.

1543 erschienen in Basel die «De humani corporis fabrica libri septem» von Andreas Vesal (1514-1564), dem Begründer der neuzeitlichen Anatomie. In dem opulent aufgemachten und illustrierten Werk zeigte der Autor anhand von zahlreichen eigenen Sektionen diverse frühere «Irrtümer» auf. Vesal wurde zur Ikone der neuen Anatomie. Er kam 1542 nach Basel und schrieb sich an der Universität ein. Es ist nicht sicher, ob er aktiv am universitären Leben teilnahm und Vorlesungen hielt, verbürgt ist aber, dass er im Mai 1543 die Leiche des hingerichteten Jacob Karrer aus dem Elsass sezierte und das präparierte Skelett der Universität schenkte. Dieses war hier lange aufgestellt und ist bis heute im Anatomischen Museum erhalten.

Entscheidend für den Aufstieg der Basler Medizinischen Fakultät seit den 1570er-Jahren waren zwei führende Anatomen: Felix Platter (1536-1614) und Caspar Bauhin (1560-1624). Sie hatten im Süden Europas studiert, wo sich schon seit Längerem das Bemühen um eine mehr empirische, auf persönliche Erfahrung gestützte Ausbildung durchgesetzt hatte, in der Anatomie wie auch am Krankenbett. Dies war damals Hauptmotiv für viele Medizinstudenten von nördlich der Alpen, zumindest einen Teil ihres Studiums an den grossen Universitäten des Südens zu absolvieren.

Auch der Platter-Schüler Caspar Bauhin studierte im Ausland, so in Padua, wo er bei öffentlichen Sektionen zusah und selbst dabei mitwirkte. Nach seiner Rückkehr nach Basel übernahm er 1582 zunächst die Professur für Griechische Sprache, begann aber bald öffentliche Sektionen abzuhalten und führte einen anatomischen Demonstrationskurs durch. 1589 wurde ihm die neu geschaffene Professur für Anatomie und Botanik verliehen, und im selben Jahr richtete man im Unteren Collegium ein ständiges » anatomisches Theater « ein. Die Anatomie war damit in Basel fest institutionalisiert.

Als anatomischer Schriftsteller trat Bauhin sehr ausgedehnt in Erscheinung. Schon seine «Anatomica corporis virilis et muliebris historia» erlebte mehrere Auflagen. Am bekanntesten wurde er durch sein umfangreiches «Theatrum anatomicum» von 1605. Mit über 1300 Seiten, weit über 100 Abbildungen, zahllosen Belegstellen aus der älteren und jüngeren Literatur, einem ausführlichen Index und Erklärungstafeln bot es, in Albrecht Burckhardts Worten, «das erste handliche und doch vollständige Lehrbuch der Anatomie».

Im Nachfolgenden einmal eine ausschnitthafte Beschreibung der stattgefundenen Auseinandersetzungen von Schober. Tatsächlich kommen nämlich die erforderlichen Inputs nicht von den Anatomen selbst zustande, sondern zunächst anderweitig über die Beschäftigung mit Hermaphroditen, hingegen gelangt dies darüber zu konkretisierenden Auseinandersetzenden, indem man darüber die diversen Details austauscht. Das man sich hierin gar darüber streitet, wer als erster die Klitoris als solche überhaupt entdeckt hat, gehört wie so vieles darüber sich Verbreitenden, zu den Anekdoten der Geschichte, denn diese war in keiner Weise unbekannt, sondern im Gegenteil, hat überhaupt erst über deren isolierte Eigenständigkeit der Neuerung dazu beigetragen, daß sie überhaupt derart ins Unbekannte geriet. Die Kliteros erfährt nämlich seit Urzeiten in vielen Kulturen ihre ganz besondere Aufmerksamkeit, was man vor allem über die Beschneidungsriten erfährt, sowie auch das Verhältniswesen zu den Hermaphroditen. Gerade in diesen Bezügen fand nämlich sehr wohl, gegenüber dem, was man als regulär erachtet, eine konkretes in-Augenschein-nehmen der Geschlechtsorgane und so auch der Klitoris statt. Was hingegen als Neuheit in Erscheinung tritt, ist hingegen die spezifizierende und vereinheitlichende Bezeichnung 'Clitoris'. Nicht nur in den anatomischen Verhältnis bezieht man sich jedoch einzig auf die griechischen und römischen Ursprünge und gerade darin trifft man solche Inbetrachtziehung auch einzig in Ausnahmefällen an, sodaß es sich dem gegenüber auch als regläre Erneuerung stellt. Wesentlich hierbei ist jedoch, daß man gerade hierüber zum Verhältniswesen des weiblichen Penis gelangte, gemäß dem sich dieses Organ nämlich repräsentiert. Betrachtet man sich hierzu die daraus resultierende Darstellung von Bartholin, so erfährt dies darüber auch seine ersichtliche Deutlichkeit. Wie man dem entnehmen kann, gestaltet sich dem gemäß auch nicht mehr das Erscheinungsbildnis über die Vorstellung, sondern man geht dazu über, aus dem Ersichtlichen heraus die Vorstellungen zu erneuern und dem anzupassen. Auch dies beruht auf den Neuerungen, welche auf dem wissenschaftlichen Prinzip beruht, nämlich die Gegebenheiten dem gemäß wiederzugeben, wie sie sich 'augenscheinlich' darbieten. Nicht die Ideologie der Vorstellungswelt ist hierin das Maß der Inbetrachtziehung, sondern die Ideologie der Vorstellungswelt über das Augenscheinliche.

Thomae_Bartholini_01.jpg
Thomae_Bartholini_02.jpg
Thomas Bartholin
Anatomia (1655)


enthält keine Zeichnungen
» «

De Mulierium partibus generationi dicatis (1597)
-

enthält keine Zeichnungen
Verlag: Ludovici König
» «
-
Observationes: Krankheitsbeobachtungen in drei Büchern (1963)
Verlag: H. Hubert
Aus dem Lateinischen übersetzt von Günther Goldschmidt
bearbeitet und herausgegeben von Heinrich Buess
-
Felix Platters "Observationes" (2003)
Verlag: Schwabe
Katharina Huber


» Anatomes (1591) «
» Anatomica corporis virilis et muliebris historia (1597) «

monstrosorumque partuum natura
Verlag: de Bry
» «


Caput XXXIV - De Clitoride (S. 167)
Zeichnungen von Vesal: S. 125,127,153,158
» «


historia epistola anatomica
enthält keine Zeichnungen
» «


ex Caspari Bartholini Parentis Institutionibus
Zeichnungen siehe rechts
» «

» De Re Anatomica Libri XV (1659) «
enthält keine Zeichnungen
» Realdus Columbus «

Divider


Mediziner in Basel um 1600
Campus Verlag
» «


L'Homme - Europäische Zeitschrift für
Feministische Geschichtswissenschaft
(01/18)
Institut für Geschichte - Universität Wien
» «

Die erste bekannte frühneuzeitliche Erwähnung der Klitoris findet sich in Erasmus 'Adagien', einer Sammlung antiker Sprichwörter und Redewendungen. Die Textstelle nimmt das Verb kleitoriazein in den Blick:

"Κλειτοριάζειν Vulgato conuitio dicebantur ij, qui puerorum amoribus oblectarentur, aut, ut ait Diogenianus, mulieres immodice lbidinosae."

Das griechische Verb bezeichne demnach unzüchtige sexuelle Praktiken - zwischen Männern oder von Frauen. In späteren Ausgaben wird dies in der Erklärung mit einer vagen, auf Hesychius und Suidas basierenden Vorstellung von einem weiblichen Körperteil und dessen Reibung verknüpft. In der Basler Ausgabe der 'Adagien' von 1513 allerdings gelang es Ersasmus noch nicht, sich einen Reim auf das antike Sprichwort zu machen - sein scheitender Erklärungsversich zeigt deutlich, dass ihm die Klitoris noch unbekannt war.

Auch dreißig Jahre später bot das wohl berühmteste anatomisch Werk der Frühen Neuzeit keine weiterführenden Informationen. Andreas Vesal (1514-1564) erwähnte in seiner in Basel 1543 erschienenen 'Fabricia' den Körperteil mit keinem Wort. die anatomische Karriere der frühneuzeitlichen Klistoris begann vielmehr nur wenig später in Italien, mit den beiden kurz hintereinander publizierten Werken von Realdo Colombo (1516-1559) und Gabrielle Fallopio (1523-1562). Während sich die Mitglieder der res publica litteraria noch darüber stritten, wem die Ehre der Entdeckung des Organs gebührte oder ob es sich nicht doch um seit der Antike bekanntes Wissen handelte, setzte sich Vesal in einer ausführlichen Antwort auf Fallopio mit den Thesen seines Schülers auseinander. Diese Antwort ist aufschlussreich in Bezug auf den zentralen Aspekt des frühneuzeitlichen Klitiorisdiskurses - die Frage nach der Funktion des Körperteils. Vesal degradierte hier nämlich die Beobachtung Falloppios vom allgemeinen Fall zum nur in wenigen Fällen auftretenden Spiel der Natur (naturae lusum) - zumal bei Hermaphroditen. Es würde sich lediglich um einen Auswuchs ohne Funktion handeln. Damit wurde die Klitoris in Vesals Replik zum Bestandteil des frühneuzeitlichen grotesken Körpers, wie ihn Michail Bachtin beschrieb. Der groteske Körper bestand aus funktionslosen oder ihrer Funktion entfremdeten, nach außen drängenden Auswüchsen. Der anatomische Körper Vesals setzte dem den nur über den anatomisierenden Schnitt und die Beobachtung des Anatomen erschließenden 'inneren Körper' entgegen. Dieser zeichnete sich dadurch aus, dass jedem Körperteil, das eben kein bloßes Spiel der Natur, kein 'lusus naturae' war, eine Funktion für das Körperganze zukam. Vesal wollte dezidiert keine reinen Äußerlichkeiten beschreiben und nichts, das keine allgemeinere Funktion hatte.

Vesals Antwort auf Fallopio konnte nicht verhindern, dass sich vor allem in Frankreich eine aufgeregte Diskussion entwickelte, an der sich einige der heute bekanntesten Autoren der Zeit beteiligten, etwa auch Ambroise Paré (um 1510-1614). Die Inhalte waren gesellschaftlich brisant und reichten von der Faszination angesichts der Lokalisierbarkeit der weiblichen Lust bis hin zu Forderungen nach umfangreichen Klitoridektomien - als Genitalverstümmelungen.

In den 1580ern und 1590ern erreichte das Thema Basel. Es fand Aufnahme in die Publikationen der beiden Ärzte und Universitätsprofessoren Felix Platter (1536-1614) und Capar Bauhin. Vermutlich waren beide dem entsprechenden Wissen während ihrer Studien in Padua und Montpellier begegnet, wo mit Gabriele Fallopio und André du Laurens wichtige Protagonisten des Klitorisdiskurses lehrten. Zurück in Basel integrierte Platter die Klitoris in die Abbildung der weiblichen Geschlechtsteile, die er von Vesal übernahm - und um eine deutlich detailliertere Darstellung der Vulva ergänzte. bauhin beschäftigte sich seit 1590 in mehreren anatomischen Publikationen mit der Klitoris und übernahm dabei auch die Abbildungen seines Kollegen. Die Textstellen zur Klitoris in Bauhins Werken ähneln einander sehr, sind jedoch unterschiedlich ausführlich. In der nachfolgenden Darstellung von Bauhins Argumentation habe ich daher seine verschiedenen Publikationen im Blick, konzentriere mich aber auf das 'Theatrum anatonicum' von 1605. Dieses Werk ist nicht nur inhaltlich am umfangreichsten und am gründlichsten in der Zitation seiner Quellen, sondern war auch in der Folge Bauhins einflussreichste anatomische Publikation.

Bei seiner Darstellung der Klitoris zelebrierte Bauhin sein gegenüber Vesal deutlich erweitertes Wissen richtiggehend. Im ersten Satz in der Randzeile, in welcher Bauhin sorgfältig seine Quellen auflistete, konstatierte er umgehend, dass die Klitoris bei Vesal fehle: 'Vesal de Clitoride nil habet'. Bei der Aufnahme der Klitoris in Bauhins umfassendes anatomisches Kompendium ging es allerdings um deutlich mehr als lediglich um einen Seitenhieb auf Vesal. Im Gegensatz zu Vesal erkannte Bauhin die Klitoris als Körperteil an und integrierte sie als solches in das von ihm im 'Theatrum anatonicum' definierte anatomische Standardwissen der Zeit. Für Bauhin war die Klitoris ganz klar 'membrum' - ein in der Anatomie zu beschreibender Teil des menschlichen Körpers.

Dadurch, dass Bauhin im 'Theatrum anatonicum' auf den ersten Blick kaum deutliche und eigenständige Bewertungen und Präferenzierungen anbot, sondern Wissen von anderen Autoren zusammenfügte, liegt hier ein zunächst merkwürdig diffus und widersprüchlich anmutendes Konglomerat vor. In Bauhins Klitorisdarstellung kreuzen sich Partikel verschiedenster Diskurse von weiblicher Lust, misogyner Zurücksetzung, Befriedigung und (männlichen) Ängsten. Bauhin sprach wie Fallopio vom 'obszünen griechischen Verb' als Herkunft des Wortes Klitoris, vom 'weiblichen Penis', aber erwähnte auch Colombos überschwängliche Bezeichnung 'dulcedo amoris'. Er rief den zeitgenössisch ebenso faszinierenden wie Ängste auslösenden Tops afrikanischer Tribaden, Frauen mit vergrößerter Klitoris, denen homoerotische Praktiken und die Fähigkeit der Befriedigung anderer Frauen zugeschrieben wurde, ebenso auf wie die Bezeichnung 'contemptum virorum' - 'Verachtung der Männer'. Die Klitoris besitze Öffnung und Vorhaut, aber keinen Durchgang, könne anwachsen, reagiere auf Berührung und setze Imaginationen in Gang. Aus der Fülle von frühneuzeitlichen Klitorisbedeutungen und -zuschreibungen, die etwa James Steintrager in seinem Beitrag zur Klitoris zusammengetragen hat, fehlt in Bauhins Darstllung kaum ein Detail. Lediglich die Schutzfunktion der inneren Geschlechtsteile etwa vor Luftzug, wurde bei Bauhin statt der Klitoris differenzierter den Schamlippen zugeordnet.

Am auffälligsten ist seine in der Forschung ja durchaus nicht unbemerkt gebliebene Hervorhebung der Bezeichnung 'penis' oder 'virga muliebris'. In der Reihe der zeitgenössischen Klitorisbezeichnungen strich er diese heraus, indem er sie mit dem Adverb 'proprie' versah. Außerdem beschäftigte ersich damit in der Folge viel ausführlicher als mit den anderen Bezeichnungen wie 'albathara', 'klitoris' oder 'tentigo'. bauhin nutzte so die in der Zeit häufig verwendete Möglichkeit, Körper über Analogisierungen zu beschreiben. Dies diente jedoch einem Zweck. Es ging ihm nämlich nicht einfach um eine Gleichsetzung von männlichen und weiblichen Geschlechtsteilen im Sinne des 'one sex models'. Er betonte sowohl Ähnlichkeiten wie Unterschiede (um Beispiel, dass die Klitoris deutlich kürzer sei als der Penis, nämlich laut seinen Kollegen Platter die länge eines Kaninchenpenis habe). Die Analogisierung ermöglichte es ihm, seine zentrale Aussage für den männlichen Leser verständlicher zu machen - und zugleich die 'Organisierung' der Klitoris als konstitutives membrum des Körperganzen zu unterstreichen. Indem er die Klitoris als ein dem Penis analoges Organ einführte, bereitete Bauhin nämlich den Kern seiner Ausführungen vor: Viel wichtiger als eine ähnliche Lokalisierung oder Form war für ihn die korrespondierende Funktion der Klitoris - das Auslösen des Samenergusses.

Die Analogie zum Penis, oder genauer zum Frenulum, wie im eingangs angeführten Zitat, betonte also nicht die Gleichheit der Körperteile, sondern diente als Verständnishilfe, um die Funktion zu begreifen und damit die Klitoris zu einem eigenständigen 'Organ' des weiblichen Körpers zu erklären. Letztlich schrieb Bauhin die größte Bedeutung weder der Klitoris noch dem Penis zu - sondern den für die Prokreation als nötig erachteten Flüssigkeiten.

Was die Geschichte, wie überhaupt das Verhältnis der Anatomie betrifft, so gilt es sich zu verdeutlichen, daß es eine solche für sich beanspruchende, wie man es im Nachfolgenden antrifft, gar nicht existiert, sondern die anatomischen Kenntnisse regulär über diverse Bezugsverhältnisse zustande kommen. Hierin ist das Gemeinsame die Anatomie des menschlichen Körpers, jedoch nicht die der Inbetrachtziehung, worüber es erlangt wird. Vor allem ist im althergekommenen Bezugsverhältnis der Körper selbst weitläufig gar nicht der eigentliche Inbetrachtziehungsgegenstand, aus dem heraus die Abbildungen stammen. Gerade diese Relationsverhältnisse werden infolge des wissenschaftlichen Werkens in einen Topf geworfen und und als 'wissenschaftliche Vorläufer ausgegeben und führen gerade darüber zu gänzlichen Mißverständnissen über die jeweiligen Sachstände. Vor allem ergibt sich daraus auch gar kein tatsächliches Ersichten der Ursprünge. So ist auch Vesal(ius) in keiner Weise der Grundsteinleger zur Ergründung der menschlichen Anatomie, sondern einzig der erneuernden wissenschaftsideologisierten Anatomie. Zumal das Verhältnis der Ärzteschaft hin zur Medizin dazu in Betracht zu ziehen ist, welches in den wissenschaftlichen Neuerungen gleichermaßen ein völlig neues Bezugswesen aufbringt, welches sich in keiner Weise in eine Reihe stellen läßt mit dem Alten. Die substanzierenden Grundlagen sind völlig andere, was sich vor allem jedoch über das Verhältniswesen der Philosophie gegenüber der Naturwissenschaft darlegt und wie zuvor beschrieben, auch über das markante substanzielle Differenzierungswesen, welches sich sprachtechnisch über das Geschlecht darlegt. Wie sich gerade über die heutige Gegenwart zwischenzeitlich aufweist, ist beides in keiner Weise miteinander vereinbar. Gravierend ist jedoch in dem Bezug, daß man die Geschichte über diese Handhabe der Darlegung des angeblich Einen, gänzlich verändernd umschreibt. Auch hierin trifft man somit auch auf den immer wiederkehrenden Mechanismus, daß man rückwirkend auf das Vormalige einwirkt, sodaß dies selbst darüber gar nicht nur nicht in Erscheinung tritt, sondern in ein ganz anderen Daseins daraus sich erwirkt.


De l'Imprimerie de D. F. Levrault
» «
Dr. en Médicine et Professeur d`Anatomie à Strasbourg

Beschreibung:
» Medicinisch-chirugische Zeitung (1818) «
zweiter Band - S. 43

Der Hr. Verf. füllt mit der Unternehmung dieses Werkes eine Lücke in der Geschichte der menschlichen Kenntnisse aus. Goelicke und Portal haben zwar eine Geschichte der Anatomen, aber nicht der Anatomie geliefert, Lassus begnügte sich, die verschiedenen Epochen der Entdeckungen in dieser Wissenschaft aufzustellen, und Schulze, Leclerc, Freind, Dujardin, Peyrilhe und Sprengel befaßten sich in der Geschichte der Medicin und der Chirugie nur gelegentlich und im allgemeinen mit derselben.

Die Einleitung handelt den Ursprung der Anatomie ab.

I. Buch. Anatomie der Aegypter. Literatur. Einbalsamierung. Skelette.

II. Buch. Anatomie der griechischen Philosophen, historisch und biographisch. Anaxagoras, Democrit, Empedocles, Alcmeon.

III. Buch. Anatomie der Asklepiaden. Allgemeine Geschichte derselben. Im Tempel von Cos fand keine Anatomie statt. Anatomie des Hippokrates und seiner Zeitgenossen. Grundsätze zur Beurteilung derselben. Anatomie des Aristoteles und seiner Zeitgenossen. Besondere Geschichte der Anatomie der Asklepiaden, den verschiedenen Distincten, organischen Systemen und Gebilden nach. Ein besonderer Abschnitt am Schlusse dieses Buches zur Biographie des Hippokrates, Diocles, Aristoteles und Protagoras.

IV. Buch. Anatomie der Alexandrinischen Schule. Allgemeine Geschichte derselben zu Alexandrien und in Italien. Besondere Geschichte derselben in der Osteologie, Myologie u.s.w. Biographischer Abschnitt. Zerophilus, Eudemus, Erasistratus, Celsus, Soranus, Moschion, Rufus, Marinus, Quintus, Lycus, Aelianus, Pelops, Salyrus.

V. Buch. Erster Abschnitt. Anatomie des Galenus. Leben und Charakter desselben. Anatomische Schriften des Galen's. Dessen Anatomie der Thiere, menschlicher Leichnahme, und des Affen, dessen Structur er mit der des Menschen übereinstimmend hält. (Der Verf. macht hier mit Recht die Bemerkung, daß es unbegreiflich sey, wie Galen, welcher über alle Theile der Arzneywissenschaft so viel schrieb, noch Zeit zu Zergliederungsen einer bedeutenden Anzahl der verschiedensten Thiere fand. Er zergliederte auch einen Elephanten.). Pathologische Anatomie Galen's. Besondere Anatomie der organischen Systeme und Gebilde. Anatomie der Schwangern und des Fötus. Zweyter Abschn. Nachfolger des Galen's unter den Griechen. Historischer Theil, welcher die pathologische Anatomie begreift, und biographischer Theil über Oribases, Meletius, Theophilus, Aetius, Vegetius, und über die dem Galen zugeschriebenen Werke. Dritter Abschn. Die Araber. historisch und biographisch. Rhazes, Avicienna, Albucasis, Averrhoes. Vierter Abschn. Anatomie im Mittelalter. Parallele zwischen diesem und dem Alterthum. Ursprung der Universitäten. Erste Versuche zur Wiederherstellung der Wissenschaften. Hindernisse für die Cultur der Anatomie. Biographie von Constantin, Royer, Galicetti, Lanfranchi, Mondini, Guy de Chauliac, de Gradi, Zerbis. Fünfter Abschn. Wiederherstellung der Wissenschaften. Allgemeine und besondere Geschichte der Anatomie in dieser Periode. Biographie von Achillini, Benedetti, Berenger, Massa, Sylvius, Günther, Fernel, Etienne, und Angabe einiger minder bedeutenden Schriftsteller, z. E. Gersdorf, Riff, Le Vasseur, Oryander u.s.w.

VI. Buch. Anatomie der italienischen Schule. Vesal legt den ersten Grund zur Anatomie des Menschen. Oeffentliche Anstalten. Anatomische Abbildungen. Vergleichende Anatomie. Pathologische Anatomie. Besondere Geschichte der italienischen Schule in der Anatomie der einzelnen organischen Systeme, und Gebilde, in den verschiedenen Entwicklungsstufen u.s.w. Im biographischen Theile kommt von italienischen Anatomen das Leben des Vesal, Columbus, Fallopius, Eustach, Vidius, Valverde, Ingrassias, Canani, Aldrovandus, Piecolhomini, Arantius, Fabricius, Varol, Casserius, Jasolinus, Licetus, Spiegel; von deutschen das Leben von Fuchs, Coiter, Schenk, Plater, Alberti, Bauhin und F. R. Salzmann; von französischen das Leben von Rondelet, Delaurens, Cabrol, Pineau, Botall; von holländischen das Leben von Bontius, Zeurnius, Paaw; von dänischen das Leben von Bartholin.

Wie es sich mit der Anatomie als solches verhält, erfährt man über die Gegenwart, zumal über die Präsenz Gunther von Hagens' Körperwelten. Was kaum jemanden bekannt ist, ist der Umstand, daß seine Intension einst darüber entstand, daß dieser sich in seinem Medizinstudium mit Plastikpuppen als Lehrmaterial konfrontiert sah, die sich diesem Studium gegenüber regelrecht als vorsinnflutlich erweisen. Seine Intension hat sich, wie sich aufzeigt, nach wie vor nicht geändert, jedoch hat sich gerade dieser Bezug bisher nur vereinzelt umsetzen können, um Zeitgemäßes als wissenschaftliche Lehrexponate zu etablieren. Der Punkt ist jedoch und dies wurde auch eindeutig Vesalius einst nicht klar, daß es regulär doch gar nicht die Ärzte und Anatomen sind, welche in diesem Lehrbetrieb ausbilden. Die Lehrkörper haben regulär gar keinen Bezug zur Praxis, zumal alle miteinander der Vorbedingung dieser Ausbildung unterliegen. Wie kann sich somit hierin das Pragmatikertum überhaupt einbringen und umsetzen? Nämlich in dem Konstrukt in keiner Weise, da es hierüber nämlich aus seinem Grundsatz heraus außen vor gestellt wird, räumlich, sachlich, wie personell auf der Trennung basiert. So gelangt ein Pragmatiker auch überhaupt nicht dort hinein und darauf basiert es auch, daß man pragmatische Exponate auch daraus fern hält. Die Pragmatiker können einzig neue Kenntnisse ausbilden, jedoch wie diese darin zur Umsetzung gelangen, bestimmt sich in diesen Lehranstalten in keiner Weise über das Pragmatische, sondern über die dem entsprechende Abgrenzung dazu und somit steht auch die Erkenntnissgewinnung darüber außen vor. so walten darin auch nach wie vor noch die alten Chematas vor, in welchem die Bildnisse darin die Grundlagen bilden und man einzig darüber ausbildet. Es ist an sich auch das Pondant zum Handwerk, wo der Lehrling nicht die Tätigkeit vollzieht, wofür dieser im Anschluß an die Lehre hingegen seine Bescheinigung erhält. Es trägt hier wie dort einzig den Schein eines Statuses, welcher als solcher erfüllungstechnisch gar nicht existiert. Tatsächlich ist die erforderliche pragmatische Lehre in beiden Verhältnissen dem Jeweiligen selbst überlassen, inwiefern er sich dies selbst verschafft und darauf beruht der Status, welcher dies nämlich im Anschluß daran von diesem selbst einfordert. Wem ist dies jedoch bewußt?

» Andreas Vesalius «
Welcome (1543)

Vesalius_body.jpg

» Honoré Fragonard «
» Musée Fragonard «
» Pferd und Reiter (1771) «

Fragonard.jpg

» Gunther von Hagens «
» Körperwelten «
Pferd und Reiter (2000)

Von_Hagens.jpg

Was suggerieren diese Bildnisse der Repräsentanten der Anatomie?

Das Leben!

Das Elementare, was mit der neuen Wissenschaft auf den Plan tritt, ist das gänzlich andere Substanzwesen. Während man zuvor den Menschen im Verhältnis von Leib (dem Körperlichen) und der Seele (Anima) erachtete, wandelte sich dies zu einem reinen Verhältnis des Körperlichen, dem gegenüber man die Unkörperlichkeit als eine unhaltbare Substanzlosigkeit ins Abseits stellte und einzig noch den Geist als ein zu erachtender Bestandteil aktzeptiert, welcher dem Körperlichen zugeordnet wird. Was zeigen jedoch diese Bildnisse? Körper ohne Leben. Ist jedoch das Leben einzig eine Suggestion? Wie kann es sein, daß ein Körper einerseits lebendig und anderseits ohne Leben ist und sich körperlich doch gar nicht voneinander unterscheidet, sondern erst im Verlaufe der Leblosigkeit eine verändernde Erscheinung zutage tritt? Ist das Leben (k)eine Substanz? Wie man hieraus sich vor Augen führen kann, hat in dieser wissenschaftlichen Entwicklung im Dunkeln verborgen etwas stattgefunden, was an sich gar nicht übersehen werden kann. Und doch ist es der Stand der Dinge, nach wie vor, daß man einzig die substanzielle Präsenz, welche den Augen ersichtlich ist, als alleinige Präsenz des Seins erachtet. Das Leben als solches existiert darin einzig als eine Mechanik und im Regelfall fällt es den Menschen noch nicht einmal auf, aufgrund der Selbstverständlichkeit der Verbundenheit der Menschen Körper mit dem Leben. Und so verwundert es diesen auch nicht, wo doch das Leben sich über das Körperliche fortsetzt, dem gegenüber es beim Tode sich verflüchtigt und er gerade dies doch gar nicht erlebt, sodaß er den Unterschied darüber nachvollziehen könnte, wie es sich damit verhält. Den Tod bewahrt man indess im Dunkeln, genau so, wie die Sexualität, sodaß auch ja nicht in Erscheinung treten kann, was sich darüber darbietet.

Man möge sich gemäß Nachfolgendem, mustergültig vor Augen führen, daß man beständig mit einer Mischung von Platonismus und Aristotelismus konfrontiert ist - der Vorstellung und Bildnisse (der Idee) über das Sein und dem Sein selbst. Derart sind die Gegebenheiten auch zu sondieren, denn hierin ist maßgeblich, daß das Sein sich durch sich selbst abbildet und es somit um eine Konfrontation der Gegenüberstellung mit den geistigen Abbildungen handelt, die der Mensch zu bewältigen sucht. Das es im Selbst jedoch in seiner substanziellen Gegebenheit einzig miteinander gegeben ist, gegenüber dem Sein außerhalb dessen, darin besteht die wesentliche Markantz und basiert darauf, daß sich einzig im Selbst Subjekt (Wahrnehmung) und Objekt (Wahrnehmendes) überschneiden - als solches Eins sind - und darin somit auch das Zentrum besteht, von dem aus die Erachtung seine wahrliche Umsetzung erfährt. Ich hatte mir in den ersten Jahren der spezifischen Auseinandersetzung mit der Selbstverständlichkeit meiner Innenwahrnehmung, welche sich mir bereits als Jugendlicher ergab, gegenüber dem regulär antreffenden Unbewußtsein bei Anderen, nicht erklären können, wie es sein kann, daß es sich derart ergibt. Indess ist es mir zwischenzeitlich klar geworden, gerade über das, was man über Nachfolgendes darlegt. Der Punkt ist, daß anderen ihre Selbstverständlichkeit darin besteht, sich in anderem zu ersehen, hingegen ihr Selbst, welches dem nicht entspricht, als solches darin nicht erscheint und somit auch nicht seine Ersichtung erfährt. Auch hierin hat man somit die Gegebenheiten umgekehrt. Nicht das Selbst bildet die Grundlage, sondern es erweist sich als das erforderlich Resultierende und somit schottet sich das (unterbewußte) Selbst auch regelrecht dem gegenüber ab (dem gegenüber es regulär offen-sichtlich ist). Gleichzeitig kann es auch einzig derart in Erscheinung treten, indem man es selbst nicht in Erscheinung treten läßt. Dies ist ein wesentlicher Grund, warum man auch immer mehr einzig Bildnisse handhabt und das Sein selbst darüber systematisch außen vor gerät. Inwiefern betreibt man heute noch diese anatomischen Studien, als Grundlage der Lehre, wie es einst als Voraussetzung aufgebracht wurde? In keiner Weise, denn tatsächlich wurde dies einzig gewährt, um über die Bildnisse zur Repräsentanz des Gemeinwesens zu gelangen. Gibt es indess irgend einen Menschen, welcher diesem Bildnis entspricht? Nein, und darauf beruht auch das stattfindende Gemeinwesen, welches über die Abbildung des Gemeinwesen's Selbst der Menschen Einheit - deren Selbst repräsentiert. Hingegen ergibt sich für Diejenigen, die sich selbst ersehen und darüber erkennen, daß sie anders sind und darin nicht vor kommen, daß diese sich damit begnügen müssen, ihr Selbst aus ihrem eigenen Selbst heraus zu begründen. Ein wahrlich wesentlicher substanzieller Unterschied und zwar gegenüber beiderlei Gegebenheiten und darüber ist aber auch nachvollziehbar, warum man es derart erfährt, wie es die Gegebenheit darin ist.


nach ihrer Beziehung auf anatomische Wissenschaft und bildende Kunst
Verlag: Rudolph Weigel
» «

Von 1543 bis 1627 (S. IX)

Wie das Streben nach anatomischen Berichtigungen und Entdeckungen in Verbindung mit der Gewohnheit, nicht mehr scbematisch, sondern nach der Natur selbst bildlich darzustellen, auf Beseitigung hergebrachter Irrthümer, auf Bereicherung der anatomischen Wissenschaft und auf Verbesserung der anatomischen Abbildung selbst hinwirken musste, so wurde andererseits aus dem Bestreben der von den Anatomen für ihre bildlichen Darstellungen beschäftigten Künstler, neben der Richtigkeit und Naturtreue auch auf Schönheit der anatomischen Darstellungen zu sehen, die Ermittelung der wahren anatomischen Mittelform vorbereitet, und am meisten machte sich dies in den Skeletten und Muskelkörpern bemerkbar. Dass es eine anatomische Mittelform gebe und dass diese eine schöne sein müsse, ward weniger wissenschaftlich erkannt, als künstlerisch gefühlt; der Künstler war zu dieser Ueberzeugung gekommen, weil die schöne Form des Nackten, abhängig von dem Knochen- und Muskelbaue, auch für diesen die schöne Form als nothwendig voraussetzt, und der Anatom theilte dieses Gefühl, weil der anatomischen Mittelform, als der von der Natur erstrebten Gestalt, die allgemein in den Naturwerken uns als Schönheit ansprechende ideale Zweckmässigkeit auch zukommen muss.

Von 1737 bis 1778 (S. XV)

Alles dieses theils aus früherer Zeit Ueberkommene, theils neu Geschaffene, überragten bald die Bemühungen des leidener Anatomen Bernhard Siegfried Albinus, in welchen die gelehrte Behandlung der Anatomie als Kritik der älteren Leistungen, die sorgfältigste Erforschung des Einzelnen in der Natur und künstlerischer Sinn für anatomische Auffassung und Darstellung fruchtbar sich vereinigten. Hierdurch ward eine neue Richtung der Anatomie begründet, wie früher durch Vesal. Die Zeit selbst war aber eine andere geworden, mehr der Wissenschaft zugewendet, als der Kunst, der Schauplatz der Wirksamkeit beider Anatomen dazu ein ganz verschiedener. Wenn Vesal von seinem Jahrhundert getragen und in Italien wirkend mit sicherem Tact und künstlerisch gebildetem Auge die anatomische Mittelform, namentlich im Skelet und in den Muskeln, richtig gefunden hatte, so ward jetzt, bei dem unzweifelhaft festgestellten Grundsatze, dass nicht das individuell in einer Leiche Vorgefundene darzustellen sei, sondern aus der Menge des Beobachteten die wahre Form zu ermitteln, dieses auf wissenschaftlichem Wege versucht und ein eiserner Fleiss auf die feste Bestimmung dieser Form und auf deren bildliche Darstellung verwendet, wobei allerdings die Künstlerhand des grossen Jan Wandelaer die Vollendung geben musste. Von jetzt an konnte nur die grösseste, durch Zirkel und Maassstab hergestellte anatomische Genauigkeit, die möglichste Naturwahrheit in der Darstellung und die alles Individuelle beherrschende, aus zahlreichen Individuen wissenschaftlich erforschte Mittelform auf Beachtung Seiten der Wissenschaft Anspruch machen, und dieses bezeichnet die von Albinus begründete Epoche anatomischer Darstellung, welche der leidener Schule angehört.

Divider

Prinzipien des Da-Seins

Divider

Den Inbetrachtziehungen und Ideologien gegenüber dem Differenzierungswesen der Geschlechter, gilt es zur Fortführung des Weiteren, die zugrundeliegenden Prinzipien des Einheitswesens gegenüber zu stellen. Während man ursprünglich die Wesensart aus der Fortpflanzung zu ergründen und begründen ersuchte, hat sich dies dahingehend gewandelt, dies auf die substanzielle Körperlichkeit zu übertragen und ergründet daraus auch das Vereinigungswesen. Elementar ist hierin jedoch, daß die geschlechtliche Differenzierung zu dem bestehenden Organismus, in seinem Ursprung hinzu gelangte und somit ist auch der Organismus kein Geteilter darin, da dies eben nicht dem Organismus wiederfuhr, wie es sich als allgemeine Inbetrachtziehung aufweist, sondern sich als ein Zusätzliches des Organismus stellt, gemäß dem, wie es sich auch mit den Gliedmaßen verhält und sich vergleichsweise stellt. Dem gegenüber funktionieren die organischen Einheitswesen in ihrem funktionalen Konstrukt gemäß eines Kollektivs, sodaß jeder funktionale Bestandteil auf den Gesamtorganismus, wie auch der Gesamtorganismus auf das jeweilige Einzelne aufeinander einwirkt und miteinander kombiniert sich umsetzt. Somit ergibt sich daraus auch eine entsprechende Unterscheidung des Auswirkungswesens über die Gesamtwesensart, die sich im Verlaufe daraus entwickelt hat. Jedoch handelt es sich nicht um eine Andersartigkeit des Organismus, sondern um eine ausdifferenzierende sexuelle Prägung, worin es sich wie ein Links und Rechts stellt und es das Eine nicht ohne das Andere gibt und beides miteinander die Einheit repräsentiert und somit auch die Wesensart und Funktionalität des Geschlechts- und Fortpflanzungswesens aus diesem Verhältniswesen heraus fungiert.

Ein wesentlicher Bestandteil der ergründeten Neuentwicklung der Wissenschaft, basiert auf der Grundlage, in Erfahrung zu bringen, welche körperlichen Bestandteile es sind, welche dieses Kernwesen ausmachen. Und hierin ist man dann auch dazu gelangt, zwischen Fortpflanzungs- und (reizwirkenden) Geschlechtsorganen zu unterscheiden. Dies ist eine wesentliche Bewandtnis, zumal das Wirken und die Auswirkungen des Jeweiligen sich auch nicht als ein Einheitswesens aufweist. Vielmehr ist es das Geschlechtswesen, was zur Fortpflanzung und somit zur Umsetzung der Wesensart der Fortpflanzung überhaupt führt. Dies zeigt sich maßgeblich auch in seiner Besonderheit des Händlings kultureller Jungfräulichkeit der Frauen, welche, soweit man zu den alten Kulturen informell gelangen kann, bereits die Grundlage des geschlechtlichen Händlings begründet, in seiner ausdifferenzierenden Bewandtnis zur Fortpflanzung. Ein wesentlicher Bestandteil des Menschen evolutionären Entwicklung basiert, gerade auch über dieses Musterbeispiel unübersehbar hervortretend darauf, die Gegebenheiten des Seins, nicht wie die Tiere, rein instinktiv zu händeln, sondern über seinen geistigen Verstand - und somit dem Verständnis über das Dasein. Es stellt sich aufweisenderweise nicht als eine kulturelle, sondern als eine grundlegende evolutionäre Auseinandersetzung, mit dem bewußten Erfahren und dem geistigen Umgang damit. Es dreht sich hierin um zwei Kernwesen des Menschen Dasein, die es erfahrensbewußt, gemäß der Erfordernis der Menschlichkeit und somit funktional, miteinander zu koordinieren gilt. Und gerade was die Präsenz des Instinktiven und dem damit Verbundenen betrifft, so wird dies von der Philosophie, jedoch spezifisch von der Wissenschaft, prinzipiell außen vor gestellt, mit der Begründung, daß der Mensch kein Tier sei und somit rein geistig handle. Tatsächlich ist es jedoch nach wie vor, wie auch bei den Tieren der Instinkt, welcher die Handlungen ausführt, dem gegenüber der Geist einzig, vergleichsweise der Reiter des Pferdes ist. Dieser ist in der evolutionären Entwicklung hinzu gekommen, jedoch fundiert nicht dieser das personelle Selbst, dem gegenüber die geistige Identität daraufhin einzurichten ist, damit die Funktionalität des Einheitswesen gewährleistet ist.

Zum Nachvollzug der ursprünglichen Sichtweisen zum Geschlechtswesen, welche man über die Schriftenwerke erfährt, gilt es, sich vorab die jeweiligen Kenntnisstände vor Augen zu führen, worin vor allem die Gegebenheit, daß das weibliche Ei erst im 19. Jahrhundert als solches entdeckt und bekannt wurde, die Besonderheit des Vorigen ausmacht. Gerade auf der Grundlage dieser spezifischen Unkenntnis und das man dies damit verbunden, wenn überhaupt in Erwägung zog, beruhten die diversen Ideologien, in welchen man auch gar nicht das Selbst, sondern seine Beschreibung und Inbetrachtziehung aus dem allgemeinen Fortpflanzungswesen heraus ergründete. Es basierte somit vor allem auch nicht auf der Inbetrachtziehung des Geschlechts selbst, sondern des Prinzips. Maßgeblich hierin sind zumal auch die mystischen Grundlagen, in welchen man den Ursprung der Dinge und das Stattfinden der Wirkungen, im Wesentlichen ursächlich Göttlichkeiten zuschreibt und sich darin vor allem darauf bezieht, da man den ersten/letzten Grund nicht (anders) kennt und darauf beruhend, die diversen Verhältnisse entsprechend prägt. Hingegen verschiebt sich dies, gemäß des Ausbreitens der Naturwissenschaften, hin zu den zugrunde liegenden Symptomen, was auf dem neuerlichen Naturverständnis beruht, in welchem, gemäß des Atoms, das Jeweilige im Selbst begründet man erachtet. Gravierend ist somit auch, daß man es hierin, sowohl sach-, wie sprachtechnisch, mit einer ganz anderen substanziellen Wesensbetrachtung zu tun hat, dem gegenüber die Neuerungen zwar Detaillierungen hervorbrachten, welche zuvor nicht präsent waren, es sich jedoch hierbei um eine absolute Quantisierung handelt, dem gegenüber das Vorige darüber nicht mehr darin ersichtlich ist und darüber auch nicht nachvollziehbar ist, da sich das Vorige prinzipiell auf die Gesamtwesensarten bezog. Die Inbetrachtziehung des Alten ist somit auch generell aus dem heutigen Gegenwartsverhältnis unmöglich, sondern es bedingt dazu grundsätzlich des Hineinbegebens in die jeweilige Gegenwärtigkeit und dessen inhaltlich erachtendes Substanzwesen. Sowohl die Perspektive, wie auch das Substanzwesen verkehrt sich hierin in eine gänzliche Umkehrung, dem gegenüber jedoch sowohl als auch in Betracht zu ziehen ist, denn es handelt es sich hierbei keineswegs um zwei Seiten des Daseins.


(Bekanntgabe zur Entdeckung des menschlichen Eies)
» «

Über Entwickelungsgeschichte der Thiere

» Zweiter Teil (1837) «
(vergleichende Embryologie)
» «


Die Grundlegung der Embryologie im 19. Jahrhundert
Verlag: Shaker
Sächsische Akademie der Wissenschaften zu Leipzig
Hrsg.: Prof. Dr. Dr. Ortrun Riha

Ortun Riha: Obwohl die internationale Wissenschaftshistoriographie in den letzten Jahren eine ganze Reihe von theoretischen, ideen-, kultur-, sozial- und mentalitäts- geschichtlichen Fragestellungen entwickelt hat, die in Bezug zur Embryologie stehen, blieben die ersten Jahrzehnte des 19. Jahrhunderts ein weitgehend 'unbeackertes' Feld. Die Forschungslücke zwischen den beiden bisherigen Schwerpunkten im 17./18. Jahrhundert einerseits und dem späten 19. bzw. dem 20. Jahrhundert anderseits wird mit der vorliegenden Monographie geschlossen. Deren Gegenstand ist somit genau diejenige Phase, in der sich die Embryologie von naturphilosophischen Erklärungsmustern löste, sich die 'modernen' naturwissenschaftlichen Methoden zu eigen machte und in deren Gefolge wiederum eine neue Begrifflichkeit und eine neue theoretische Fundierung erfuhr. So fallen die für das Verständnis der Entwicklungsvorgänge grundlegenden Entdeckungen in diesen Zeitraum: Keimblattkonzept, Säugetier-Ei, Chorda dorsalis und Kiemenanlagen bei Landtieren; allein dieser Umstand macht eine solche Untersuchung zu einem lohnenden Unterfangen. Für das Akademie Projekt "Wissenschaftsbeziehungen im 19. Jahrhundert zwischen Deutschland und Russland auf den Gebieten Chemie, Pharmazie und Medizin", in dessen Rahmen das Buch entstand, bot sich diese Thematik jedoch darüber hinaus insofern an, als die Akteure - allen voran Christian Heinrich Pander, Karl Ernst von Baer und Martin Heinrich Rathke, aber auch andere Forscher, die bisher weniger Beachtung fanden, - ganz überwiegend in der relativ kleinräumigen Wissenschaftsregion zwischen Königsberg und St. Petersburg (und damit zwischen Preußen und dem Russischen Reich wechselnd) tätig waren; vor allem die Universität Dorpat spielte durch ihre transnationale Scharnierfunktion eine zentrale Rolle. Die Ergebnisse der Untersuchung gehen jedoch über Biographien und Institutionengeschichte hinaus: Der durchgängige Rückgriff auf die historischen Originalarbeiten ermöglichte zum einen die Veröffentlichung bisher unbekannten Materials und zum andern auf dem Weg der Diskursanalyse eine Neubewertung des Paradigmenwechsels in der Embryologie. Dieser vollzog sich keineswegs abrupt, sondern in zäher Auseinandersetzung mit nach wie vor persistierenden naturphilosophischen Konzepten, denen nicht nur ein Teil der Terminologie, sondern auch die Affinität zu Deduktion und Analogie entstammte. Parallel dazu lässt sich die Ablösung der Säftelehre durch die Zelltheorie beobachten, aber auch auf dieser Ebene konnte das neue Modell seine Überlegenheit gegenüber traditionellen Plausibilitäten nur langsam erweisen, so dass insgesamt die Gründungsphase der modernen Embryologie weniger einen Umbruch als die 'Gleichzeitigkeit des Ungleichzeitigen' exemplifiziert.

Somit ist auch bezüglich der Ärzteschaft, welche man über die Griechen vermittelt bekommt, zu bedenken, daß deren Grundlagen sich elementar von dem der neu entstandenen Medizin unterscheidet. Gleich ist indess, daß sich dies ebenfalls aus dem Generellen der allgemeinen substanziellen Naturkundlichkeiten heraus begründete und dem gemäß einst auf den vier Grundelementen von Erde, Wasser, Luft und Feuer beruhte. Gemäß dem erachtete man die Befindlichkeiten auch gemäß des Verhältnisses der Eigenschaften dieser Elemente. Zu Grunde liegender Unterschied ist jedoch, nicht nur gegenüber dem Neueren der Medizin, sondern auch gegenüber den einstigen griechischen Philosophen, deren elementaren Anwendung des Grundprinzips der Ausgewogenheit. Wie sich aufweist, so stammt gar beiderlei von den Ägyptern, wohingegen das Elementarprinzip der Ausgewogenheit einzig von den Ärzten und wie sich ausfindig machen läßt, auch von den Pythagoreern derart zur Grundlage wurde, wohingegen es bei den Ägyptern, von Grund auf das Lebens- und damit verbunden das Gerechtigkeitsprinzip repräsentierte. Dem gegenüber ist es bei den griechischen Philosophen nicht nur im Bezug der Gerechtigkeit, der Geist das Zentrum der Erachtung, sondern generell wird darin das Sein daraus ergründet, sodaß hierin die Erkenntnis die Grundwesensarten begründeten. Gerade diese geistige Grundwesensart, welche im späteren Verlauf auch in unsere Kultur gelangte, löste aus diesem Verhältnis heraus auch die elementare Unterscheidung von Wahrnehmung und Vorstellung auf, was man speziell über die Auflösung der Unterscheidung von Bewußtsein, Geist und Gehirn erfährt. Diese substanzielle Vereinheitlichung und die gänzliche Quantisierung des pythagoraischen Zahlensystems, bilden indess die Grundlage des neueren naturwissenschaftlich-physikalischen Natursystems.

» Melancholie im Mittelalter «
Eine antike Tradition als Vorentwurf der Moderne
Daria Norma Jansen

Mit einem Krankheitsbegriff, der nicht länger totalisierend, sondern dynamisch und lokal verstanden wird, entwickelt die Humoralpathologie eine Distanz zum Numinosen und bildet Assoziationsmechanismen zwischen Symptomatik, menschlicher Konstitution und Umwelt aus. Dabei steht ein ursprüngliches naturwissenschaftliches Bestreben im Zentrum dieser Medizin: die Suche nach einem rationalen Verständnis und das Durchdringen kausaler Ursache-Wirkung-Beziehungen. Silke Esterl erkennt in der mit dem Corpus Hippocraticum gebildeten Schule das "Bestreben, über die Nosologie hinaus zu einer Ätiologie, also einer Ursachenbestimmung, zu kommen.

Für die Beschreibung und Therapie geistiger Erkrankungen bietet die Humoralpathologie einen Raum außerhalb theologischer Praktiken, indem eine direkte Verbindung zwischen Seele und Körper fokussiert wurde. Die Humoralpathologie lässt sich damit als einen frühen Versuch verstehen, seelische Störungen mit empirisch nachvollziehbaren Termini zu beschreiben und kausal auf überschaubare Ursachen zurückzuführen, um ihnen dadurch "einen Teil ihres Schreckens und ihrer Unberechenbarkeit" zu nehmen. Indem psychische Erkrankungen zu medizinischen Phänomenen erhoben - und somit dem Kompetenzbereich der Ärzte und nicht länger den Priestern oder Magiern zugeordnet - werden, vollzieht sich eine elementare, trennscharfe Abgrenzung der Disziplinen: "In seinem Buch Über die heilige Erkrankung [de morbo sacro] vollzieht Hippokrates deshalb nicht nur eine Trennung zwischen Beobachtung und Aberglaube, sondern auch eine zwischen Medizin, Philosophie und Theologie, dem Glauben und dem Wissen.

Die Denkrichtung der hippokratischen Medizin von einer deskriptiven Nosologie zu einer interpretierenden Ätiologie gelingt über die Etablierung eines theoretischen Systems, der Elemente- und Säftelehre, die den Rahmen markiert, innerhalb dessen Diagnose und Therapie praktiziert werden können. Die Säftelehre postuliert die Vorstellung, dass die Gesundheit des Menschen auf einem Gleichgewicht (eukrasia) der Mischung (krasis) der vier humores (Blut, Schleim, gelbe und schwarze Galle) basiere. Mit einer Störung dieses Gleichgewichts entstehe ein Missverhältnis dieser Säfte (dyskrasia), was als Ursache für die Ausprägung seelischer und körperlicher Krankheiten verstanden wird.

In dem Text De natura hominis ('Über die Natur des Menschen', ca. 400 v. Chr.), der wahrscheinlich von Polybos stammt, wird die idealtypische Vorstellung der eukrasia anschaulich beschrieben: "Am gesundesten ist der Mensch dann, wenn ihre gegenseitige Mischung, Wirkung und Menge ausgewogen und wenn sie am innigsten verbunden sind, krank aber, wenn einer der Säfte in zu großer oder zu geringer Menge vorhanden ist oder sich im Körper absondert und nicht mit allen vermengt ist." In der hippokratischen Lehre entsprechen die vier Körpersäfte den "kosmischen Elementen und Perioden, sie beherrschten das ganze Sein und Verhalten des Menschen" und können in ihrer Zusammenstellung je nach Jahreszeit schwanken (so dominiert die schwarze Galle zum Beispiel im Herbst, während ihr der Winter unlieb und der Frühling feindlich). Extreme Abweichungen vom Gleichgewicht dieser Säfte führen dabei zu pathologischen Veränderungen des menschlichen Organismus und können psychische und physische Krankheiten auslösen.

Die Verehrung der Vierzahl und die Vorstellung, dass eine krankhafte Veränderung aus der Störung einer Gleichgewichtslage erwachse, lassen sich auf einen pythagoräischen Ursprung zurückführen.

Alkmaion von Kroton, ein pythagoräischer Arzt, der um 500 v. Chr. gelebt hat, erklärt, die Gesundheit werde durch das gleiche Recht (ἰσονομία) der Kräfte (δυνάμειζ) erhalten [...]. Die 'Alleinherrschaft' (μοναρχία) einer unter ihnen sei die Ursache der 'Krankheit"; und er faßt den Begriff der Gesundheit in die Formel der 'gleichmäßigen Mischung der Qualitäten' (σύμμετροζ τῶν ποιῶν κρᾶσιζ) zusammen.

Und auch wenn die Pythagoräer die Vier-Säfte-Lehre nicht selbst entwickelten, "bereiteten sie den Boden dafür, indem sie eine Reihe tetradischer Zuordnungen aufstellten [so z.B. [...] Feuer, Wasser, Luft und Erde; Frühling, Sommer, Herbst und Winter], in deren System die vier Säfte späterhin eintreten konnten." Empedokles erweitert das vollkommene Zahlensystem der Pythagoräer um den semantischen Gehalt einer kosmischen Elementenlehre. Mit Blick auf die pythagoräische Tradition postuliert Empedokles eine Beziehung zwischen den Naturstoffen und der Dynamik der Jahreszeiten. Bei Empedokles lassen sich an dieser Stelle Gedanken der älteren Naturphilosophen, wie Thales oder Anaximenes, wiederfinden, die alles Sein und alles Stoffliche auf ein einziges Urelement zurückführen. Dieses Postulat der Einheit verbindet Empedokles mit dem System der Vielheit der Pythagoräer und gelangt dabei zu einer Elementen-Lehre, "die die 'vier Wurzeln des Alls' [mit] vier [...] kosmischen Grundwesen gleichsetzte: Sonne, Erde, Himmel, Meer". Über Philiston wird dieses Konzept um "den Gedanken [ergänzt, dass] jedes dieser Elemente eine bestimmte Qualität (δύναμιζ) besitze: 'zum Feuer gehört Hitze, zur Luft Kälte, zum Wasser das Feuchte und zur Erde das Trockene'." Durch diese Verbindung tritt die Empedokleische Elementenlehre in Einklang mit einer Qualitätenlehre - "mit dem Erfolg, daß die Elemente ihre starre Stofflichkeit verl[ie]ren". Empedokles betont neben Verteilung und Mischung auch die Bedeutung eines ausgewogenen Mengen- und Größenverhältnisses. Erst eine vollkommene Mischung ergebe den Menschen, "der den größten Verstand und die schärfsten Sinne besitz[e]".

Dieses ideengeschichtliche Kompendium fließt in Polybos 'De natura hominis' zu der eigentlichen Vier-Säfte-Lehre zusammen. Es gelingt, die "rein medizinische Säftelehre und eine allgemein-kosmologische [...] Spekulation in einen systematischen Zusammenhang zu bringen".

Polybos versteht das Gleichgewichtsideal der eukrasia als Basis der menschlichen Gesundheit. Die Absonderung oder 'Alleinherrschaft' eines der Säfte stört die versierte Harmonie und führt somit zu einer Erkrankung des Organismus: "Wenn einer davon sich absondert und für sich allein bleibt, muß nicht nur die Stelle, die er leer läßt, krank werden, sondern auch diejenige, wo er hinfließt und sich ansammelt, weil die Überfüllung Schmerz und Beschwerde verursacht." In diesem Wirkzusammenhang zwischen Gesundheit und Krankheit steht auch die humorale Therapie, die das Ziel verfolgt, die Körpersäfte wieder in ein harmonisches Gleichgewicht zurückzuführen, indem überschüssige, krankmachende Säfte aus dem Organismus entfernt werden. "Dies erfolgt z.B. mithilfe von Brechmitteln, Aderlässen, Blutegeln, Brandgeschwüren zur Erzeugung von Heilfieber." Präventiv soll eine gesunde Diätetik dazu beitragen, dass das Gleichgewicht der Säfte bestmöglich unterstützt wird.

In dieser Form gewinnt die Vier-Säfte-Lehre eine weitreichende medizinische und naturphilosophische Bedeutung. Im 2. Jahrhundert n. Chr. knüpft der Eklektiker Galen explizit an die hippokratischen Schriften an und etabliert "die Säftelehre, also den Urbestand der hippokratischen Medizin", als einen zentralen Bestandteil kanonischer Lehre, der bis zu den Naturphilosophen des Mittelalters in dieser Form Gültigkeit behalten sollte.

Wie sich aufweist, so sieht man sich nicht in der Lage, die Grundlagen der ägyptischen Astrologie nachzuvollziehen, woraus sich deren Mythologie begründete, was darauf beruht, daß man hierin die Verknüpfung mit der Astronomie voraussetzt, an dem man es zu ermessen sucht. Über dieses Musterbeispiel gilt es einmal hervorzuheben, was sich daraus entwickelt und wie es sich damit verhält. Dies läßt sich hierin vor allem auch aus der Gegenwart heraus demonstrieren, über die präsente Anwendung der daraus abgeleiteten Astrologie, in welcher man nämlich die Astronomie daran gekoppelt hat. Und es kann auch ein Jeder für sich darüber nachvollziehen, über deren Anwendung des astrologischen Charakters, bei dem man nämlich diesen aus dem Geburtszeitpunkt heraus, übertragend auf die Sternenkonstellation, berechnet. Im Moment der Geburt findet indess gar nicht die Prägung der mentalen Veranlagungen und somit auch nicht die des Charakters statt, sondern im Moment der Zeugung (worüber schwanger Frauen zu berichten wissen, da im Mutterleib sich dies bereits anhand seiner Lebhaftigkeit zeigt). So basiert dem gemäß auch die ursprüngliche Ermittlung des Charakters der alten Ägypter, nicht berechnend aus den Sternenkonstellationen, sondern aus dem Ermitteln des Wirkens des (geborenen) Menschen, welches man dem Prinzip des jeweiligen Sternenbildes gegenüber stellte, um es dem gegenüber zu ermessen und nicht, um es daraus zu ermitteln. Das Verhältnis und Anwendungsprinzip verdeutlicht sich dem gemäß auch über deren Götter, welche entsprechend der Mythologie, zunächst auf der Erde lebten, sich jedoch davon entfernten und zu Sternen am Himmel wurden. Maßgeblich hierin ist, daß das Wirken gar nicht an und in den Sternen zu ermessen ist, sondern einzig aus dem Wirken auf der Erde, gemäß dem es sich auch mit dem Ermessungswesen gegenüber der Götter stellte. Zumal es hierin darum ging, das Wirken selbst (und somit der Götter) zu ermessen und nicht das von Planeten, hatte es somit auch nichts mit der Astronomie zu tun, die sich davon scheidet. Hingegen ist die Entwicklung, dies miteinander zu verbinden schon das Richtige, nur bedingt es darin auch des funktionalen Verbundes, was man augenscheinlicherweise noch nicht, entsprechend der Erfordernis, vollzogen hat.

Das substanziell Elementare jedoch, was die Ägypter aufbrachten, ist das ermessende Prinzip der Ausgewogenheit und gerade dies erweist sich auch als das Zugrundeliegende des Seins der erfahrenden Einheitswesen, welches sich über das Harmonie- und Disharmonieverhältnis unserer Gefühle wiederspiegelt. Dem gegenüber ermisst man indess das Sein dessen gemäß des Erscheinungswesens der Empfindungsreize der Nerven, welche hingegen einzig die Intensität der Präsenzen wiederspiegeln und nicht dessen Natur des Verhältnisdaseins. Gerade diese Unterscheidung ist jedoch elementar für die Ermessung des Daseinswesens des Selbst, wie auch das des Seins als solchen. Und so verdeutlicht sich gerade auch darüber, daß das Sein doch in seinem Selbst präsent ist und aufgrund des Ursprunges dessen und des gleichzeitig daraus hervortretenden Wahrnehmungswesens, ergibt sich darüber auch das Primäre des Präsenzwesen und nicht im Äußerlichen, wie man es allgemeinhin prägt. Im Selbst des Subjekts ergibt sich sowohl substanziell, wie auch funktional der Schnittpunkt von Subjekt und Objekt und ist somit auch keineswegs rein subjektiv, sondern im Gegenteil, ergibt sich überhaupt erst daraus die Objektivität, die man angeblich anstrebt. Dem gegenüber stellt nämlich das rein Äußerliche(nde) in Betracht ziehend, hingegen nicht als Objektivität, sondern als ein ausgrenzendes Objektivverhältnis, worin gar nicht ersichtlich ist, was das Innere selbst ausmacht. So ist es aber auch das Vereinigungswesen als solches, welches das Prinzip der Ausgewogenheit repräsentiert, nämlich in seinem prinzipiellen Verhältnis gegenüber den Gemeinsamkeiten, Ergänzungen und Widersprüchen, worüber es sich reguliert und darauf beruhend überhaupt die Einheiten präsent sind. Darauf basieren die Einheiten, die man in ihrer präsenten Existenz von Werden, Sein und Vergehen antrifft, hingegen ansonsten nicht sind. Man verbinde dies zu seiner Einheit und man ersieht das Dasein, wie es ist, gemäß seines Wirkens, worüber es sich uns über unsere Wahrnehmung nachvollziehbar darbietet.

Das Prinzip der Waage
↓↑
Gemeinsamkeiten & Ergänzungen ↔ Widersprüche

» Die Abwägung des Herzens «

Weighing_of_the_Heart.jpg

obere Reihe: Hu und Sia, Hathor, Horus, Isis und Nephthys, Nut, Geb, Tefnut, Shu, Atum, Ra-Horakhty

untere Reihe: Tutu, Ani, Renenutet und Meshkenet, Ani's ba, Ani's Herz, Meretseger, Shay, Anubis, Feder von Maat, Thoth, Monster Ammut

Die Ma'at ist das Prinzip und gleichzeitig repräsentierende Göttin. Die Feder ermißt auf der Waage die Ausgewogenheit des Menschen Seelenleben. Und miteinander bildet dies die Grundlage des Verhältnisses des Seins, welche dem Lebensprinzip der Ausgewogenheit gegenüber gestellt wird, sodaß es auch im Angesicht des Todes über das darüber hinaus stattfindende Leben sich bestimmt, inwiefern es sich fortsetzt. In Anbetracht der Evolution ist es genau das, was sich darüber darlegt, worin einzig das sich evolutionär fortsetzt, was dem Sein und dem Sein des Selbst, als solches zuträglich ist, hingegen Lebenswidrigkeiten darin ihrer Verlustigung unterliegen. Aus dieser Gegebenheit heraus stellt sich auch alles andere als ein Umgebendes und Geleitwesen, welches die Verhältnismäßigkeit darin formt und prägt und damit verbunden auch Zeugnis darüber ablegt.

Was die Bezugnahmen zu den althergebrachten kulturellen Gegebenheiten betrifft, so sind diese weitläufig bis zur Gegenwart erhalten. Markanterweise ist sogar das gleiche Verhältnis des Ursprunges zum Samen nach wie noch über unsere gegenwärtige Sprache präsent. Hierin wurde nicht nur die Bezeichnung, sondern auch die Ideologie aus dem lateinischen ursprünglich übernommen (lateinisch: semen, griechisch: σπόροι/spóroi). Man vergleiche hierin den Pflanzensamen und den Samen des Menschen. Darüber verdeutlicht es sich. Hingegen entspricht jedoch, gemäß der neueren Kenntnisse, der Pflanzensamen gar nicht dem Samen des Menschen, denn der Pflanzensamen beinhaltet bereits die Frucht. Die Frucht der Pflanze bezeichnet jedoch das Gemeinsame von Fruchtfleisch und inneliegendem Samen. Dem gegenüber ensteht jedoch aus dem Samen nicht die Frucht, sondern daraus tritt der Keimling hervor, worüber sich der Organismus ausbildet. Über diese Verhältnisse erfährt man somit auch ein konkretes Abbildnis der Ursprünge und dessen Bildnisse aus den aktuellen sprachtechnischen Gegebenheiten heraus. Zwar nennt man mittlerweile den menschlichen Samen differenzierend gemäß des altgriechischen σπέρμα Sperma, jedoch handelt es sich dabei um die Aussaat, gemäß des Samens in seinem Verbund mit der Spermaflüssigkeit. Diesbezüglich gilt es auch zu bedenken, daß Vergrößerungsgläser erst zur Zeit des Aufkommens der Botanik zur Entwicklung gelangten und die Erkenntnisse darüber sich über diese zunächst ausbildeten, jedoch im Sprachschatz die Entwicklung regelrecht stehen geblieben ist. Wie man hierüber wiederum ersehen kann, ist das bestehende sprachtechnische Dilemma äußerst weiträumig und auf vielfältig Weise anzutreffen. Maßgeblich ist hierin, daß diese Hochsprache, sowohl die Allgemein-, wie auch die Fachsprachen gleichermaßen repräsentiert, indess jedoch das jeweils Eine nicht unbedingt das Andere darin deregulierend klärt, sodaß doch vielmehr viele Sprachen über dieses Eine seine Anwendung erfährt und sich dies auch regulär in unersichtlicher Weise vollzieht. So haben sich gerade hierin Fachsprachen gebildet, welche sich gänzlich gegenüber dem Allgemeinwesensgebrauch differenzieren, was jedoch dazu führte, daß die allgemeine Verständigung untereinander darüber gänzlich verloren geht, insofern sich alle derart voneinander sondieren. Man erachte hierzu die Gegebenheiten der interdisziplinären Verhältnisse und deren völligen Unmöglichkeit, in ihrer jeweiligen Spezialisierung der Fachsprache miteinander zu kommunizieren. Markanterweise stellt es sich hierin, wie mit den menschlichen äußeren Sinnen, die jeweils eine andere Wirkung vermitteln (Sprache sprechen), man jedoch über die innere bewußtwerdende Wahrnehmung alle miteinander kombiniert erfährt und doch alle nachvollziehbar verstanden werden, da sie auf dem gemeinsamen Prinzip der Wirkung basieren. Das es sich mit der vom Menschen gebildeten Sprache hingegen anders stellt, liegt in der Natur dessen Wesensart, in welcher die Wirkung selbst nämlich nicht enthalten ist.

Was das Spezfische der alten Prinzipien der geschlechtlichen Inbetrachtziehung betrifft, so hat Allen den sozialen Kern der Unterscheidungen ergründet und wie man dem entnehmen kann, so basiert dies vor allem auf dem, was noch heute zugrundlegendes Thema ist und nicht nur für Frauen, sondern auch für Männer gleichermaßen, von je her die Grundlagen der besonderen Umstände ausmachten, nämlich das Prinzipienwesen des geschlechtlichen Regulariums. Dieses Regularium des sozialen Verhältnisses des Mit- und Zueinanders, basiert auf der Grundlage, dem regulär Animalischen eine geistig fundierte Ideologie entgegen zu setzen und dient darüber hinaus, in seiner elementaren Bewandtnis, dem Erlangen und Aufrechterhalten der funktionalen Einheit des Ganzen, aus dem heraus es sich fundiert, sodaß es darüber der Präsenz des Einzelnen gegenüber gestellt wird. Bei dessen Bezug zur Fortpflanzung geht es dem gemäß auch um das sachliche Erbe und dem gemäß auch des Händelns des rein Körperlichen, um den Erhalt und die Gestaltung dessen als solchen zu wahren und erst daraus resultierend, um das daraus Erwirkende für den Einzelnen, zur Nachfolge und Fortführung dessen. Auch dieses substanziell differenzierte Händling, trifft man sprachtechnisch noch heute in seiner Herkunft der Anwendung an, nämlich über den Begriff der Sinnlichkeit und dessen Synonyme, welche zweierlei Bedeutung haben: zum Einen bezieht es sich auf das Verhältnis des Empfindungs- und Gefühlswesen und zum Anderen auf das der rein geistigen Sinnhaftigkeit. Darin besteht des Wesens Kern der geistigen Hervorhebung und der isolierten rein sachlichen Handhabe dessen, daß darüber selbst keine Empfindungen und Gefühle hervortreten und damit verbunden über diese reinen Versachlichungen, der Fixierung und Monisierung dessen, das instinktive Auftreten der Empfindungen und Gefühle und somit das, was das Animalische ausmacht, außen vor stellt. Gerade darauf beruhen auch die Händlingswesen der Geschlechter, was man bereits bei den Urvölkern antrifft, dem gegenüber die Sinne der Sinnlichkeit eine ganz andere Sprache sprechen, worüber überhaupt erst das eigentliche Einheits- und Abrenzungswesen gegenüber dem formellen Handlungswesen in Erscheinung tritt und sich relativ dieser beiden Verhältnisse die Geschlechter miteinander (ver)binden (das uralte Leid der Liebenden, denen die Sachlichkeiten zuwider läuft!). Sinneswesen und Sachwesen sind funktional voneinander geschieden, über die sich differenzierende funktionale Einheit geistiger Vorstellung und Sprache - dem Sinnenerfüllten gegenüber dem Sinnenenleeren. Es sind zwei völlig grundverschiedene Sprachen, die sich hierin gegenüber stehen, woraus sich auch die Grundlage des Selbst in seinem Gegenüber zum allgemeinen Sachwesen ergibt. Aufgrund dieser Präsenz, ergibt sich daraus nicht nur eine Binarität in der Gegenüberstellung der Geschlechter, sondern gar primär eine Binarität des Selbst zu seinem Selbst und somit auch zum Geschlecht, was sich auch als Ausgangslage des erlangten 20. Jahrhunderts erweist, worin nämlich gegenüber den scheinbaren Fortschritten der Erkenntnisse, dies genau zum Gegenteil führte und seitdem mehr in Frage stellt, als je zuvor. Gerade das Verhältnis von "sex unify", "sex polarity" und "sex complementary" ist darin nämlich zum elementaren Bestandteil der Auseinandersetzung mit dem Selbst geworden.

The Concept of woman

» Volume 2 - Part 1 - The Early Humanist Reformation 1250-1500 (2002) «
» Volume 2 - Part 2 - The Early Humanist Reformation (2002) «
» Volume 3 - The Search for Communion of Person 1500-2015 (2016) «
Verlag: Eerdman's Press (Volume 1 first: Eden Press)
» «


Von Robert Grosseteste bis Bartholomäus von Brügge (1246/1247-1309)
Verlag: Brill

An dieser Stelle sei auf zwei Beispiele einer solchen Rezeption der aristotelisehen philosophischen Texte zur Ehe eingegangen: 1981 veröffentlichte die amerikanische feministische Philosophin Jean Bethke Elshtain ihr Buch "Public man, private Woman. Women in Social and Political Thought". Das Buch übt sozialphilosophisch-feministische Kritik an der dichotomen Unterscheidung zwischen einer dem Mann zugeordneten Sphäre des "Öffentlichen" und einer der Frau zugeordneten Sphäre des "Privaten". Die Autorin setzt sich kritisch mit der Entwicklung dieser geschlechtsgebundenen Unterscheidung in der Philosophiegeschichte auseinander. In diesem Zusammenhang hinterfragt die Philosophin auch die Ausführungen über das Verhältnis von Mann und Frau im ersten Buch der Politik und distanziert sich von ihnen als einer unzulänglichen Vereinnahmung der Sphäre des Öffentlichen durch den Mann.

Als zweites Beispiel von Rezeption der aristotelischen Philosophie der Ehe in einer Arbeit, der eine feministisch-philosophisclre Intention zugrunde liegt, sei hier eine umfangreiche Studie von Prudence Allen aus dem Jahre 1985 genannt. Die amerikanische Philosophin beschreibt in ihrem Buch, das den Titel "The Concept of woman. The Aristotelian Revolution, 750 B.C. - A.D. 1250" trägt, philosophische Konzepte der Frau und der Geschlechterbezichung von den Vorsokratikern bis an die Schwelle des Spätmittelalters. Ihre Absicht ist es, die Geschichte der philosophischen Konzeptualisierung der Frau in ihrer Beziehung zum Mann aufzuarbeiten und so einen Beitrag zu aktuellen philosophischen Diskussionen um die Identität der Frau und um die Beschaffenheit der Geschlechterbeziehung zu leisten. Allens Deutung zufolge lassen sich die gesamten antiken und früh- und hochmittelalterlichen philosophischen Ausführungen zum Thema "Frau" und "Geschlecht" auf drei philosophische Grundpositionen zurückführen, die sie als "sex unify", "sex polarity" und drittens als "sex complmentary" qualifiziert. Die erste Position zeichne sich dadurch aus, dass sie die Existenz eines realen Unterschieds zwischen den Geschlechtern bestreite. Die zweite Position - sex polarity - gehe demgegenüber von einem wesentlichen Unterschied zwischen den Geschlechtern aus, verstehe Mann und Frau als Gegensätze und ordne den ersteren der letzteren hierarchisch über. Die letzte Position schließlich - sex complementary -, mit der Allen deutlich sympathisiert, erkenne zwar die Existenz eines wesentlichen Geschlechtsunterschieds zwischen Mann und Frau an, verstehe aber beide als komplementäre, gleichrangige und gleichwertige Partner. Die Philosophin sieht in Aristoteles den Gründer des Konzepts der sex polarity also einer hierarchisch und antagonistisch verstandenen Geschlechterbeziehung. Bemerkenswert ist auch, wie sie ihrerseits das Fortleben dieses als aristotelisch gedeuteten Geschlechterkonzepts der sex polarity in der Geschichte darstellt. Prudence Allen zufolge ist die Geschichte der Antike und des Früh- und Hochmittelalters eine Geschichte der allmählichen Durchsetzung dieses aristotelischen, hierarchisch-antagonistischen Geschlechterkonzepts - deshalb der Titel Aristotelian Revolution -, deren Höhepunkt in der Institutionalisierung aristotelischer Schriften im Lehrplan der Pariser Universität im Jahre 1255 erreicht wird.

Was die Ergündung der Zeiten vor der Renaissance betrifft, so ist hierin vor allem zwischen drei Verhältnissen zu unterscheiden: zum Einen gibt es überhaupt nur wenige tatsächlich erhaltene Originale. Und davon wiederum sind weitläufig einzig Fragmente erhalten, vor allem der alten Griechen. Zum Anderen beruhten grundsätzlich die Schriften auf Handschriften und davon angefertigte Abschriften, sodaß sich in Frage stellt, inwiefern man hierin überhaupt von einem Original ausgehen kann, worin die Erforschung dessen auch immer weiter fortschreitet, dies (in seiner Relation) zu ermessen, dem gegenüber sich jedoch das nachvollziehende Verständnis umso mehr verliert, umso weiter das Zeitgemäße sich in seinem Verständniswesen voneinander entfernt. Der eigentliche positive Kontrapunkt dessen ist hingegen die Bereicherung, welche sich über diese Maßstabsetzung entwickelte, zumal bei den Verständigen sich die Bildnisse darüber beständig auch erweitern und konkretisieren und damit verbunden auch Eigengebilde hervorbringen, welche weit über den Ursprung hinausreichen. Entsprechend bestehen die Präsenzen jedoch grundsätzlich nicht auf reinen Wiedergaben oder Bezugnahmen zu Aufgebrachtem, sondern generell auf Interpretationen, in Verbindung mit sprachtechnisch interpretierten Übersetzungen, sodaß es sich regulär um reine Zuschreibungen handelt. Nicht erst seit dem Mittelalter fand das Händling der Aufbereitungen statt, sondern dies ist durchgängig anzutreffen, bereits aus seinem Ursprung heraus und vermischt damit verbunden auch weitläufig alles miteinander. So ist es denn auch wesentlich, gerade die jeweilige Relativität darin zu ersehen. Diesbezüglich gilt es jedoch auch grundsätzlich zu bedenken, daß kein Text den Originaltext wiedergibt, insofern der Wortlaut nicht der Gleiche ist, was mit der Spezifikation der Sprache zusammenhängt, in welchem jedes Wort und jede formulierte Aussage, seine ganz eigenes Bildnis, wie auch dessen kulturellen Verbundes repräsentiert. So ist auch das kulturell ideologische Sinnverhältnis darin maßgeblich, worüber überhaupt dies seine Inhaltlichkeit erfüllt. Stellt man somit verfügbare Originale den aufgebrachten Bildnissen dessen gegenüber, wird man feststellen, daß kein Bildnis dem Original entspricht, außer wenn es den original Wortlaut wieder gibt. Damit verbunden gilt auch hierin das Prinzip, daß die Kultur und somit auch deren Wiedergaben, ein Verbund mit dem jeweiligen Dasein sind, sodaß das Jeweilige auch einzig sich vermittelt und vermittelbar ist, gemäß dem Bezugsverhältnis zur kulturellen Gegebenheit. So ist gemäß dem auch die Kultur des Ursprunges, das des Wiedergebenden und das der Gegenwart im Nebeneinander in Betracht zu ziehen, um das Relativum darin gemäß dem zu realisieren. Bezüglich meiner Ausführungen gilt es mir somit auch hervorzuheben, daß insofern das Original und ein Verweis dazu nicht einbezogen ist, sich auch meine Bezugnahme als Relativa stellt, zumal es sich im Besonderen, z.B. im Bezug auf Aristoteles, auch als solches stellt, denn maßgeblich sind mir die Erkenntnisse und gerade in dessen Bezug hat sich aus dessen Grundlage heraus ein wahres Kompendium darüber hinaus entwickelt, worin wohl kaum jemand überhaupt besagen kann, inwiefern dies tatsächlich seinen Prinzipien entsprach, wobei dieser sich nämlich in seinen Ausführung gar selbst wiedersprach. Zumal ist mein spezielles Aufbringen einzig fragmentarisch, wenn überhaupt woanders anzutreffen und als bereichende Fragmente binde ich sie auch entsprechend ein, sodaß sich darüber das zugrundeliegende Kompendium entfaltet.

Sammlung_Tusculum.jpg
Sammlung Tusculum

Frauenmedizin.jpg
Frauenmedizin in der Antike

» Sammlung Tusculum «
» Bibliographie der Ausgaben «
» Wikipedia-Liste der Werke «

Seit 1923 erscheinen in der Sammlung Tusculum maßgebende Editionen griechischer und lateinischer Werke mit deutscher Übersetzung. Die Originaltexte werden zudem eingeleitet und umfassend kommentiert; nach der neuen Konzeption bieten schließlich thematische Essays tiefere Einblicke in das Werk, seinen historischen Kontext und sein Nachleben. Die hohe wissenschaftliche Qualität der Ausgaben, gepaart mit dem leserfreundlichen Sprachstil der Einführungs- und Kommentarteile, macht jeden Tusculum-Band zu einer fundamentalen Lektüre nicht nur für Studierende, die sich zum ersten Mal einem antiken Autor nähern, und für Wissenschaftler, die spezifische Aspekte eines Werkes vertiefen möchten, sondern für alle, die sich durch vertrauenswürdige Übersetzungen einen Zugang zur Antiken Welt verschaffen wollen.

Divider


Griechisch-lateinisch-deutsch
Reihe: Sammlung Tusculum
Verlag: De Gruyter (Artemis & Winkler)
und

Medizin und Gesellschaft

Die Entwicklung der wissenschaftlichen Medizin
Celsus, De medicina - Über die Medizin

Die Ordnung der Geschlechter
Xenophon, Oikonomikos - Von der Hauswirtschaft
Platon, Leges - Gesetze
Aristoteles, Politica - Politik
Tacitus, Annales - Annalen
Soranos, Gynaecia - Frauenheilkunde

Geburtenkontrolle und Abtreibung
Corpus Hippocraticum, De natura muliebri - Über die Natur der Frau
Corpus Hippocraticum, De carnibus - Über das Fleisch
Platon, De re publica - Staat
Aristoteles, Politica - Politik
Hippokrates, lus iurandum - Eid
Celsus, De medicina - Über die Medizin
Plinius, Naturalis historia - Naturgeschichte
Soranos, Gynaecia - Frauenheilkunde
Digesta - Digesten

Die Theorie: das Bild des weiblichen Körpers in der Medizin

Die Anatomie der weiblichen Geschlechtsorgane
Corpus Hippocraticum, De victu - Über die Diät
Soranos, Gynaecia - Frauenheilkunde
Galenos, De semine - Über den Samen
Galenos, De uteri dissectione - Über die Anatomie der Gebärmutter
Galenos, De usu partium - Über den Nutzen der Körperteile

Befruchtung und Empfängnis
Parmenides
Corpus Hippocraticum, De aeribus - Über die Umwelt
Corpus Hippocraticum, De morbis - Über die Krankheiten
Corpus Hippocraticum, De genitura - Über den Samen
Corpus Hippocraticum, De natura pueri - Über die Natur des Kindes
Corpus Hippocraticum, De victu - Über die Diät
Corpus Hippocraticum, De superfetatione - Über die Überbefruchtung
Corpus Hippocraticum, De muliebribus - Über die Frauenkrankheiten
Aristoteles, De generatione animalium - Über die Zeugung der Tiere
Soranos, Gynaecia - Frauenheilkunde
Galenos, De semine - Über den Samen
Galenos, De usu partium - Über den Nutzen der Körperteile

Menstruation, Geschlechtsreife und Pubertät
Corpus Hippocraticum, De natura pueri - Über die Natur des Kindes
Corpus Hippocraticum, De muliebribus - Über die Frauenkrankheiten
Aristoteles, De generatione animalum - Über die Zeugung der Tiere
Aristoteles, Historia animalium - Geschichte der Tiere
Celsus, De medicina - Über die Medizin
Soranos, Gynaecia - Frauenheilkunde
Galenos, De simplicium medicamentorum temperamentis et facultatibus
- Über die Mischung und Wirkung von nicht zusammengesetzten Heilmitteln

Das Werk, welches die sprach- und sachtechnischen Grundlagen hingegen aus seinem lateinischen Ursprung heraus in einem weitreichendem Umfang wiederspiegelt, ist markanterweise das Einzige, welches es in dieser Art gibt, nämlich die Enzyklopädie des Isidor von Sevilla. Zumal es sowohl für das Verständnis der Dinge, sowie auch für dessen Abbildung über die Sprache die Grundlage bildet, für den Nachvollzug und die Darlegung des Einheitswesens des Seins. Wendet man diesen Maßstab auf die deutsche Sprache an, wird man erkennen, warum ein solches darin nicht anzutreffen ist, nämlich aufgrund seiner gravierenden widersprüchlichen Inklusionen. Somit stellt sich auch eine Übersetzung Isidor's Enzykopädie als unmöglich, da hierin dieses Ordnungswesen nicht derart ausgebildet wurde, hingegen selbst aus den entstandenen sachlich organisierten Enzyklopädien alphabetisierte Lexikas wurden. Dem gemäß entwickelte sich auch unser mißliches Sprachverhältnis. Nicht nur daß hierin das Links bei L und das Rechts bei R steht, sondern alles miteinander seine gänzliche Abtrennung voneinander erfährt und gar nicht der Zusammenhang des Verständnisses die Grundlage bildet, sondern das Jeweilige ein in sich stehendes isoliertes quantitatives Wissen. Hierin trifft man zwar fragmentarisch, vor allem im Begrifflichen, die Grundlagen weiträumig an, sind jedoch auch mit dem behaftet, wie man es unter anderem bezüglich der Sexualität antrifft. Dies basiert auf dem Abwendungs- und vor allem Umkehrverhältnis der Wissenschaft gegenüber dem Einheitswesen der Philosophie, indem in dieser sich das Sein aus dem Einzelnen (der Atome) zusammensetzt, das Jeweilige (angeblich) die Eigenschaften beinhaltet und daraus sich (angeblich) die Einheit des Ganzen ergibt, sodaß man es dem gemäß auch derart vermischt in der Sprache antrifft. Verständnis und Wissen trennen sich somit hierin auch substanziell, aufgrund dieser Differenzierung.

Gerade darüber findet jedoch der Kern der Wesensart der Binarität (binär: 1-0) seine Umsetzung, welche nicht erst im 20. Jahrhundert sich durch das daraus entstehende ausbreitende Vakuum vermittelt. Es stellt sich generell gemäß des elektrischen Stromkreises, worin zwar einzig in der zuführenden Leitung Strom fließt, jedoch dieser einzig fließt, wenn der Stromkreis geschlossen wird, und man ganz einfach die Inbetrachtziehung und Erklärung ausläßt, was denn eigentlich im Rückfluß fließt, wo darin doch kein Strom fließt. Das der Computer indess die Null als Zahl interpretiert, hingegen kein Nichts und somit auch keine Null existiert, klärt unter anderem darüber auf, daß die Binarität darin noch eine ganz andere ist, indem nämlich darin sowohl die Eins, wie auch die Null sich als binär stellt, da die Null hierin einen Wert aufweist. Somit erweist es sich auch nicht als verwunderlich, daß einst die Atomwissenschaftler zu dem Resultat gelangten, daß das Atom, welches sie als Grundstock des Seins erachteten, gar nicht als solches existiert. Und so ist es denn auch nicht verwunderlich, daß der Mensch mittlerweile mit einem Unbewußtsein lebt, welches dieser gar für selbstverständlich erachtet und gemäß dem bezeichnenderweise pflegt, ohne sich darüber bewußt zu werden, daß doch darin sein Kernwesen des Selbst verborgen ist, dessen es der zentralen Erachtung bedingt, um seine eigentliche Menschlichkeit zu erfahren. So ist gerade auch Isidor's Händling in der Art von Markantz, daß dieser die Dinge nicht einfach nur darstellt, sondern sie gar spezifisch, gemäß ihrer konstruktionellen funktionalen Präsenz in Frage stellt, inwiefern sie so sind, wie man es besagt. Die geistige Vorstellung und die Sprache sind nicht das Sein, sondern einzig interpretierend verweisende Bildnisse. Wer dies nicht grundsätzlich in Frage stellt, nimmt somit auch nicht die Wirklichkeit wahr, denn es sind die Wirkungen (Wirkungen ↔ Wirklichkeit), worüber sich das Sein uns darbietet, worin die Bildnisse eben auch nur darauf verweisen, insofern man dem gemäß es auch als Hinweis erachtet. Und so ist gerade auch das Unbewußtsein ein klares Zeichen darauf, was dessen Wirkwesen als solches ausmacht. Darin besteht die Handhabe meiner Inbetrachtziehung, gemäß dem es sich gerade in unserem inneren Sein, über seine Auswirkungen, den damit verbundenen hervorbringenden Wirkwesen und somit auch die damit einher gehende Funktionalität sich aufweist, wie es sich darin nicht anderes verhält, wie in der Generalität des Seins. Die Unterscheidung, welche man darin begründete, basiert einzig darauf, inwiefern man die Dinge aus dem Inneren oder Äußeren heraus in Betracht zieht, hingegen erblickt man nach wie vor, einzig aus dem Inneren heraus beide Warten der Sichtung, welche sich auch einzig darin miteinander vereinen. Das Wirken ist die Sprache der Natur, sowie auch die Natur der Sprache und einzig darüber erblickt man die Natur des Seins, gemäß dem ihre Präsenz auch einzig ersichtlich ist, dem gegenüber die Bildnisse dazu dienen, darüber aufzuklären, was als solches daraus nicht ersichtlich ist.

» Isidor von Sevilla «

» Isidori Hispalensis episcopi etymologiarum sive originum libri XX «
» Book XI «
Latin text by W. M. Lindsay
published by Oxford University Press, 1911


Verlag: Weidmann

» Die Enzyklopädie des Isidor von Sevilla (2008) «
Marix Verlag
» Lenelotte Möller «
» Rezension von Cardellede Hartmann «


Truth from Words
Verlag: Cambridge University Press


Verlag: De Gruyter


Nach der Pariser Handschrift und den Monseer Fragmenten
Verlag: De Gruyter
» «


Quellen und Forschungen zur Sprach- und Kulturgeschichte der Germanischen Völker
» Bd. 1. Textkritische Ausgabe der ersten Fassung Buch I - X (1974) «
Bd. 2. Textkritische Ausgabe der zweiten Fassung Buch I - VI (1982)
sowie des Buches XI in Kurz- und Langfassung

» Bd. 3. Wortschatz. Register der deutschen Glossen und ihrer lateinischen Bezugswörter (1995) «
Verlag: Walter de Gruyter

Vollständiges lateinisch-althochdeutsches Wörterbuch
zur althochdeutschen Isidor-Übersetzung
()

Institut für deutsche Sprache und Literatur (DAWB)
» «

Lateinisches und Romanisches aus den Etymologiae des Isidorus von Sevilla ()
(Forschungen zur griechischen und lateinischen Grammatik 9)
Untersuchungen zur lateinischen und romanischen Wortkunde
Lexikalische Untersuchungen zu den Etymologiae des Isidorus von Sevilla

Divider

Isidor von Sevilla ()
Sein Leben, sein Werk und seine Zeit
Verlag: J. P. Bachem
Original: Justo Pérez de Urbel: San Isidoro de Sevilla. Su vida, su obra y su tiempo (1945)
deutsche Übersetzung von

Die historisch-geographischen Quellen in den etymologiae des Isidorus von Sevilla

» Band 2 - Textausgabe und Quellenangabe (1913) «
Verlag: Weidmann

» Isidor-Studien () «
Verlag: Beck

» Die Lagerung und Verbreitung der Handschriften des Isidorus von Sevilla () «
Verlag: Beck


Das Bild der Geschichte in der Enzyklopädie Isidors von Sevilla (S. 1-62)
Verlag: Böhlau

Divider

Summarium Heinrici



Verlag: Walther de Gruyter


Werkentstehung, Textüberlieferung, Edition
Max Niemeyer Verlag

Nachfolgend parallel dazu ein Muster aus den Verhältnissen unseres hiesigen Mittelalters und man achte hierin auf den Ursprung, Verlauf und Inhalt. Wie man dem entnehmen kann, so vermischten sich hierin die Übernahmen aus dem Lateinischen und Griechischen, welche inhaltlich unerreichbar weit entfernt waren, mit den Kenntnissen und der Sprache eigener Herkunft, wie es jedoch auch zumeist üblich ist. Kern der Angelegenheit ist vor allem, daß dem gegenüber bei den alten Griechen, zu deren Zeit des Entwicklungswesens, die geistige Betätigung eine besondere Stellung einnahm, auf dem Grundwesen der Anwendung von Formwesen und Schrift, was anwendungstechnisch auch von den Römern übernommen wurde und gerade darin das Schriftwesen noch eine Weiterentwicklung der Form erfuhr. Dem gegenüber war jedoch nicht nur in unserem Lande, sondern zu jener Zeit des Mittelalters generell in unseren Breitengraden, das Handlungswesen rein auf den praktischen Nutzen des regulären Umgangswesens ausgerichtet und so existierte auch zunächst weder ein Schriftwesen, noch die Gelegenheiten, welche überhaupt derartige Beschäftigungen darboten. Anwender des Schriftwesens waren zunächst die christlichen Vereinigungen, derer es aufgrund deren Ausbreitung einer einheitlichen Sprache bedingte, vor allem jedoch auch zur Grundlagenschaffung für die Worte der in hebräisch verfaßten heiligen Schriften. Dem gegenüber wird indess das aufkommende Verwaltungsschriftentum des Territorialwesens der Ausbilder der deutschen Schriftsprache und dessen Umgangswesen, worüber sich im Verlaufe beides auch miteinander vereinte. Gleichzeitig vermischten sich jedoch hierüber aber auch die darin vorherrschenden Kenntnisse, Vorstellungen und Ideologien miteinander. Gerade in der Gegenüberstellung zu Isidors Aufbringen verdeutlicht sich, daß man sich hierin zu jener Zeit gar auf gravierende Weise zwischen den Welten befindet. Über das aufkommende Kirchen- und Territorialstaatswesen begründet indess die Schrift das Vorgabewesen, worin nicht das gesprochene Wort, sondern die Schrift das Sein beschreibt und darüber vorgibt zu sein. Es entwickelt sich darin nicht zu einem Zusätzlichen der gesprochenen Sprache und auch nicht als ein Gegenüberstellendes, sondern es wird darüber das Zugrundeliegende definiert, gemäß dem sie gemäß den Vorbildern übernommen und ausgebildet wird. Die verbalsprachliche Integration dient indess einzig zur Ausfüllung als Lehnwörter und nicht als Erbwörter, wie man es allgemein in Betracht zieht, deren Inhalt nämlich darin bereits aufgrund der Form der Sprache, ein anderer wird, wie man sich über die Sprache selbst, wie auch über die diversen Abstammungen entsprechend vor Augen führen kann. So bildet hierin auch nicht das Sein die Grundlage darin, sondern wie es sein soll, gemäß der Prinzipialitäten der Formwesen der Ideologie, die es darüber zu erlangen und auszugestalten gilt. Gemäß dem erwirken sich auch im Mittelalter entsprechende Wesensarten, zu denen man zu Recht vor allem mit Sarkasmus darauf schaut, denn das ist, was sich darüber darbietet, wenn man beides gegeneinander gegenüber stellt, daß von der jeweiligen Seite heraus, es sich als Sinn und Unsinn gegenüber stehend erweist, da es nämlich nicht den gleichen Sinn enthält. Diese Sprache funktioniert eben nicht nur relativ, gemäß dem, was man darüber aufbringt, sondern vor allem auch gemäß dem, wer darüber das Was aufbringt, denn in ihrer Anwendung repräsentiert sie die Verbundenheit mit dem Sein - des Aufbringenden Sein.

Konrad von Megenberg: Das Buch der Natur, Von den tiern
Universitätsbibliothek Heidelberg
Werkstatt Diebold Lauber
» D-Initiale mit Liebespaar «

» Buch der Natur (ca. 1350) «
Übersetzung von
» Conradus von Megenberg «
der Urschrift
» Liber de natura rerum (ca. 1230) «
» Thomas von Cantimpré «

Das Buch der Natur ist in 8 große Teilbereiche gegliedert, die in den Ausgaben der Prologfassung durch Pro- und Epilog gerahmt werden. Die Kapitel im Buch der Natur sind - mit Ausnahme der I., II. und VIII. Teilbücher - alphabetisch nach den lateinischen Begriffen der Themen geordnet. Diese Ordnung geht nicht über den ersten Buchstaben der Begriffe hinaus. Buch I umfasst Glieder und Organe des Menschen, die in der Reihenfolge von Kopf bis Fuß abgehandelt werden. In Buch II werden zunächst die himeln, dann die siben planeten und letztendlich die Elemente beschrieben. Die Planeten und Elemente sind nach den Himmelssphären (Kosmologie des Mittelalters) in absteigender Reihenfolge geordnet. Das Kapitel III A0 enthält eine Erklärung hinsichtlich der Ordnung der Tiere nach ihren Habitaten. Das VIII. Buch weist keine erkennbare Ordnung auf.

Buch I

I.0 Von dem menſchen in ſeiner gemainen natur. I.1 Von der hirnſchal. I.2 Von dem hirn. I.3 Von dem har. I.4 Von dem ſlaf. I.5 Von den augen. I.6 Von den augenbran. I.7 Von den oren. I.8 Von der naſen. I.9 Von dem part. I.10 Von dem mund. I.11 Von den czenden. I.12 Von der czungen. I.13 Von der ſtimme. I.14 Von dem aichleinn. I.15 Von dem uberual. I.16 Von der ſluntrorn. I.17 Von der luftrörn. I.18 Von der keln. I.19 Von dem hals. I.20 Von den achſſeln. I.21 Von den armen. I.22 Von den mäuſlein. I.23 Von den henden. I.24 Von den vingern. I.25 Von den negeln. I.26 Von den pain. I.27 Von dem margk. I.28 Von dem flaiſch. I.29 Von der haut. I.30 Von dem ruck. I.31 Von der pruſt. I.32 Von den pruſtlein. I.33 Von dem herczen. I.34 Von der lebern. I.35 Von der gallen. I.36 Von der lungen. I.37 Von dem miltz. I.38 Von dem pauch. I.39 Von dem magen. I.40 Von dem nabel. I.41 Von der plaſen. I.42 Von den nyeren. I.43 Von den adern. I.44 Von den pant adern. I.45 Von den czaichen, ob ein fraw ſwanger ſey. I.46 Von welhen ſachen ein fraw ſwanger werd eins knaͤbleins. I.47 Von den czaichen, ob ein fraw ein knaͤblein trag. I.48 Wie dye gepurd an dy werlt kom. I.49.1 Von den czaichen der naturlichen ſyten vnd dez erſten von dem har. I.49.2 Von der varb. I.49.3 Von den augen. I.49.4 Von der uberpra. I.49.5 Von den naſlochern. I.49.6 Von der ſtirn. I.49.7 Von dem mund. I.49.8 Von dez menſchen antlucz. I.49.9 Von den oren. I.49.10 Von der ſtymme. I.49.11 Von dem flaiſch. I.49.12 Von dem lachen. I.49.13 Von der wegung. I.49.14 Von dem hals. I.49.15 Von der pruſt. I.49.16 Von den rippen. I.49.17 Von den achſeln. I.49.18 Von den armen. I.49.19 Von den henden. I.49.20 Von den fueſſen. I.49.21 Von den ſchrieten. I.49.22 Welher kün ſey. I.49.23 Welher vorchtig ſey. I.49.24 Welher gutz ſyns ſey. I.49.25 Wer einen wolgeſtallten leib hat. I.49.26 Wer dy weiſhait lieb hat. I.49.27 Wer ſtumpfs ſynns ſey. I.49.28 Wer vnſchamig ſey. I.49.29 Wer czornig ſey. I.49.30 Von ainem vnkewſchen mann. I.49.31 Der ein weibiſchen mut hat. I.49.32 Von den poſen mannen. I.50 Von den trawmen.

Buch VIII

1 Von den wunderlichen prunnen. VIII.2 Von den wunder menſchen. VIII.3 Von den wunderleichen læuten.

Divider


von Conrad von Megenberg
Die erste Naturgeschichte in deutscher Sprache
In Neuhochdeutscher Sprache (neu gefaßt - )
Verlag: Julius Abel

46. Von den Ursachen der Empfängniss eines männlichen Kindes

Will man wissen, wodurch eine Frau ein männliches Kind empfängt und woraus ersichtlich ist, ob sie einen Knaben gebären wird, so ist zunächst zu bemerken, dass in den Fällen, wo das Sperma virile heiss und reichlich vorhanden ist, dieses die Oberhand besitzt, so dass durch die Cohabitatiou ein Knabe erzeugt wird. Eine weitere Ursache hierfür ist gegeben, wenn das Sperma grösstenteils aus dem rechten Testikel herrührt und in die rechte Seite des Uterus gelangt. Die rechte Seite ist nämlich wärmer wie die linke, und das Sperma aus dem rechten Testikel kräftiger wie das aus dem linken. Desshalb ist mein Rath, dass die Frau, wann sie eines Knaben genesen will, sich gleich nach der Cohabitation auf die rechte Seite legen soll. Einige geben auch an, dass, wenn das Sperma des Mannes aus dem rechten Testikel in die rechte Seite den Uterus gelange, ein Knabe gezeugt werde, wie ich vorher schon sagte, gerathe aber das Sperma aus dem linken Testikel in die rechte Seite des Uterus, so entstehe ein Mannweib. Kommt das Sperma aus dem rechten Testikel in die linke Seite, so entwickelt sich ein weibischer Mann. Wenn aber das Sperma aus dem linken Testikel in die linke Seite des Uterus geräth, so soll daraus ein Mädchen werden. Zur Erzeugung eines Knaben hilft ferner die Kälte der Luft, sowie das kältere Klima überhaupt, und der Wind, der vom Sternbild des Wagens nach Süden weht und lateinisch Aquilo heisst. Die Kälte treibt nämlich die natürliche Wärme in den Leib hinein und vermehrt dadurch die innere Wärme. Zur Entstehung eines Knaben ist grössere Wärme nöthig, wie zu der eines Mädchens.

49. Von den Kennzeichen des Charakters
ff - Wer einen weibischen Sinn hat

Ein weibisch gesinnter Mann ist ungeduldig, gegen Schmerz empfindlich, leicht verführt und ebenso leicht bekehrt, ebenso rasch erzürnt wie versöhnt. Bei allen Thieren sind nemlich zumeist die weiblichen Individuen äusseren Eindrücken leicht zugänglich. Sie sind auch listiger wie die Männchen, leichter zum Handeln bereit oder vorschnell und schamloser. So spricht Rhaazes. Die Frauen haben auch einen kleineren Kopf, schlankeren Hals und zierlichere Gesichtsbildung. Die Brust ist eng, die Schultern sind schmal, die untere Parthie der Brust und die Wölbung derselben ist weniger entwickelt wie beim Manne. Dagegen sind die Hüften und das Gesäss breit angelegt. Die Beine sind klein, Hände und Füsse zierlicher gebaut. Bei allen Thieren sind die Weibchen furchtsamer wie die Männchen.

49 gg. Von den Castraten

Ein Castrat oder Kappaun, das heisst ein Mann, der der Zeugungstheile entbehrt, ist böse veranlagt, denn er ist thöricht, habgierig und unüberlegt, und unternimmt in Folge dessen mehr, als er zu leisten im Stande ist. Wer aber nicht absichtlich castrirt sondern als Solcher geboren ist, oder dessen Genitalien ungenügend entwickelt sind, ist einem Kappaun zu vergleichen, auch wächst ihm niemals ein Bart. Solche Leute sind die bösesten unter Ihresgleichen.

Von den wunderbaren Menschen

Die Wundermenschen mit körperlichen Gebrechen besitzen entweder ihre Glieder nicht völlig oder in grösserer Zahl, als sie haben sollen. Der Ursachen hierfür giebt es mancherlei. Ein Hauptgrund ist der, dass die Frauen sich während der Cohabitation nicht richtig benehmen und hin und her bewegen, so dass sich der männliche Samen im Uterus theilt. Theilt er sich gleichmässig in der unteren und oberen Hälfte des Uterus, so entstehen Zwillinge, die dann zunehmen, wie sich Zwillinge zu entwickeln pflegen. Geschieht die Theilung des Samens nur oben und unten nicht, so entsteht ein Mensch mit zwei Köpfen und einem Unterkörper, der sich dann auch weiter entwickeln kann. Vollzieht sich die Theilung des Samens unten und nicht oben, so wird eine am Unterkörper gedoppelte Missgeburt daraus.

Es kommt auch vor, dass der Samen in reichlicher Menge vorhanden und besonders kräftig ist. Dieser lässt dann einen, über das gewohnte Maass grossen, Menschen entstehen. Ist dagegen bei geringer Quantität die Kraft des Samens vorwiegend, so fehlen der Frucht einige Glieder, zum Beispiel die Arme oder einige Finger oder die Füsse und Beine. Dasselbe ereignet sich auch dann, wenn die Quantität des Samens zwar zureicht, seine Qualität dagegen zu wünschen lässt. Aus wenigem und schwachem Samen entsteht ein Zwerg. Ist der Samen quantitativ grade genügend, seine Kraft aber zu stark entwickelt, so macht sie das Glied, für welches sie grade besonders in Betracht kommt, ausnahmsweise gross oder bringt es in grösserer Zahl hervor. Desshalb hat ein Neugeborenes oftmals einen grossen und einen kleinen Fuss oder einen grossen Kopf und einen kleinen Körper oder sechs Finger an jeder Hand beziehentlich sechs Zehen an jedem Fuss oder auch nur an dem einen und am anderen nicht. So hat man denn auch ein Kind gesehen, das elf Mundöffnungen und zwei und zwanzig Lippen hatte, allerdings unvollkommen entwickelt, wie denn auch das Kind todt geboren wurde.

Es ereignet sich auch, dass zwei wirksame Kräfte gleich stark sind. Die eine derselben wirkt nach der männlichen, die andere nach der weiblichen Richtung, und die Folge ist ein Geschöpf, das männlich und weiblich gleichmässig entwickelt und auch befähigt ist, sich nach beiden Seiten hin gleichmässig zu bethätigen. Leute mit beiderlei Genitalien heissen lateinisch Hermaphroditae. Ist die Vertheilung der in Frage kommenden Kräfte dagegen ungleich, so entwickelt sich das eine Genitale vollkommen, das andere dagegen nicht.

Wir finden auch, dass die Frucht im Mutterleibe sich nach dem Gedankengange der Mutter entwickeln kann. Deshalb sollen Schwangere keine unschönen Gegenstände betrachten, sondern schöne Menschen und schöne Bildwerke. Dies gilt besonders für die erste Zeit der Schwangerschaft, wenn die Natur die Frucht erst noch bildet und dieselbe noch nicht entwickelt ist.

Divider

» Enzyklothek «
Literaturhinweise


Untersuchungen zu seiner Text- und Überlieferungsgeschichte
Verlag: De Gruyter


von Konrad von Megenberg
Die erste Naturgeschichte in deutscher Sprache
Verlag von Karl


Das Wissen seiner Zeit
Verlag: C. H. Beck
Hrsg.: Claudia Märtl, Gisela Drossbach, Martin Kintzinger


Sachkunde und Dinginterpretation bei
Jacob van Maerlant und Konrad von Megenberg

Max Niemeyer Verlag


Die illustrierten Handschriften und Inukabeln
Böhlau Verlag

Divider

Thomas Cantimpratensis ()
Liber de Natura Rerum
Editio princeps secundum codices manuscriptos I

Verlag: de Gruyter
» «


Liber de naturis rerum - Redaktion III (Thomas III)
Reihe: Wissensliteratur im Mittelalter - Band: 54.1
Reichert Verlag
Hrsg.:

» Thomas Cantimpratensis «
Liber de natura rerum - version: Thomas III
Edition von Vollman-Hünemörder (1993)

Divider

» Der "Experimentator" (1998) «
eine anonyme lateinische Naturenzyklopädie
des frühen 13. Jahrhunderts
Dissertation von Janine Deus

Den Anlaß zum Thema der Dissertation gaben die Zitate im "Liber de natura rerum" des Dominikaners Thomas von Cantimpré (ca.1201-ca.1270), die Thomas einem anonym überlieferten Werk entnahm und die er einem sogenannten "Experimentator" zuschrieb. Christian Hünemörder entdeckte 1968 in Stuttgart bei seinen Forschungen zu Thomas eine Handschrift, in der sich die dem "Experimentator" zugeschriebenen Zitate teilweise wiederfanden. Weitere Nachforschungen förderten weitere Handschriften zutage (Sloane, Chambéry, sowie eine Kurzfassung desselben Werkes). Heinz Meyer entdeckte bei seinen Forschungen über das Werk "De proprietatibus rerum" des Franziskaners Bartholomaeus Anglicus, mit dem das Werk des "Experimentators" grundlegende Gemeinsamkeiten aufweist wie den fast identischen Prolog, den Werkaufbau und das verwendete Material, weitere Handschriften des "Experimentators". Aufgrund der Beziehungen des "Experimentators" zum Werk des Bartholomaeus Anglicus wird der anonym überlieferte "Experimentator" ebenfalls unter dem Namen des Bartholomaeus Anglicus und unter dem Titel "De proprietatibus rerum" in den Handschriftenverzeichnissen aufgeführt. Da der tatsächliche Zusammenhang beider Werke in weiten Teilen noch ungeklärt ist, wird hier der bislang zugeschriebene Titel "De proprietatibus rerum" nicht beibehalten.

Autoren der im Werk benutzten Quellen genannt: Isidorus von Sevilla (ca. 570-636), u.a. "Etymologiarum sive originum libri XX", Gregorius der Große (ca.540-604), u.a. "Moralia in Iob", Beda Venerabilis (672/73-735), u.a. "De natura rerum", Pseudo-Dionysius Areopagita (um 500), u.a. "Celestis Hierarchia", Basilius der Große (um 330-379), "Hexaemeron", Ambrosius von Mailand (um 340-397), u.a. "Hexaemeron"; für Buch XII fälschlicherweise Plato (anstelle von Johannes Platearius [Ende des 11.Jahrhunderts] und Mattheus Platearius [gest.1161] "Circa instans"); für Buch VI Aristoteles (384-322), u.a. "De celo", "Meteorologica", Pseudo-Aristoteles u.a. "De mundo", "De proprietatibus elementorum", Macrobius (um 400), u.a. "Commentarius in somnium Scipionis", Martianus Capella (Anfang des 5. Jahrhunderts n.Chr.) "De nuptiis Philologiae et Mercurii", Alphraganus = al-Fargani (gest. 816) "Rudimenta astronomica", "Differentie scientie astrorum", Ptolemaeus (2. Jahrhundert n.Chr.), u.a. "Almagestum"; für die Inhalte bezüglich der Komplexionenlehre (nach der das Überwiegen eines Saftes im menschlichen Körper, also Blut, Schleim, gelbe oder schwarze Galle, Aussehen, Charakter und Krankheitsdispositionen eines Menschen bestimmt) Aristoteles (384-322), "De animalibus libri XIX" und Constantinus Africanus (gest.1087), u.a. "Pantegni", "Viaticum", "De gradibus".

Als erstes wird eine Begründung für die Reihenfolge der im Werk zu behandelnden Themen gegeben: Die Darstellung folgt der Ordnung der Substanzen, da die Eigenschaften der Dinge dieser folgen. Als nächstes wird der Zweck des Werkes genannt: Es ist nützlich, um die Rätsel der Heiligen Schrift zu verstehen und das Haus Gottes zu errichten. In dem Werk sollen zuerst einige natürliche Eigenschaften, dann die künstlichen behandelt werden. Begonnen wird mit den unkörperlichen Substanzen, dann folgen die körperlichen. Es folgt die Übersicht über den Inhalt der einzelnen Bücher, wobei auffällt, daß entgegen der Ankündigung die künstlichen Dinge nicht behandelt werden.

Divider


im Spiegel der lateinischen Historiographie
des 12. und 13. Jahrhunderts

Verlag: Peter Lang
Hrsg: Peter Stotz

Das die Form die Wesensart des Seins bestimmt, galt als elementare Grundlage bei den alten Griechen. Hingegen zeigt sich gerade über unsere deutsche Schriftsprache, daß hierin zwar die Form regelrecht mathematisch über die Grammatik umgesetzt wurde, indess jedoch der Inhalt ein einziges Gemische darstellt, gemäß dem es sich über das Thema der Sexualität unübersehbar verdeutlicht. Gerade darauf beruht jedoch auch der Gegensatz der alten griechischen Philosophie, gegenüber der neuen aufkommenden Wissenschaften. Während Ersteren die Universalien das Bestimmende sind, ist es hingegen dem Neuen der Inhalt (Atome), welcher die Form bestimmt, aufgrund dessen man hierin auch auf dieses Gemische stößt und keineswegs nur darauf beruht, daß man aus diversen Sprachen Lehnwörter und Ableitungen integriert. Wie man gleichfalls einst erkannte, bildet sich nämlich das Grundlagenwesen des Seins spezifisch über die Sprache ab, warum dessen Ausbildung auch eine spezifische Achtung erfuhr. So ist nämlich ein Apfel nur ein solcher, insofern das Jeweilige ein solcher ist, was sich somit auch speziell über den dies repräsentierenden Begriff darlegt. Gemäß dem der fortlaufende Vorgang hingegen in der Wahrnehmung ein anderes Bildnis erscheinen läßt, worin diese Konstanz als solche nicht ersichtlicht ist, ergibt sich dies nämlich erst über die Konstanz der begrifflichen Bildnisse. So wandelt sich zwar der Apfel, gemäß Werden, Sein und Vergehen, doch ist die Funktionalität, worauf die Präsenz beruht hingegen nicht diesem eigen, was sich darüber darlegt. Während genau dies sich über die Begriffe abbildet und darüber zur Ersichtung gelangt, ist dies indess über die Vorstellung alleine derart nicht gegeben. Somit ergibt sich auch darüber überhaupt erst die Klarheit über das substanzielle Wirkungs- und Präsenzwesen des Seins, worin sich über das Kombinat von Wirken und Funktionalität, das jeweilige Präzenzwesen der erfahrenden Einheiten ergibt.

Funktionalität → Wirkungseinheit (das Hervorbringende) ← Wirkung/Reflektion

Elementar ist dem gegenüber jedoch, daß Begriffe und Sprache nicht selbst das Bildnis sind, sondern die Funktionalität in seinem Grundwesen auf einer symbolischen Kodierung basiert, welche einen Hinweis liefert für das Jeweilige, auf was es hindeutet und gemäß dem erforderlichen Verbundswesen mit dem Jeweiligen sich daraus ein "realistisches funktionales(!)" Bildnis ergibt. Die Besonderheit ergibt sich indess über das Verbundswesen, auf das Begriff und Sprache speziell hinweisen und gerade darüber auch über die gegebenen Bildnisse dieses Verbundswesen wiederspiegelt. Der Bezug der (eigenen!) Sprache bildet sich indess aus der geistigen Vorstellung, welche sich aus der Wahrnehmung heraus fundiert und zur Erinnerung wird. So basiert diese vom Menschen zusätzlich gebildete Sprache auch auf der Grundlage der Sprache der Natur, dessen Kommunikation sich über die Wirkungen auf direkte Weise fundiert, zu dem die menschliche Sprache eine Erweiterung als Verweis begründet, dem gegenüber die Handlungssprache hingegen in seiner Vielfalt dessen Wirkungswesens, gemäß der darin enthaltenen Körpersprache, auf direkte Weise über dessen Wirkwesen kommuniziert. Die Sprache für sich ist ohne diesen Verbund hingegen inhaltsleer, gemäß dem auch das Wort Liebe nicht die Liebe vermitteln kann, ohne daß die Liebe erfahren wurde. Das Wort Liebe erwirkt ohne dies nicht den erforderlichen Suggestionsbezug des Erfahrenen, da das erforderliche Erfahrene in der Erinnerung nicht existiert und erwirkt, wenn überhaupt, dann das, was man des Menschen geistige Spekulation nennt und darüber hinaus auch diverse Varianten, bis hin zur gänzlichen Illusion. Somit ist aber auch des Menschen zusätzliche Sprache in seiner Anwendung grundsätzlich mit der Spekulation behaftet, da sie sich über das geiste Bedürfnis über das Präsente hinaus entfaltet und sich über die Vielfalt der gespeicherten Bildnisse ergibt, die sich miteinander kombinieren. Und wie John Locke es gemäß Plato nennt, so bilden sich in unserer geistig projizierten Vorstellung Ideen über das Seiende ab, was dies passenderweise als ein daraus kombinierend Entstehendes bezeichnet. Und so bedingt es auch grundsätzlich der kontinuierlichen replizierenden Ersichtung des jeweiligen Selbst, da es sich relativ eines abstrahierten Abdruckes stellt und nicht dieses Selbst ist.

Hinzu kommt, daß über die Wahrnehmung einzig die reflektierenden Wirkungen des Jeweiligen vermittelt wird und somit auf diese Weise nicht des jeweiligen inneres Selbst, sondern regulär einzig Äußerlichkeiten darüber ersichtlich sind. Aus dem Grund bedingt es somit auch der Verbundsbezüge der diversen Perspektivenschauen, um darüber das Jeweilige selbst daraus in Erfahrung zu bringen. So, wie es sich mit uns selbst und spezifisch unserem inneren Selbst stellt, so verhält es sich generell in der Natur des Seins. Um den Einblick zu erlangen, bedingt es des hinein begebens dessen, um es daraus heraus ersehen zu können. Nicht nur im Menschlichen, sondern in jeglichem Sein steckt innerlich ein wirkendes Selbst, was dessen Konstanz der Präsenz ausmacht und ist von außen selbst nicht wahrnehmbar. Man erfährt darüber einzig die nach außen dringenden und über das Äußere hervortretende Reflektionen dieses Selbst und nicht das Selbst selbst. Sich selbst zu ersehen, zumal vor allem auch sein inneres Selbst, erweist sich somit auch als die elementare Grundlage, die Natur des Seins als solche zu ersehen. Und umso mehr man das eigene Selbst erfährt und seine Erkenntnisse daraus erwirkt, umso weitreichender ergeben sich darüber auch die Erkenntnisse für das Sein an sich.

Dies bildet die Grundlage für das Verständnis und wird über das reflektive, einander ergänzende Verhältnis von Wahrnehmung und reflektiver Erinnerung (Vorstellung) generiert, in ergänzender Verbindung mit der Sprache. Darauf beruht auch die besondere Stellung der Begriffe in der Sprache, da sie Verbundsverhältnisse ausdrücken und darüber vermitteln, wie das Begreifen auf das Ergreifen und das daraus sich Vermittelnde verweist. Und wie sich demonstrativ über Isidor's sprachtechnische Hervorhebung in seinem Kernwesen verdeutlicht, bedingt es zur Erfüllung der Funktionalität des vereinheitlichen Verbundes von sinnenerfahrenen Kenntnissen, Vorstellung und Sprache, dessen Einheitswesen dem gemäß in dieser Reihenfolge zu fundieren und generell auf seinen jeweiligen Ursprung zurückzuführen ist und sich auch einzig das Verständnis daraus erwirkt. Betrachtet man sich dem gegenüber das stattfindende Bildungswesen, so findet darin gar einzig eine Sprachausbildung statt, ohne tatsächlichen sinnenbezogenen erlebenden Inhalt, jedoch erfährt man es allgemein als scheinbare Selbstverständlichkeit, wohingegen sich hierin die Sprache doch einzig durch die Sprache selbst erfüllt. Schlägt man aus diesem Verhältnis heraus ein Lexikon auf, erfährt man darin genau das Gleiche, sodaß es auch einzig Denjenigen überhaupt bewußt wird, welche den tatsächlichen Bezug als solchen darin bedingen. Der darin stattfindende und sich umsetzende Effekt, basiert indess auf der Zweistufigkeit von Assoziation und tatsächlicher Hervorbringung der Bildnisse. Zur Verdeutlichung dessen, fixiere man hierzu ein Objekt und verschließe anschließend die Augen, dann wird es daraus ersichtlich. Man ersieht nämlich zunächst einmal gar nichts und erst im Verlaufe, gemäß der Intensität des Bezuges zum Objekt, ergibt sich ein vages Bildnis. Die stattfindende Assoziation wirkt nämlich gemäß eines aufblitzenden Bildnisses, welches jedoch kein tatsächliches Bildnis ist und somit darüber die Suggestion erwirkt, man habe eine Vorstellung darüber. Und aufgrund der Kontinuität und Angewöhnung dieser Anwendung, wird somit auch diese Suggestion selbst als Wahrnehmung, daraus hevorgehend interpretiert, was entsprechend seiner Ausgiebigkeit auch zur Ausgrenzung der Vorstellung gegenüber der Wahrnehmung führt. Vergleicht man das Verhältniswesen der Tiere zu Bildnissen, so erfährt man darüber, daß diese aufgrund dessen, daß sie keine assoziierende Verknüpfung herstellen zu dem, was das Bildnis abbildet und sie somit auch in dem Bildnis nicht das Entsprechende - die Wirkung des Abgebildeten - damit in Verbindung bringen. Und gar sich selbst können sie aufgrund dessen in einem Spiegel nicht ersehen, wobei es gerade zu Letzterem einige Ausnahmen gibt. So basiert des Menschen erweitertes Verhältnis dem gegenüber darauf, daß dieser Bildnisse grundsätzlich assoziiert. Maßgeblich ist somit aber auch, mit was er dies in Verbindung bringt. Ohne dies ist es regulär auch für den Menschen, gemäß den Tieren wirkungsleer, was sich auch ergibt, wenn der Mensch auf ein Bildnis stößt, zu dem dieser keinen natürlichen bekannten Bezug herstellen kann, oder es nicht tut. Und so verhält es sich auch mit der Sprache relativ zu dem, was man darüber assoziiert. Gemäß dem kann Sprache auch zum Gegenteiligen und somit zum Mißstand führen, insofern es nicht seine entsprechende (An)Leitung erfährt.

Elementar bezüglich des sinnlichen Erlebens ist hingegen, daß deren Wirken selbst gar nicht in die Erinnerung übertragen werden, sondern einzig als Versinnbildlichung dort hinein gelangen und somit auch einzig dies in der geistigen Vorstellung daraus hervortritt. Auch die Sprache ist, gemäß dem aus den geistigen Hervortretungen Beruhenden sinnenleer und in dessen Verbund erfahren wir auch das Extrem reiner Versachlichungen, welche damit einher gehen, insofern man sich spezifisch daraufhin fokussiert, ohne das Sinnliche mit einzubeziehen. Gerade aufgrund des Umstandes, daß das sinnliche Erleben generell nicht nach außen übertragbar ist, erfährt dies auch seine Besonderheit des rein persönlichen Erlebens, welches als solches anderen nicht vermittelbar ist, außer regulär über die Auswirkungen, welche darüber stattfinden. Den Schmerz und die Freude kann man zwar geistig versinnbildlicht und indirekt durch körperliche Auswirkungen vermitteln, jedoch nicht das eigene persönliche sinnliche Erleben dessen selbst. Man kann es nacherleben bei sich selbst, jedoch nicht das Stattfindende Sinnenerleben in des anderen Selbst. Das Einzige, worüber es sich gemäß seiner Relation vermittelt, ist die sinnliche Reflektion, wie man sie speziell im Sexuellen erfährt, indem sich das sinnliche Erleben über die Reflektion miteinander verbindet, koordiniert und darin spiegelt. Das sprachlich Kommunikative beinhaltet weder im Verhältnis des Selbst, noch in der Kommunikation mit anderen, das sinnliche Erleben. Und selbst, wenn man es mit Worten benennt und beschreibt, spricht es über die Wirkungslosigkeit darüber auch nicht auf direkte Weise die Sinne an. Maßgeblich ist damit verbunden, daß es sich hierbei, wie bei einem Blicken in zwei entgegengesetzte Richtungen verhält, sodaß, insofern man Eines davon spezifisch fokussiert, das Andere darüber ins Abseits gerät. Es ist funktionsbedingt und gerade darüber zeigt sich auch die spezifische Funktionsweise des Bewußtsinnes selbst auf, worin nämlich einzig beides, wie überhaupt das Sinnliche einzig darüber in Erscheinung tritt, jedoch das sinnliche Wirken in den geistigen Hervortretungen hingegen nicht zur Erscheinung gelangt. Zu unterscheiden ist somit, was man allgemein nicht erachtet, gemäß der einstigen Mißachtung Descartés, daß der fließende Vorgang der bewußtwerden Hervortretung ein anderer ist, als das statische Erscheinen der Kontinuität des Bewußtseins (Bewußtwerdung ↔ Bewußtsein), worin das Bewußtsein spezifisch über das Zirkelsystem erzeugt wird, gemäß nachfolgender Abbildung, worüber die Bewußtwerdung selbst, in seiner Reflektion, zum Anschauungsgegenstand wird. Der Geist projiziert gemäß dem einzig die Bildnisse, welche aus der Erinnerung heraus zu diesem gelangen. Gerade diese Scheidung und Präsenz des Bewußtsinns ist das, worüber sich die eigentliche Sichtung und auch Klärung der inneren Sinne und deren Funktionsweise ergibt. Über die monistischen Geistfixierungen ist dies indess ins Abseits geraten.

Bewußtsinn

Es bedingt somit der Kommunikation über die Sprache auch grundsätzlich des Involvierens des sinnlichen Subjekts selbst, insofern dies Inhalt sein soll und nicht rein sachlich orientiert ist, dem gegenüber man in der hochdeutschen Sprache gar ein Neutrum ausgebildet hat, in welchem einzig das grammatikalische Subjekt Inhalt ist, jedoch nicht das aussagende Subjekt selbst. Dem gegenüber verhält es sich mit der regulären Verbalsprache und somit aus seinem Ursprung noch bestehenden Dialekt und dem neu entstehenden Slang anders, denn hierin ist die spezifische Ausdrucksform und somit das damit verbundene generelle Involvieren des Subjekts die Anwendungsform, worüber auch das Sinneswesen in dessen Verbund mit vermittelt wird und auf direkte Weise über das Wirken zum Ausdruck und darüber zur Vermittlung und Ansprechen dessen gelangt. Es bedingt grundsätzlich dessen spezifischen Involvierens, ohne das ein solches nicht stattfindet. Hierzu gilt es anzumerken, daß die Erfahrung zeigt, daß Diejenigen, welche einzig die Hochsprache erlernt haben, dieses Verhältnis nicht nachvollziehbar erscheint, dem gegenüber man hingegen weitläufig zuweil auch die Hochsprache sich umwandelt, was in seiner spezifischen Weise auch den Slang ausmacht. Hingegen ist kein allgemeines Bewußtsein für diese funktionale Gegebenheit vorhanden und ist auch generell nicht als zu erachtendes Thema anzutreffen, sodaß auch diese Gegebenheit sich als gänzlich unbewußt stellt. Die Hochsprache ist eine Formalsprache und speziell im Formwesen trifft man somit auch das daraus resultierende reine Versachlichungswesen an und ist darin Ermessungsgegenstand, dem gegenüber der Mensch jedoch als solcher, zum Einen, über die reine Versprachlichung der Dinge, wie auch über das spezielle Eintrainieren eines solchen Händlings dazu gelangt, dies als Reguläres zu handhaben. Formalsprache und Umgangssprache sind jedoch zwei unterschiedliche funktionale Wesensarten, was man ersichtlicherweise nicht dabei bedacht hat, bei der Umsetzung, diese Formalsprache gleichermaßen auch als Umgangssprache zu handhaben.

Hochsprache.svg

Über die aufgezeigten Verhältnisse verdeutlicht sich auch, warum die heimische Philosophie im Verlaufe in der Phänomenologie des Geistes, sowie damit verbunden in dem Leib-Seele-Problem versandet ist. Dies geschah im Verbund mit dem Aufkommen der physischen Kenntnisbildungen der Naturwissenschaft, worüber deren Präsenz immer klarer sich als reines Geistwesen dem gegenüber eingrenzte. Die Grundlage hierin bildet die handhabende Undifferenziertheit von Wahrnehmung und Vorstellung und dessen pilosophisches Detailwesen erfährt man in der Gegenüberstellung von Plato und Aristoteles, sowie Descartés und Locke. Während Plato die Kenntnis dem Geiste gegeben ist, wendet sich Aristoteles hingegen dem zu, was die Wahrnehmung über das Sein darbietet. Und während über Descartés das Bewußtsein und somit die Wahrnehmung über das Denken hervortritt, erläutert Locke das Verhältnis der anfangs leeren Erinnerung, die sich über die Wahrnehmung erfüllt und daraus sich die Ideen im Geiste begründen. Während somit dem gegenüber die aufkommende Naturwissenschaft sich explizit auf die Wahrnehmung des dem Auge Ersichtlichen spezifiziert und aufgrund dessen darin auch kein derartiges Innenleben existiert, fehlt es somit auch der Verbindung dieser beiden Inbetrachtziehungsweisen. Dem gegenüber ist jedoch auch dieser es der Geist, worüber sich alles miteinander vermittelt, aufgrund dessen sie Jegliches theoretisieren und die Theorien ihre Lehren begründen, welche darin den Lernenden den Ausgangpunkt begründen. Und so mündet auch das Wissenschaften wiederum in einer reinen Vergeistigung des Seins, was auch die aufbringende Bewandtnis der Anatomen war, daß es des Grundsatzes der Praxis bedinge, um die erforderliche Funktionalität zu gewährleisten. Dem entsprechend erweisen sich jedoch die Ideologien, im Verbund mit dem Popularismus, als zentrale Leitlinie der kulturellen Grundwesensarten, welche man praktiziert und so ist es maßgeblich aufgrund dessen auch das Geistwesen, worüber sich alles miteinander bestimmt. Hingegen hatte bereits Aristoteles in seiner Anatomie des Innenlebens die Erkenntnis aufgebracht, daß es zur Hervorbringung der koordinierten und qualitativen Erscheinungen der äußeren Sinne, wie wir es (über die bewußtwerdende Wahrnehmung) erfahren, zwangsläufig eines weiteren Organes bedinge, um dies zu vollziehen. Und auch Locke bringt über seine Ergründungen die erforderliche Unterscheidung von (bewußter) Wahrnehmung, Erinnerung und geistiger Vorstellung auf. Der Kern der anatomischen Grundlagen sind somit hierüber gegeben, jedoch finden diese nicht ihre erforderliche Anwendung des Trennungs- und Spezifizierungswesens. Stattdessen beschränkt man sich verharrend darauf, auf eine Einschränkung der Anatomie auf Körper und Geist.

Diese Einschränkung erweist sich auch als generelle Bewandtnis der Entwicklungen des Sprach-, Rechts- und Formalwesens, welche im Verbunde miteinander einher gehen, was sich verdeutlicht, wenn man den Ursprung dazu in Betracht zieht. Wie nachfolgender Auszug aus dem Rechtswesen darlegt, worin nämlich das Billigen und Mißbilligen das Kernwesen des natürlichen Umganges begründete, indem hierin das Empfindungs- und Gefühlswesen, gegenüber dem sachlichen Umgang, seine erforderliche Berücksichtigung erfuhr, so kann man dies in späterer Zeit gar nicht mehr nachvollziehen. Des Menschen reflektierendes Urteilswesen beruht auf zweierlei zugrundeliegenden Wesensarten: zum Einen auf dem von Empfindungen und Gefühlen, in dessen Verbund das Instinktive und Intuitive reflektiv hervortritt und davon separierend, auf dem des reflektierenden geistigen Willens. Dem gemäß fand ursprünglich auch beides seine erforderliche Berücksichtigung, worin das Billigen sich auf des Menschen Natur bezieht und dies bedingend auch zu berücksichtigen ist, hingegen jedoch der Wille des Menschen, auf der geistigen Entscheidung beruht, sodaß es sich dem gemäß auch um ein zusätzliches und somit um ein be-willig-en handelt. Grundsätzlich ist beides funktional im Nebeneinander präsent, steht jedoch nicht bedingend miteinander im Einklang, sodaß es auch aus dem Grund einer zu differenzierenden Berücksichtung bedingt, den man somit auch entsprechend zu ermessen suchte. In der Wahrheitsfindung bedingt es, aufgrund dieser Verschiedenheit auch primär der Feststellung, inwiefern die stattfindende Aussage der eigenen Wahrheit entspricht oder sich dies als eine Lüge erweist, gemäß dem, inwiefern dies mit seiner Wesensart des Selbst in Einklang steht. Und erst sekundär kann infolge dessen eine Wahrheitsfindung zur Sache selbst sein Reglement finden. Gerade die Lüge gibt es nämlich einzig im Geiste, wohingegen Empfindungen und Gefühle einem zwar trügen können, gemäß der Sinnestäuschung, jedoch nicht betrügen, gemäß der geistigen Lüge.


in der Theorie des Civilrechts
Verlag: Arnoldische Buchhandlung

Das deutsche Billigkeit stammt von Bill, welches im Altdeutschen so viel war als Recht, empfundenes Recht, im Gegensatze des gegebenen, geschriebenen Rechts. Es scheint mithin zunächst eine allgemeine Rechtsnorm bedeutet zu haben, die neben dem positiven Rechte und zur Ergänzung desselben bestand, so wie mehrere Schriftsteller die römische Aequitas juris civil correctio oder emendatio nennen. Billig war dem Naturrechte gemäß und mithin mehr als der Billigkeit gemäß im heutigen Sinne. Auch das Zeitwort billigen, welches nicht bloß für billig, sondern auch für recht erkennen bedeutet, umfaßte ursprünglich mehr, als man dabei sich zu denken jetzt gewöhnt ist. Diese wahre Bedeutung ist aber fast ganz verschwunden, und daher kommt es, daß die Juristen, welche von der Existenz und der Stellung der aequitas im Sinne des römischen Rechts keine deutliche Vorstellung haben, von Billigkeit im jure civili nichts hören wollen, indem sie dabei über die Idee der moralischen, christlichen Billigkeit, als etwas mit der Ausübung des Rechts unereinbaren, die richterliche Willkür möglicher Weise befördernden, sich nicht zu erheben vermögen. Nun ist es vollkommen wahr, daß moralische Billigkeit, als etwas ganz subjectives, nur Sache der Parthei, nicht des Richters ist, mithin auch nicht Theil oder Gegenstand der Theorie des Rechts sein kann. Aber um so gewisser ist diese Billigkeit, in so fern sie in einem Nachlassen von der Strenge des Rechts besteht, der römischen Aequitas ganz fremd und spricht eben dadurch für die Wahrheit der Existenz dieses Begriffs in der Theorie des Rechts, an der deßhalb auch nie mit Grund gezweifelt worden ist. Jene setzt klare Bestimmungen des Rechts voraus, vollkommene Rechte, die aus subjectiven Gründen von dem Berechtigten selbst freiwillig gemildert werden; diese aber den Mangel positiven Rechts oder dessen Unbestimmtheit, welche die Schöpfung einer neuen Rechtsnorm, der auquitas selbst, als Vermittlerin zwischen jus und factum, nöthig macht, damit ein gegebener Fall nicht unentschieden bleibe, was bei einem wohl organisierten Rechtszustande, selbst in Ermangelung positiver Gesetze, nicht denkbar seyn kann, noch darf. Billigkeit im Sinne des deutschen Wortes finden wir im römischen Rechte und bei den Classikern vornehmlich durch humanitas, officium pietatis, benignitas, temperamentum benignitatis u.a. bezeichnet. Um von dem wesentlichen Unterschiede, der zwischen moralischer und, um die römische aequitas hier im Gegensatze so zu nennen, juristischer Billigkeit obwaltet, sich zu überzeugen darf man nur erwägen, wie die erstere von unseren ausgezeichnesten Moralisten definirt und ihrem Wesen nach bezeichnet wird.

Adelung, in seinem Wörterbuche der hochdeutschen Schreibart, sagt von Bill: dieses Wort ist von jeher am meisten von dem empfundenen Recht, dem Rechte der Natur gebraucht worden, im Gegensatze dessen, was dem gegebenen Rechte oder den eigentlichen Gesezen gemäß ist. Campe, in seinem Wörterbuche der deutschen Sprache, nennt die Bill geradezu ein Wort, welches ehemals das Recht bedeutete. Es ist zu bedauern, daß beide Sprachforscher sich nicht gründlicher über die ursprünglichen Bedeutungen dieses Wortes verbreiten. Wenn Campe a.a.D. von Bill sagt: es verdiene für dasjenige, was Recht und Gesetz werden soll, was es auch im Englischen bedeute, wieder eingeführt zu werden, so setzt er voraus, daß es diese Bedeutung gehabt habe, ohne jedoch eine nähere Nachweisung zu geben. Ueber den Ursprung des Englischen, auch im Französischen recipierten Bill habe ich keine genügende Auskunft gefunden. Das Wort Bill kommt in der englischen Sprache in andern, sehr verschiedenen Bedeutungen vor, die jedoch in keinem Zusammenhange mit dem altdeutschen Bill zu stehen scheinen. Nicht uninteressant ist es, das deutsche Bill und billig mit einigen Fremdwörtern zu vergleichen, die seine Ableitung aus dem Lateinischen zu rechtfertigen scheinen. Von dem lateinischen bilanx, zwei Waagschalen habend, also ein Mittel zum Abwägen, Erwägen, ausdrückend, stammt das italienische bilancia, die Waage, das Gleichgewicht. Davon bilicare, in's Gleichgewicht bringen, figürlich: wohl erwägen, und bilico, das Gleichgewicht. Alle diese Worte sprechen für eine Verwandtschaft mit dem deutschen Bill in Klang und Sinn und scheinen synonym mit aequum, aequitas, aequilibrium. Selbst die mit dem englischen bill verbundene Bedeutung, nach welcher es ein Vorschlag des Parlaments ist, der, wenn er von beiden Häusern genehmigt wird, mithin gleichsam in beiden Waagschalen der Erwägung aeque beurtheilt worden ist, durch königliche Genehmigung zur Parlamenstacte wird, spricht für die Verwandschaft mit dem deutschen Bill und den angeführten lateinischen und italienischen Worten.

Während Albrecht über die Synonyme des Lateinischen aufklärt, oder konkreter, sie auzuklären sucht und dieser darüber dazu gelangt, daß es bei den Römern gar keine Klarheit darüber gab, erläutert hingegen in Nachfolgendem Eberhard das Verhältnis deutscher Gerechtigkeit, in dessen Synonymitäts- und Wirkwesen. So gilt es, sich darin vor Augen zu führen, wie dieser ein und dasselbe in den drei unterschiedlichen Gegenüberstellungen darlegt und sich darüber auch veranschaulicht, worin es seine reguläre Bewandtnis fand. Nämlich einzig in Ersterem, in welchem es um das reine Gewohnheitsrecht und somit des personell händelnden Miteinander geht, welches auf der Vereinbarung untereinander beruht und in kurzen Worten die Klarheit gegeben ist, da es sich in sich klärt. Dem gegenüber verliert dieser sich gegenüber dem (durch Andere vor-)geschriebenen Gesetze in der Umfänglichkeit, da es darin gar nicht enthalten ist und zu vermitteln sucht, wie es denn Betroffene erfahren. Hierin liegt tatsächlich noch die Billigung beim Richter, jedoch bezieht sich dies darin auf das Maß der Ermessung der Sachlichkeit des Rechts. Im dritten Abschnitt hingegen nimmt dieser gar die Position des Betroffenen ein, welcher darin dem Rechtswesen gegenüber steht und darüber auch erfährt, daß es die Gefühle sind, dessen es darin entbehrt. Und so ist seine Schlußfolgerung jedoch noch nicht vollständig miteinander verknüpft, um daraus zu ersehen, daß es doch die reine Sachlichkeit der Sprache ist, aufgrund dessen dies auch die Gefühle gar nicht anspricht, sodaß ein solches Händling sich als nicht derart einwirkend stellt, als wenn die Gefühle als solche Bestandteil sind und selbst angesprochen werden. Der Geist steht somit darin regelrecht unbeteiligt anbei, ohne daß dies ihn berühren kann, sodaß dieser es auch dem entsprechend handhabt, da der unangesprochene Instinkt darauf selbst nicht reagiert.


in einem kritisch-philosophischen Wörterbuche
der sinnverwandten Wörter der hochdeutschen Mundart

Dritter Theil - F-G
Verlag: Ruffsche Buchhandlung

Gerecht. Billig. - Gerechtigkeit. Billigkeit.

Die Fertigkeit, nichts gegen das Recht eines anderen zu thun, ist die Gerechtigkeit und Billigkeit; wer danach handelt, handelt gerecht und billig, und was beyden gemäß ist, das ist gerecht und billig. Obgleich das natürliche Gefühl schon diese Begriffe unterscheidet, und seine unentwickelten Urtheile darüber in der Sprache niedergelegt hat: so ist es doch nicht überflüssig, sie in einer allgemeinen Synonymik genauer zu zergliedern. Denn es ist nicht nur sehr angenehm, mit seinen Gedanken bey den Betrachtungen der ersten großen Grundpfeiler der allgemeinen Gesellschaft des menschlichen Geschlechts zu verweilen; die genauere Bestimmung dieser Begriffe, die von so großer Wichtigkeit sind, ist auch noch so wenig vollendet, daß kein Beytrag zu derselben unnöthig angesehen werden kann. Hingegen muß auch diesem, trotz des Titels darbietenden Verbundenheit zum Dialekt, gemäß des dritten Abschnittes, von anderer Stelle vermittelt werden, worin gerade die Grundlagen bestanden, worüber auch das seine Darlegung erfährt, was zuvor zur Rede kam, daß nämlich hierin die Gefühle das Persönliche ausmachen und ein elementarer Bestandteil des Gerechtigkeitsverhältnisses ist.

Divider

Die allgemeine Ansicht der Begriffe, die diese Wörter bezeichnen, führt auf den Unterschied, der der Gerechtigkeit die strengen oder vollkommenen Pflichten zu ihrem Gegenstande zutheilt, das ist, diejenigen, zu welchen wir können gezwungen werden, der Billigkeit hingegen die unvollkommenen, die Pflichten der Menschenliebe, die Niemand von dem Andern mit Recht erzwingen kann. Dieser Unterschied ist nicht unrichtig, allein er bestimmt den Begriff der Billigkeit noch nicht genau genug.

Denn zuvörderst gibt es eine allgemeine Gerechtigkeit welche sowohl die Gewissenspflichten der Menschenliebe als die strengen oder Zwangspflichten in sich begreift; die belohnt und bestraft, dem Wohlthäter mit Dank vergilt, das Verdienst schätzt, und dem Nothleidenden hilft, kurz der die Würdigkeit und Bedürftigkeit der Menschen eben so heilig ist, als das eigentliche Mein und Dein.

Von diesem allgemeinsten Begriffe ist sogar die Bedeutung des Wortes gerecht in der deutschen Sprache ursprünglich ausgegangen. Denn gerecht bedeutet wie recht, von dem es nur eine andere Form ist, das was seinem Grunde gemäß ist. So ist ein Kleid demjenigen for den es bestimmt ist, gerecht, wenn es ihm paßt, und also seine Größe und Form nach dem Körper, dem es anliegen soll, genau bestimmt ist. Eine Handlung ist in diesem Sinne gerecht, wenn sie durch den vernünftigen Grund, der sie bestimmen soll, bestimmt ist. Derjenige theilt Lob und Tadel gerecht aus, der in seinen Urtheilen über Andere keinen andern Gründen, als ihrem erforschten und erkannten Verdienste oder Unverdienste folgt. Die Gerechtigkeit will, daß wir einem jeden das Seinige lassen; denn das sind all die Güter, wovon wir aus vernünftigen Gründen mit völliger Gewißheit erkennen, daß sie zu ihm und zu keinem andern gehören.

Wenn also die Pflichten der Menschenliebe mit in der Tugend der Gerechtigkeit enthalten sind: so muß es noch einen besonderen Nebenbegriff geben, wodurch sich die Billigkeit von der Gerechtigkeit unterscheidet; und dieser ist die Ausübung seiner Rechte, so wie es der innern Verbindlichkeit gegen Andere, oder den Pflichten der Menschenliebe gemäß ist.

Die Gerechtigkeit kann nämlich von zwey Seiten betrachtet werden; zuvörderst von der Seite der Pflichten gegen Andere, sowohl der Zwangspflichten, als der Pflichten der Menschenliebe, und hiernächst von der Seiten der Rechte. Nach der ersten Seite erstreckt sich die Gerechtigkeit über alle menschlichen Handlungen; sie müssen all gerecht und also der Zwangsverbindlichkeit und der Verbindlichkeit zur Menschenliebe gemäß seyn. Nach der Seite der Rechte begreift sie nur die Zwangsrechte, und sie muß in ihrer Ausübung durch die Billigkeit gemäßigt, oder welches einerley ist, durch die Menschenliebe eingeschränkt werden, wenn der Mensch, der der Gegenstand und das Opfer derselben ist, nicht unter dem Gefühle der Härte sich soll beklagen zu haben.

Dieser Begriff der Mäßigung in der Ausübung strenger Recht ist folglich der erste, unter welchem einem jeden Menschen die Billigkeit erscheint. Die Gesetze der Gerechtigkeit schreiben mir meine Pflichten vor, und machen mich mit meinen Rechten bekannt; die Gesetze der Billigkeit schreiben mir vor, wie ich den Gebrauch meiner Rechte durch meine Pflichten mäßigen, einschränken, bestimmen muß. Der Billige ist auch in allen seinen Handlungen gerecht; denn er beobachtet alle seine Pflichten gegen andere, und mäßigt sich in dem Gebrauche seiner Rechte, indem er sich seine Ausbildung derselben bloß seine Rechte, er kennt auch seine Pflichten, und mäßigt den Gebrauch der Ersteren durch die Beobachtung der Letzteren.

Die erste Bestimmung unserer Rechte durch unsere Pflichten kommt bey den Rechten vor, die uns die positiven Gesetze geben. Da gibt es eine gesetzgebende, eine richterliche und eine vollziehende Billigkeit. Denn der Gebrauch dieser drey Gewalten muß durch die Pflichten und die Gesetze der natürlichen Gerechtigkeit bestimmt werden, wenn er der Billigkeit gemäß seyn soll. Und hier kann das nähmliche Gesetz ungerecht und unbillig heißen; aber in verschiedener Rücksicht; ungerecht, sofern es der natürlichen Gerechtigkeit oder dem Naturgesetz entgegen ist, unbillig, sofern der Gesetzgeber sein Recht nicht den Naturgesetzen gemäß gebraucht hat. Man hält das Gesetz für unbillig, daß der älteste Sohn das ganze väterliche Vermögen erbt, weil man glaubt, daß der Gesetzgeber dabey nicht die natürliche Gerechtigkeit zu Rathe gezogen hat.

Divider

Der angegebene Unterschied läßt sich auch, in Ansehung des Wortes billig, durch den Ursprung desselben rechtfertigen. Denn es stammt von dem veralteten Bill, gefühltes Recht, ab, wovon noch in den oberdeutschen Mundarten, insonderheit in der Schweitz, Unbill, gefühltes Unrecht, übrig ist. "Bill, sagt Lessing in den Beyer. zu e. d. Gloss. Das Unbill, indignatio, Unwillen". Es ist aber eigentlich das Unrecht durch dessen Gefühl die Indignation erregt wird. Die Billigkeit und Unbilligkeit wird aber mehr durch das Gefühl beurtheilt, und kann nicht in jedem Falle zu Jedermanns Befriedigung durch Zergliederung der Vernunft dargelegt werden. Die Quelle der natürlichen Billigkeit ist die innere Verbindlichkeit des Gewissens und die allgemeine Gerechtigkeit, angewandt auf den Gebrauch unserer strengen Rechte, und unter diese innere Verbindlichkeit ist es oft schwer, den Eigennutz und die Leidenschaft zu überzeugen, indeß man durch die Aussprüche der strengen Gerechtigkeit oder den Buchstaben der geschriebenen Gesetze alle Zweifel und Einwürfe zum Schweigen bringen kann. Inzwischen ist eine unbillige Behandlung oft schmerzhafter, als eine ungerechte, eben deswegen, weil sie tiefer gefühlt wird.

Elementar ist somit auch hierin die stattgefundende Entwicklung, die man gar nicht nachzuvollziehen vermag. Gemäß des Umstandes, gibt es nämlich einzig Belege über geschriebene Rechtsverhältnisse und somit erst über die Zeitverhältnisse der entstehenden territorialen Herrschaftswesen, worin das geschriebene Recht die Grundlage bildet, wohingegen im Ursprünglichen, der reinen Personalunion, auch gar keine Schriftsprache existierte, hingegen jedoch Jegliches Miteinander in seiner Substanzierung, über das Handlungswesen und mündliche Vereinbarungen, nicht nur in seiner geschichtlichen Herkunft, sondern generell und somit auch heute noch fortwährend, darüber stattfindet. Man bedenke die Markantz der gänzlichen Unbedachtsamkeit gegenüber dieser Gegebenheit der Aktualität dessen!

So erweist sich der Verlauf auch derart, wie nachfolgend aufgezeigt, gemäß dem man die Vereinbarungen einzig zur Erlangung territorialer Reglements als solche sammelte, indess sich jedoch über das Obrigkeitswesen des Staats- und Kirchenrechts hingegen einzig eine Übernahme aus dem römischen Recht vollzog. Zwar vermischte sich dies auch im Verlaufe der Jahrhunderte zum Teil miteinander, wohingegen jedoch seit Einführung des Bürgerrechtes, mit Beginn des 20. Jahrhunderts, einzig noch das Staatsrecht, gemäß des römischen Rechts, in Anwendung ist und bereits zuvor das Kirchenrecht dem gegenüber seine formelle Abseitigkeit erfuhr. Dies basiert hingegen jedoch nicht auf der Vereinbarung der Gemeinschaftsmitglieder untereinander, sondern auf einem dem gegenüber sich stellenden Regulat - dem herrschenden Regulat. So ist es auch darin etwas anders, wie Oestmann in seinem Buche erwähnt, daß nicht das Recht und die Sprache sich parallel miteinander entwickelten, sondern man die umsetzenden Entwicklungen derart gestaltete, daß sie miteinander eine Einheit bilden. Hingegen basiert das Kernwesen beider jedoch vor allem auf dem außen vor Stellen des Subjekts, welches darin einzig noch dem gegenüber steht.

» Reallexicon der Deutschen Altertümer (1885) «
Artikel: Leges barbarorum
Verlag von Woldemar Urban
E. Götzinger

Leges barbarorum, Volksrechte, heissen die ältesten Rechtsaufzeichnungen der germanischen Stämme nach der Völkerwanderung. Vor der Völkerwanderung hatten die Germanen keiner geschriebenen Gesetze bedurft; erst als sie sich nach den Kämpfen mit den Römern teilweise auf römischem Boden niedergelassen und neue Staaten gebildet hatten, in welchen Deutsche und Römer nebeneinander lebten und die Verhältnisse verwickelter geworden waren, trat das Bedürfnis ein, neben der Feststellung des von früher her bestehenden Rechtes zugleich die neuen Verhältnisse rechtlich zu fixieren. Die Volksrechte sind darum nicht bloss Aufzeichnungen des Gewohnheitsrechtes, sondern zum Teil Ergebnisse der Vereinbarung des gesamten Volkes über dasjenige, was es als Recht befolgen wollte, oder der Gesetzgebung des Königs. Die besondere Entstehung dieser Rechtsaufzeichnungen und der späteren ist meist in tiefes Dunkel gehüllt; doch enthalten manchmal die Prologe oder Epiloge mehr oder minder beglaubigte Nachrichten über den Ursprung des Gesetzes. Das wichtigste Motiv für die Aufzeichnung des Rechtes scheint die Berührung mit den Römern abgegeben zu haben, deren Recht mit demjenigen der eingewanderten Deutschen gegenseitig zu vereinbaren war; man erkennt das daraus, dass die ersten leges solchen Stämmen angehören, welche am frühesten auf römischem Boden einwanderten. Eine fernere Veranlassung zu Rechtsaufzeichnungen trat dann ein, wenn mehrere bisher voneinander unabhängige Gemeinden oder Staaten durch Eroberung miteinander vereinigt wurden, wobei dann eine Vereinbarung über gewisse Rechtsverhältnisse, namentlich über das Wergeld und die Bussen, zum Bedürfnis wurde. Für diejenigen Volksstämme, welche ihre einmal eingenommenen Wohnsitze nicht mehr verliessen, trat erst mit der Unterwerfung unter das fränkische Reich ein Bedürfnis der Rechtsaufzeichnung ein; derart sind im 6. und 7. Jahrhundert die leges der Bayern und Alemannen entstanden. Karl der Grosse endlich liess die Rechte aller derjenigen Volksstämme verzeichnen, welche bisher nur nach ihren Gewohnheiten und den ungeschriebenen Vereinbarungen über das Recht gelebt hatten: die Rechte der Friesen, Sachsen und Thüringer. Auch der Übertritt zum Christentum war ein Anlass, die Rechte der Kirche und der Geistlichkeit festzusetzen und die mit der heidnischen Religion zusammenhängenden Gebräuche christlich umzuändern. Nur das salische Recht ist noch vor der Einführung des Christentums abgefasst worden. Überall scheinen es einige ausgewählte, mit der Anwendung des Rechtes vertraute Männer gewesen zu sein, denen man das Geschäft der Aufzeichnung übertrug; wo aber durch die Aufzeichnung ein neuer Grundsatz aufgestellt werden sollte, war es der König, der auf der Reichsversammlung mit den weltlichen und geistlichen Grossen und unter Zuziehung des Volks das neue Recht verkündete.

Der Inhalt der Volksrechte ist mannigfaltig und ihr Umfang ungleich. Immer nehmen die Busssätze für die verschiedenen Rechtsverletzungen und die Wergeldbestimmungen für die Stände die wichtigste Stelle ein. Daneben erscheinen Bestimmungen über Verfassung und Kirche, über die Stellung der Römer zu den Deutschen, dann findet man Verhältnisse des Grundbesitzes und die Formen seiner Übertragung berücksichtigt, das Erbrecht, das Güterrecht der Ehegatten und das Familienrecht überhaupt, die Leistung des Schadenersatzes und die Verfolgung des Eigentums an beweglichen Sachen. Rechtssätze, welche in der Überzeugung und der Kunde aller lebten und täglich geübt wurden, überging man bei der Aufzeichnung. Vielfach sind einzelne Bestimmungen und ganze Abschnitte aus einem Recht in das andere hinübergenommen worden. Die Darstellung ist bald breiter, bald knapper; manche Volksrechte haben mehrere Überarbeitungen erfahren.

Mit Ausnahme der angelsächsischen Gesetze sind alle Volksrechte in lateinischer Sprache geschrieben; doch findet man zerstreut viele deutsche Worte, zum Teil deutsche Redensarten. Erst im 9. Jahrhundert sind einzelne Rechtsquellen deutsch übersetzt worden.

Divider

» Strafrechts- und Kriminalitätsgeschichte () «
der Frühen Neuzeit
Verlag: de Gruyter

S. 20: Das frühneuzeitliche Reich und das gemeine Recht konstituierten einen grenzübergreifenden strafrechtlichen Raum, in dem sich grundlegende Strukturen und Probleme eines transnationalen Strafrechts ausformten. Dies gilt für die staatliche, territoriale, politische und jurisdiktionelle Räume bzw. Grenzen übergreifende Strafverfolgung wie für die Ausformung von Nacheile, Requisition, Rechtshilfe, Verfolgungs- und Bestrafungspflicht, stellvertretender Strafrechtspflege, Gerichtsstand, Asyl und Auslieferung als spezifischen grenzübergreifenden Instrumenten und Praktiken. Im frühneuzeitlichen Reich - wie auch in anderen europäischen Ländern - vollzog sich Strafjustiz folglich in komplexen Kommunikations- und Interaktionsprozessen in einem Mehrebenensystem, das durch Rechtspluralismus, Diversität, Heterogenität, Hybridität und Fragmentierung gekennzeichnet war. Die unterschiedlichen interdependenten Räume, Ebenen, Jurisdiktionen, Interaktionen und Kommunikationen im frühneuzeitlichen Reich bilden für die Strafrechtsgeschichte wie für die Untersuchung von Kriminalität eine besondere methodische Voraussetzung und Herausforderung, sowohl im Hinblick auf die Analyse von Kriminalität als auch bezüglich des Strafrechts und der Praxis der Strafiustiz. Nimmt man nur den Zustand am Ende des Alten Reiches um 1800, dann übten mehr als 250 Reichsstände (8 Kurfürsten, über 200 Fürsten und 50 Reichsstädte) die hohe Strafgerichtsbarkeit über zumindest ein Strafgericht bzw. entsprechende juridische Institutionen aus, wobei meist die jeweiligen juristischen Fakultäten der Landesuniversitäten (soweit vorhanden) einbezogen waren. Dazu kamen die Strafgerichtsbarkeiten der kleineren Reichsmitglieder (z.B. der Reichsritter) und die unzähligen lokalen Strafgerichte, welche die niedere Strafgerichtsbarkeit und in einigen Fällen auch die höhere ausübten, sowie zahlreiche spezifische Gerichtsbarkeiten von Kirche/Geistlichkeit, Universitäten, Zünften und weiteren intermediären Gewalten. Die Zahl der Normgeber und juridischen Institutionen im frühneuzeitlichen Alten Reich geht folglich in die Tausende; ein umfassender Überblick existiert nicht und nur ein kleiner Teil ist in meist räumlich, zeitlich und thematisch begrenzten Fallstudien erforscht.

Divider


Böhlau Verlag

Die ältesten schriftlichen Quellen über das einheimische Recht stammen von Römern und sind in lateinischer Sprache überliefert. Es handelt sich um mittelbare Rechtsquellen, um kurze Einsprengsel in der antiken Literatur. Besonders bekannt und umstritten ist die "Germania" des römischen Historikers Tacitus (98 n. Chr.). Auf knapp 30 Seiten schildert der Römer, der selbst nie nördlich der Alpen war, Sitten und Gebräuche der Stammesvölker, die dort leben sollten. Dabei hielt das Beispiel eines angeblich unverbrauchten Naturvolkes den verlotterten Weichlingen des römischen Imperiums den Spiegel ihrer eigenen dekadenten Verkommenheit vor. Tacitus war also alles andere als ein unvoreingenommener Beobachter. Dennoch erlangte seine kleine Schrift, nachdem sie erst im 15. Jahrhundert wiederentdeckt worden war, schlagartige Berühmtheit. Die Diskussion um eine germanische Rechtsgeschichte kreist seitdem um wenige Sätze.

Bei allen Einwänden gegen Ungenauigkeiten und Einseitigkeiten der "Germania" scheint der Mechanismus, den Tacitus beschreibt, unzweifelhaft zu sein. Eine Auseinandersetzung, die aus moderner Sicht auf einer Rechtsverletzung beruht, erschien in der germanischen Zeit als Privatangelegenheit. Nicht die Gemeinschaft oder irgendeine Obrigkeit kümmerte sich darum, sondern die betroffenen Familien waren selbst berufen, ihren Streit auszufechten oder beizulegen. Entweder gab es Gewalt oder Konsens. Zwischen diesen beiden Polen bewegt sich die gesamte älteste Geschichte der Rechtsdurchsetzung. Ob die Zeitgenossen ihr Verhalten in rechtliche Vorstellungen einordneten, ist unklar, aber nicht entscheidend. Diejenigen Streitigkeiten, die heute Rechtssachen sind, führten damals zu Fehdehandlungen oder zur Aussöhnung.

Zur Klarstellung sollte man dieses Modell von einem altbekannten Prinzip unterscheiden: Am Anfang der Überlieferung steht nicht der Grundsatz "Auge um Auge, Zahn um Zahn". Eine derartige Talion, also der Anspruch, Gleiches mit Gleichem zu vergelten, blieb der frühen einheimischen Rechtsgeschichte fremd. Der Talionsgedanke setzt einen Herrscher voraus, der die Möglichkeit besitzt, Rachehandlungen zu verbieten oder auf das Gleichmaß der Verletzungen zu beschränken. Auge um Auge, Zahn um Zahn - dieses alte Prinzip ist in sumerischen, babylonischen und altisraelischen Quellen überliefert. Es stammt aus Kulturen, die über ein vergleichsweise hohes Maß an staatlicher Organisation verfügten. Angebunden an einen göttlichen oder königlichen Gesetzgeber und eingebettet in eine ausgeprägte Schriftkultur ging es im orientalischen Recht darum, allgemeine Regeln für das Zusammenleben der Bevölkerung zu Formulieren. Davon kann bei den von Tacitus geschilderten Zuständen keine Rede sein. Eine Zentralgewalt war nicht vorhanden, schriftliche Gebote gab es nicht, Rachehandlungen ließen sich nicht lenken. In einer Gesellschaftsordnung ohne jeden Staat prägen Gewalt und Konsens die Auseinandersetzungen, unabhängig davon, ob sie aus moderner Sicht rechtlich eingebunden oder anderswie erscheinen.

So ist hingegen der Kampf gegen den Schriftglauben, den man in der Renaissance bekämpft, ein uraltes und noch heute bestehendes Mißverständnis gegenüber dem Glauben, speziell dem des Christentums, indem es darin eben nicht um die Ergründung und Darbietung der Göttlichkeit sich dreht, sondern um die Worte Gottes und somit der heiligen Schrift, womit der damit verbundene allgemeine Schriftglaube einher geht. Maßgeblich hierin ist, daß auch die aufkommende allgemeine ärztliche Versorgung sich im Mittelalter über die Klöster und deren aufbringenden Kenntnisse vollzog, was auf den Übernahmen des griechischen, lateinischen und arabischen Ursprunges beruhte und getreu der besagenden Worte seine Anwendung erfuhr, gemäß dem es sich auch darüber hinaus ausbreitete, gegen das Prinzip sich die Gegenwehr der Anatomen richtete. Der christliche Glaube repräsentiert die Worte der heiligen Schrift und dies bildet die Grundlage der Ermessung. Tatsächlich erwirkt jedoch das ausführende Händling ein fälschliches Gesicht, da es derer drei Arten zu dessen umsetzenden Präsenz bedingte, nämlich für die allgegenwärtigen Grundlagen des Seins, der Theosophie, zur Übertragung der Worte der heiligen Schriften und damit verbunden, der Worte Gottes, der Theleologie und zur Vermittlung der daraus entstehenden Lehren der Theologie. Zumal man darin auch speziell zwischen dem göttlichen, weltlichen und menschlichen Verhältniswesen unterschied, da es ja doch vor allem auch um die Vermittlung sich dreht, als ein dazwischenstehender Mittler darin zu funktionieren. So trifft man es auch an, daß sich vor allem die Theosophie mit der Philosophie überschnitt und im Nebeneinander, wie auch kombiniert miteinander einher gingen und es sich gar als gravierendes Mißverhältnis stellt, daß die Philosophen gerade dieses Dreiecksverhältnisse gar nicht derart in Betracht zogen. Speziell diese Trennungen ersieht man weitläufig auch nicht, wie auch, daß zwischen Esoterischem und Exoterischem ein gravierender Unterschied besteht, sodaß gerade in dem Bezug auch die Bildnisse darüber weitläufig nicht wirklich die damit einhergehende Aufklärung bewirken. So ist hingegen jedoch dem Glaubenswesen, gemeinsam mit dem Philosophiewesen, auch die Theosophie verlustigt gegangen, zumal dies auch mit der durch die aufkommende Wissenschaft entstandenen generellen Scheidung von Göttlichem und Weltlichem einher ging, hingegen jedoch bereits zuvor innerhalb der Kirche das Scheidungswesen von Theosophie, Theleologie und Theologie, zur beständigen Zerrissenheit führte. Auch hierin wurde indess die reine Vergeistigung zum elementaren Grundstock der Repräsentanz.

Philosophie   Theleologie/Theologie
anima vegetiva spiritus vegetativus
anima sensitiva/sentiens spiritus animalis
anima rationalis spiritus rationalis

So erfährt aber auch die entstandene Philosophie durchweg gar keine Eigenständigkeit, was sich darüber darlegt, daß darin einzig das Verhältnis einer Philosophie des Geistes anzutreffen ist und somit ein relatives Verhältnis des 'Spiritus' des Christenglaubens, über das sie nie hinaus reichten und über die aufkommenden Naturwissenschaften sich gemäß der ausbreitenden Physis und dem Dualismus des einstigen Materie-Energie-Verhältnisses spezifizierend ihre Ausgrenzung erfuhren. Gerade darüber zeigt sich jedoch, daß sie einzig die Worte, aber doch in keiner Weise den griechischen Ursprung übernahmen, denn darin besteht dieses Mißverhältnis eben nach wie vor nicht. Darin repräsentiert die Seele - das Leben - die Substanz und der Körper ist die Form, über die es sich erhält und trägt. Man verdeutliche sich hierzu den Werdegang der Naturwissenschaft, worin diese im Verlaufe selbst die Energie als Materie definiert und man in der Ergründung der Atome letzendlich darin mündete, gar kein materielles Atom ausfindig machen zu können. Darüber kann man sich den Ursprung verdeutlichen, indem man nämlich die Gegebenheiten gemäß Wirkwesensarten in Betracht zieht, welche man gemäß des Wahrnehmungsverhältnisses als substanzielle Objekte erfährt. Die Substanz, welche den Raum erfüllt, ist hingegen nämlich tatsächlich gar nicht wahrnehmbar, da die Wahrnehmung darauf beruht, einzig Wirkungen wahrzunehmen, aufgrund dessen die raumausfüllende Substanz einzig indirekt erfahrbar ist, da sie selbst keine Wirkung ist - und auch nicht enthält, wie man es in der Naturwissenschaft vermutete. Darauf basiert das gesamte Mißverhältnis, welche das Verhältnis zum Substanzwesen bis zur Gegenwart durcheinander bringt, da man nämlich hierin nicht die Funktionalität der Wahrnehmung gemäß der Erfordernis ergründete. Gerade dies ist nämlich einzig über die Ergründung im Selbst, gemäß seiner darin präsenten funktionalen Gegebenheit ergründbar. Und gerade diese introspektive Analyse ist es, die fortwährend systematisch außen vor gestellt wird, obwohl das Selbst gerade den Bestandteil hervorbringt, welcher uns das Sein vermittelt und auch einzig darin in seiner wahrnehmungsgetreuen Funktionalität ergründbar ist. Es ist nämlich nicht das äußere Auge, welches wahrnimmt, sondern dieses Auge vermittelt einzig, sondern es ist das innere Auge, welches ersieht und somit ist es auch ein elementarer Unterschied, was darüber ersehen wird - das Selbst ersieht.

Gerade das Dreiecksverhältnis repräsentiert indess das, worin die Grundlagen bestehen, nämlich das Sein an sich, die Wahrnehmung dessen, worüber wir das Sein über dessen Wirken einzig erfahren und die Vorstellung darüber, welche die Bildnisse liefert, worüber das bestehende Verhältnis über die rein reflektiven Wirkungsverhältnisse hinausgehend erfaßbar wird. Gerade aufgrund dessen, daß der Geist kein Sinnesorgan ist und über die Erinnerung nicht nur eine Kontinuität gespeichert, sondern auch weiterverarbeitet wird, ergibt sich daraus überhaupt eine Erweiterung des Ersichtens des Seins, welches über das rein Sinnengegebene hinaus geht. Hingegen sind aufgrund dessen jedoch auch die Varianten von Glaube, Illusion, Wahrheit und Wirklichkeit die beständigen Begleiter zur Ausbildung des Realitätsverhältnisses. So begründet sich jedoch auch das Verständnis über das Sein primär über das Verständnis von Mensch sein und damit verbunden über das weltliche Dasein. Und indem aus diesem Ausschnitt die Prinzipien in Erfahrung gebracht werden, gelangt man auch über das reguläre Daseinsverhältnis hinaus, zur Sichtung des Seins an sich. Das Sein steckt nämlich gleichermaßen in allem und indem hierin das Verhältnis des Selbst und des weltlichen Daseins seine nebeinander stattfindende Inbetrachtziehung erfährt, gelangt man darüber auch zur Generalität des Seins, woraus es dann ersichtlich ist. Folgendes Prinzip repräsentiert die Klarheit der erlangenden Ganzheitssicht, worüber das Sein als solches ersichtlich ist und auf der Gleichzeitigkeit beruht:

Ich bin Teil des Universums
das Universum steckt in mir

Dieses Faktum zu erfahren, basiert auf dem Erkennen der einzelnen, wie auch den daraus ergründeten generellen Funktionalitäten und Prinzipien, die miteinander kombiniert die sinnliche Wahrnehmung in ihrer regulären Beschränktheit auflösen (Funktionalität und Prinzip bilden hierin die Grundlage des Sichtens), sodaß darüber auch das Sein als solches in seiner gegebenen Präsenz über die Sinne ersichtlich wird. Dies geschieht im Verbund dessen, daß man über das dem gemäße kennende Erfahren des eigenen Selbst auch in des jeweiligen anderen Selbst gelangt. Und somit gelangt man in diesem Verbund auch zum Selbst des Seins in seiner Gänze, worüber sich die Gesamtsicht seiner Präsenz und Inhaltlichkeit ergibt. Aufgrund dessen, daß das Selbst Bestandteil des Seins ist und gleichzeitig das Sein in seiner Präsenz in dem Selbst (wirkend) ist, ist darüber auch das Einheitswesen als solches gegeben, welches darüber auch seine Ersichtung erfährt. Der Kern darin besteht somit auch darin, daß ein Jegliches Subjekt ist und um es 'als solches' zu erfahren, die Subjekt-Objektseparierung aufzulösen ist. Dem gegenüber basiert das Subjekt-Objekt-Verhältnis funktional auf der trennenden Inbetrachtziehung innerer und äußerer Wahrnehmung, zumal rein äußerliche Betrachtungen das Extrem dessen repräsentiert und gar das eigene Subjekt zu ersichten, spezifisch außen vor stellt. Hervorzuheben ist hierin 'das Reguläre' des durch die Sinne erfahrenden Erkennens des Ersehenden und dem daraus sich begründenden nachvollziehenden Verstehens und daraus hervortretenden Erkenntnisse. Im Gegensatz zum Geist, welcher hierin einzig zusätzlich fungiert, ergibt sich das Erkennen der Sinne (bereits) über das Erfahren, gemäß seiner Natürlichkeit der Funktionalität und als Bestandteil des Seins, wohingegen das geistige Erkennen auf dem Wiedererkennen beruht, welches hingegen auf der Reflektion der Erinnerung beruht. Der Geist ist, was die Wahrnehmung betrifft, gemäß der funktionalen Einrichtung, einzig ein zusätzliches mentales Organ und einzig derart erfüllt es auch das Funktionswesen als solches, dem gegenüber speziell dessen Zentrierung, die Wahrnehmungsfähigkeit nicht nur einschränkt, sondern gar gänzlich verklärt. Man wird bezüglich dieser Beschreibung auf das Verhältnis der Handhabeung des Buddhismus stoßen, gemäß dem es sich auch stellt. Hingegen geht es hierin um das (Er)Kennen und die bewußte Anwendung der dahinter steckenden Funktionalität, zumal dies auch fokussierend auf ein Jeweiliges anwendbar ist.

ersehen.jpg

Was gravierenderweise allzu leichtfertig übersehen wird ist, daß gerade über die diversen Vorgänge der Entwicklung, auch eine elementare Selbstfindung des Menschen einher geht, was sich herrausragenderweise vor allem auch über die Renaissance mustergültig darlegt, in welcher man das eigene Erleben und die eigene Erfahrung, als Kontrapunkt dem durch das Schriftwesen Vorgegebenen gegenüber stellt. Wer einmal in diesem Kontext die stattgefundenen Entwicklungen in Betracht zieht, wird genau dieses Kernwesen darin antreffen, in jeglichen Verhältnissen der Umstürze, im Kleinen, wie auch im Großen, indem nämlich in jeglicher Entwicklung Neuanfang, die ideologisch fixierten Vorstellungen und damit verbunden auch in den sogenannten Hochkulturen, die schriftsprachliche Präsenz im Raume stehend, eben nicht die daraus zu erfolgende spezifische Ergründung und dessen Aufklärung erfährt und sich auch die Geschichte sich darin beständig wiederholt. Das Gestaltwesen ist hierin vielmehr auf ein beständiges Tauziehen zwischen den Weltsichten fixiert, dessen Grundlage jedoch die Kontroversität der Wahrnehmung gegenüber der Vorstellung repräsentiert. Und so haben sich auch gerade aus diesem Verhältnis heraus die Naturwissenschaften etabliert, jedoch ohne in Betracht zu ziehen, wie die Funktionalität der menschlichen Wahrnehmung überhaupt funktioniert. Das sie hierin einzig die äußeren Sinne in Betracht ziehen, verschafft keineswegs eine Aufklärung darüber, sondern im Gegenteil, ergibt sich daraus nichts anderes wiederum, wie eine Ideologie.

Die geistige Vorstellung und die damit verbundene Sprache sind generell nur ein Hinweis auf das Sein und beide stehen dem Verhältnis der Wahrnehmung über das Sein gegenüber - sie sind beide nicht das in Betracht ziehende Sein selbst - hingegen begründet sich über die sinnliche Wahrnehmung und das darüber stattfindende Erlangen der Wirkungen aus dem Sein heraus, der direkte Draht zum Dasein des Seins. Wesentlich hierin ist jedoch das fungierende Verhältnis äußerer und innerer Wahrnehmung, worin das Äußere einzig (v)ermittelt, indess es das Innere ist, worüber die Reflektierung und darüber überhaupt erst das erlebende Wahrnehmen stattfindet. So ist das äußere Auge, welches uns über die Lichtreflektionen die entsprechenden Bildnisse vermittelt, nichts anderes, als ein Fernglas, mit welchem wir sehen. Das tatsächliche Ersehen findet indess über den Bewußtsinn - das Innere Auge - statt und bedingt sich vor allem auch über das Steuern der Aufmerksamkeit, sodaß man auch etwas mit den äußeren Augen ansehen kann, ohne es tatsächlich zu ersehen. Und auch was man darüber ersieht, entspricht nicht all dem, was das äußere Auge aufnimmt, sondern darüber ergeben sich relative Ausschnitte dessen, gemäß dem man es auch erlebend dem entsprechend erfährt. Insofern man sich somit rein auf die Funktionalität der äußeren Augen bezieht, ersieht man darüber in keiner Weise, wie es sich im Inneren damit stellt, zumal das reflektive Wirken hierin ausschlaggebend ist, was sich darauf ergibt.

So ist es denn auch dergestalt, daß man in der Ergründung des Seins ein nachvollziehendes Verständnis überhaupt erst einmal ausbilden muß. Und insofern wer zu einem Solchen gelangt ist, bedingt es anderen, dies gemäß dem auch nachzuvollziehen. So ist Derjenige, welcher den speziellen Bezug zur Seele ergründete und darüber Bildnisse begründete, Aristoteles gewesen, sodaß sich hierüber ein spezifisches Maßwerk heraus ergibt, worüber man das Verhältnis der einstigen Anatomie dessen ermessen kann. Inwiefern hat jedoch überhaupt wer Aristoteles' Aufbringen gemäß des Seinigen nachvollzogen? Über Salatowsky erfährt man eine spezielle Inbetrachtziehung dessen, worüber sich vor allem jedoch verdeutlicht, daß die Sache selbst rundum doch gar nicht die Grundlage bildet, sondern die Grundlage (und somit wiederum die Ideologie) die Ersichtung der Sache vorgibt. So existieren auch dem gemäß unzählige Wiedergaben ein und desselben. Und doch läßt sich aus dem Ursprung das Aufgebrachte selbst ermitteln, indem man die diversen Aufbringen nebeneinander stellt und sich gerade darüber ebenfalls wiederum das Selbst erhellt, aufgrund der Inbetrachtziehungen aus den diversen Warten heraus. Und im Bezug ist es maßgeblich auch das Substanzverhältnis, welches man diesem gegenüber stellt, ohne tatsächlich den Kern dessen zu erkennen, welcher sich nämlich wahrlich erst über das Verständnis der menschlichen Wahrnehmung heraus ergibt.


Die Rezeption der aristotelischen Psychologie
im 16. und 17. Jahrhundert

Verlag: B. R. Grüner

S. 99: Amerbachs Verständnis für des Entelechiebegriffs

Amerbach beginnt die Erörterung der Seelendefinition mit der gewichtigen Frage, ob Cicero mit seiner Deutung der έντελέχεια als ένδελέχεια den Aristoteles mißverstanden habe. Um diese Frage zu beantworten, versucht er die originäre Ansicht des Aristoteles über die Seele zu ermitteln, dessen Definition er unter Hinweis auf De An. II 1, 412a19-21 sowie 412a27f. wie folgt paraphrasiert: "Die Seele ist daher Substanz als Form, oder sie ist die erste Vollendung eines natürlichen, mit Organen versehenen Körpers, der in Möglichkeit Leben hat." Anders als Melanchthon nimmt Amerbach damit auf korrekte Weise Ausgang vom Begriff substantia (ούσία), die er unter Hinweis auf De An. II 1, 412a6-10 genauer als forma (είδοζ) bzw. als 'actus primus' (έντελέχεια) bestimmt. Dabei läßt er keinen Zweifel daran, daß das Wort έντελέχεια eine 'perfectio' bezeichnet und von Themistius (sic!) richtig von τέλοζ & έχειν hergeleitet worden ist.

Im Wissen um die vielfache Bedeutung des Begriffs ένέργεια fügt Amerbach sogleich hinzu, daß die Gleichsetzung mit dem Begriff έντελέχεια nur dann gerechtfertigt ist, wenn sie gerade 'nicht' als 'motio', sondern als 'perfectio' verstanden wird. Perfectio beschreibt nämlich einen Zustand, in dem ein Ding sein Ziel in sich enthält. So ist die Seele Vollendung eines Lebewesens, ohne der es ein solches gar nicht wäre, es sei denn auf bloß homonyme Weise. Denn als 'forma' beseelt sie das Lebewesen, gibt ihm sein Sein, das sich in seiner Gestalt (είδοζ) kundtut.

Diesen Prozeß, so Amerbach, nannte Aristoteles genauerhin 'actus primus', denn ein Lebewesen sei auch dann beseelt, wenn es nicht aktuell tätig sei im Sinne des 'actus secundus'. Amerbach erklärt diese Differenzierung zwischen den beiden unter Hinweis auf De An. Il 1, 412a22-27, wo Aristoteles die Entelechie zum einen mit der Wissenschaft (ωζ έπιστήμη) und zum andern mit dem aktuellen Vollzug von Wissen (ωζτό θεωρείν) vergleicht. Hieraus folgert er, daß die Seele offensichtlich eine έντελέχεια im Sinne der Wissenschaft als ein Habitus ist. Wie dies zu verstehen ist, verdeutlicht er mit einer zweiten Analogie: Mit dem Dasein der Seele gibt es auch Wachen und Schlafen. Dabei ist das Wachen dem Vollziehen von Wissen vergleichbar, der Schlaf der Wissenschaft als Hexis ohne Vollzug (μή ένεργείν, 412a26). Früher aber der Entstehung nach ist die Wissenschaft. Aus diesem Vergleich ergibt sich nun, daß die Seele eine έντελέχεια ή πρώτη ist, d. b. ein Zustand (habitus), in dem ein Lebewesen gleichsam untergründig sein Telos in sich enthält, ohne 'actualiter' tätig sein zu müssen. Die Seele ist dergestalt, so Amerbach, Quelle und Prinzip aller Tätigkeiten, eben 'actus primus'. Das bedeutet auch, daß die Seele Prinzip der Bewegung ist, nicht die Bewegung selbst, wie bereits Aristoteles gegen Plato betont habe (vgl. De An. I 3) und wie erneut gegen Cicero betont werden müsse. Vielmehr sei die Seele unbeweglich, wie aus De An. II 4, 415b9ff. ersichtlich sei. Folglich sei jener Starrsinn, der sich noch heutigentags auf die ciceronianische Schreibweise der ένδελέχεια berufe, obwohl die Codices allesamt έυτελέχεια überliefern, zu bekämpfen.


Transformationen zwischen Renaissance-Aristotelismus und Frühaufklärung
Verlag: frommann-holzboog

"Das bedeutet auch, daß die Seele Prinzip der Bewegung ist, nicht die Bewegung selbst"

Hierzu gilt es mir, meine persönliche Ergründung des Seins, auf den Punkt gebracht, an dieser Stelle wiederzugeben, dessen Umfänglichkeit ich über mein » 2.Buch « darlege und im » 1. Buch « den Kern des Ganzen veranschaulische. Ausgangspunkt der Ergründung war zum Einen die Präsenz der Auswirkungen meiner mentalen Veranlagungen, worüber sich die diversesten Widrigkeiten mit meiner personellen Umwelt ergaben, sowie auch maßgeblich die entstandenen Auswirkungen damit verbundener Lebensumstände, welche letztendlich mein über das Erleben erfahrenes Grundprinzip über das Sein - die Realität - gänzlich in Frage stellte. Als das, woraus dies resultierte, erwies sich der Umstand, daß man gar allgemein die Wahrnehmung aus der (von anderen übernommenen) Vorstellung heraus abbildet und nicht, wie es sich regulär ausbildet, aus der Wahrnehmung heraus die Vorstellung ausbildet. Speziell aus dem Grund stellte ich auch die Lehren grundsätzlich als solche zunächst außen vor. Und darin besteht auch der wesentliche Unterschied meines Aufbringens, zu dem ich heute Parallelen ergründe, die sich immer weiträumiger auch ergehen. Elementar war hierin, daß ich rein pragmatisch mein Selbst ergründete, wie dies in mir drinnen funktioniert und aufgrund welcher Umstände dessen Funktionsweise zu jener Zeit gestört wurde. Ausgangspunkt und auch im Verlaufe sich fixierende Grundlage, wurde spezifisch die Funktionalität, worüber sich 'ein Etwas' als solches darbietet (gemäß Werden, Sein und Vergehen nämlich). Jegliche Einheit des Seins, welche man antrifft, weist eine ganz spezifische Funktionalität auf, anhand dessen man dies auch generell unterscheidet, mit dem wesentlichen Unterschied, daß man dem dies als Eigenschaft zueignet, welche diesem hingegen gar nicht gegeben ist (was sich nämlich über Werden, Sein und Vergehen in aller Klarheit aufweist - im Gegenüber zur Funktionalität!). Zum Anderen sind jedoch die funktionalen 'Instrumente', welche man über das Innenerleben erfährt, gar nicht als solche ersichtlich, sondern einzig deren Wirken und deren Spezifikation ergibt sich über die Differenzierung der jeweiligen spezifischen Funktionsweise (Geist, Bewußtsinn, Erinnerung, Instinkt, mentale Veranlagungen). Und derart nennt man sie auch allgemein bei ihren bezeichnenden Namen 'gemäß' ihrer subtanziellen Präsenz! Beim Vergleich mit dem äußeren Sichten ergab sich mir Gleiches, denn auch bezüglich eines Steines, gelangt nicht dieser zur Wahrnehmung, sondern einzig dessen reflektierenden Wirkungen. Dieser kann als solcher gar nicht in die Wahrnehmung gelangen, sodaß sich spezifisch aufgrund der Funktionalität der Wahrnehmung überhaupt das Ganze aufklärt. Hierüber sind nämlich einzig Wirkungen wahrnehmbar und ist unser einziger Bezug des erlebenden Erfahrens des Seins! Dahinter steht nämlich das Prinzip des Seins, worin der substanziell erfüllte Raum durch die Zeit mit Bewegung erfüllt ist und sich darin die Einheiten gemäß präsenter funktionaler Prinzipien erfüllen (erfüllter Raum ↔ Bewegung ↔ Funktionalität!). Das jeweilige Selbst der Konstanz einer Einheit ist ein Bündniswesen dessen, welches entsteht und vergeht, gemäß seiner Vereinigung dessen. Die als solche erfahrende Körperlichkeit indess, ist gegenüber den reinen Wirkwesen, welche auch unabhängig davon als Wirksubstanzen existieren, ein Verbund der Wirkungseinheit mit der raumausfüllenden Substanz (Seele & Körperlichkeit). Und so ist auch die Seele einzig lebendig und als solche präsent, gemäß dem sie dem Funktionalitätsprinzip entspricht, in seinem Verbund mit der Körperlichkeit, in dessen Verbund man deren Eigenschaftswesen bestimmt.

Dem gegenüber ist, gemäß Salatowsky's Wiedergabe einmal verdeutlichend, die Inbetrachtziehung der Praktiken der Philosophie aus was heraus überhaupt gegeben? Worüber findet deren Ersehen statt? Tatsächlich ist es bei diesen gar nicht Thema, worüber dies überhaupt stattfindet, sondern der einzige Bezug ist das, 'was' hervortritt und wahrgenommen wird und dies ändert sich auch nicht in den weiteren Entwicklungen bis in unsere Zeit. So steckt gerade in der Unterscheidung von Entelechie und Endelechie des Wesens Kern und man hat das Prinzip vor Augen. Und doch kann man es nicht ersehen, was darauf beruht, daß nämlich die Vorstellung darüber gar nicht auf die Wahrnehmung übertragbar ist, da man die in Betracht ziehende Seele als solche auch gar nicht ersehen kann. Und so findet gar über Locke eine detaillierte und ausgiebige Beschreibung der Unterscheidung von Wahrnehmung, Erinnerung und geistiger Vorstellung statt, worüber dieser das Überbewußtsein darlegt, jedoch bezieht dieser sich darin auf ein 'Cabinet', ohne dabei zu erachten, daß diese gravierenden funktionalen Unterscheidungen doch darlegen, daß es ein jeweiliges Anderes ist, was es hervor bringt. Und so ist auch nicht verwunderlich, daß man sein Cabinett ins Deutsche als Seele übersetzt, was das Wesentliche darin ausmacht, was man in der deutschen Übersetzung aber gar nicht vermittelt bekommt. Und auch Ludwig Büchner's Aufbringen von Kraft und Stoff zerfällt an der Infragestellung, ob nun die Kraft 'das Bewegende' sei oder ebenfalls eine Substanz, gemäß des Stoffes. Überall trifft man auf die Fragmente, die doch an sich bereits in sich erklären, wie es sich damit verhält. Und doch läßt es sich 'daraus' nicht ersehen und wird einzig zum Streitpunkt, da all dem das Elementare fehlt, nämlich worüber die innere Wahrnehmung überhaupt zustande kommt und es als solches ersichtlich wird.

Für das weitere Aufzeigen gilt es sich vor allem diesen zentralen Aspekt der zwischenzeitlich einzig noch auf den wissenschaftlichen Fundierungen bestehenden Präsenzen sich zu verdeutlichen. Gerade dies stellt nämlich das Innenerleben, wie wir es in unserem persönlichen Selbst erfahren, darüber gänzlich außen vor, zumal dies generell als eine rein geistige Erscheinung erachtet wird, dem gegenüber jedoch unser Gefühlsleben gar keine geistige Erscheinung ist, sondern im Gegenteil, kann dies im Geiste gar nicht in Erscheinung treten, außer als eine Versinnbildlichung, warum es auch einzig derart überhaupt seine Erachtung findet. Während in den philosophischen Verhältnissen zwar die Ergründung aus dem Selbst heraus die Grundlage bildet, so ist dieses Selbst hingegen über die äußeren Augen gar nicht ersichtlich und somit auch nicht Bestandteil wissenschaftlicher Einsichten. So basiert auch die philosophische Eingrenzung indess auf den Geist, dem gegenüber die wissenschaftlichen Vereinnahmungen sich hingegen auf das den Augen Ersichtliche und somit die Äußerlichkeiten beschränkt. Die Entbehrung, mit welcher man aufgrund dessen konfrontiert ist, basiert somit vor allem darauf, das für die diversen Wirkwesen, welche unser Innenerleben aufweisen, nie eine spezifizierende Ergründung stattfand. Die Mentalität, welche nicht nur das Kernwesen der sexuellen Differenzierungen ausmacht, sondern auch unseren Charakter und die Vielfalt unserer Begabungen repräsentiert, sind veranlagte Gegebenheiten, die weder des Geistes, noch der körperlichen Gegebenheit entspringen, sondern mit dem Instinktiven und Intuitiven einher gehen, als angeborener Bestandteil unseres Unterbewußtseins. So sind indess speziell die wissenschaftlichen Errungenschaften jedoch dem gegenüber darin förderlich, das Körperlich-Physische davon zu separieren, worüber es vor allem auch die Klarheit darüber verschafft, innerhalb dessen Rahmen man sich darin befaßt. Nachfolgend einmal ein Bildnis, worüber sich das Prinzip darlegt und das Verhältnis des Inneren und Äußeren sich verdeutlicht.

Würfel

Zentrale Bewandtnis der Innensichtung ist die Differenzierung der jeweiligen spezifischen Funktionalität, gemäß dem diese sich als solche repräsentieren und die Voraussetzung, daß es für das Jeweilige ein jeweiliges entsprechend Spezifischen bedingt, was es hervor bringt. Bewußtwerdende Wahrnehmung, Erinnerung und geistige Vorstellung, sind die drei funktionalen Gegebenheiten, welche man im Überbewußtsein antrifft und dem gemäß handelt es sich hierbei um das Hervorbringen durch Bewußtsinn, Erinnerung und Geist. Erst in Anbetracht dessen, ergibt sich überhaupt erst das reguläre Erfahren und darüber auch die Ersichtung des Weiteren. Man verdeutliche sich hierüber, daß aufgrund des reinen Geistbezuges die Gegebenheiten als solche gar nicht ihre erforderliche Sondierung und somit auch Ersichtungen erfahren können. So wird man auch in jeglichen Inbetrachtziehungen einzig das Bewußtsein, jedoch nicht die Bewußtwerdung antreffen, was hingegen über das Zirkelwesen von Bewußtsinn, Erinnerung und geistiger Projektion einher geht. Gleichfalls tritt darüber auch nicht die klare Unterscheidung von Wahrnehmung und Vorstellung als solche hervor, die einzig über diese Differenzierung als solche ersichtlich wird. Elementar ist indess vor allem auch das Empfindungs- und Gefühlswesen, welches einzig über den Bewußtsinn hervortritt und als solches weder in die Erinnerung und den Geist gelangen, sodaß vor allem auch darüber sich die eigentliche Klarheit ergibt. Maßgeblich hierin ist vor allem die Perspektive, aus der heraus man die Gegebenheiten in Betracht zieht und so verschiebt sich dies auch in Richtung Geist, insofern man es nicht spezifisch als solches sondiert aus dem Bewußtsinn heraus in Betracht zieht. Die Grundlage basiert dem gemäß auch auf der Unterscheidung von Wahrnehmung und Vorstellung, worüber auch die Vorstellung ihre erforderliche Separierung erfährt. Zu dem gilt es sich zu verdeutlichen, daß es sich dabei um Projektionen aus der Erinnerung handelt und somit ist dies auch in seiner Eindeutigkeit der Unterscheidung als solches ersichtlich.

Bewußtsinn

Maßgeblich hierin ist vor allem auch die Zweiseitigkeit, welche sich hierin funktional ergibt, denn einzig in der bewußtwerdenden Wahrnehmung sind auch die Sinnlichkeiten mit enthalten, wohingegen in die Erinnerung einzig Versinnbildlichungen dessen gelangen und somit auch im Geiste als solche nicht in Erscheinung treten. Im Verbund mit der Sprache tritt hierüber ein gravierender Gegenseitigkeitseffekt auf, aufgrund dessen eine sich trennende Zweiseitigkeit auftritt, die als solches ja nicht Einheit sein können. Um somit speziell sein Selbst bezüglich der mentalen Veranlagungen über die Reflektionen der Wirkungen zu erfahren, bedingt es somit auch der speziellen wahrnehmungsgemäßen Ausrichtung seiner Aufmerksamkeit darauf, in seiner Gegenüberstellung und Abgrenzung zu den geistigen Präsenzen. Hierin besteht somit auch ein grundsätzliches Mißverhältnis gegenüber der erforderlichen Differenzierung von Wahrnehmung, worin speziell das im Geiste Erscheinende gar keine Wahrnehmung ist, sondern auf der Projektion aus der Erinnerung heraus beruht. Auch ist das, was die Augen an Lichtreflektionen vermitteln, kein sinnlicher Vorgang, worin ebenfalls keine sinnliche Erregung einher geht, dem gegenüber man jedoch Wahrnehmen und Empfinden als Eines erachtet und darin nicht dies voneinander trennt. Und auch zwischen dem Empfinden und den Gefühlen besteht ein gravierender Unterschied darin, aufgrund dessen, daß Letzteres auf den Reflektionen der inneren Sinne beruht und nicht auf dem, was die Physis der Nerven vermitteln. Maßgeblich hierin ist jedoch vor allem, daß der Bewußtsinn als solcher unbekannt und unbedacht ist, man dem gegenüber jedoch alles miteinander als Eines in Betracht zieht, wohingegen gerade es sich in diesem einzig als derart repräsentiert. So ergibt sich nämlich überhaupt erst aufgrund des außen vor stehens, dieser spezifischen Gegebenheit, daß man es aus dem Grund auch daraus heraus nicht ersehen kann, da es sich einzig auch sondiert. So findet denn tatsächlich auch die Perspektivenschau regelrecht aus dem Geiste heraus statt, ohne zu bemerken, daß man darin einzig dessen Reflektionen erachtet und stellt darüber das Sinnliche als Unbewußtes Sein darin hinter sich, sodaß man es nicht in seiner klaren Präsenz ersieht. Dreht man sich indess herum und fokussiert speziell das Sinnliche, wird es jedoch darüber ersichtlich, wie es sich darin verhält. Das Erfahren des eigenen Selbst ist somit auch abhängig davon, inwiefern man seine Aufmerksamkeit daraufhin einrichtet.

Gerade dieser Part des Mentalen des Selbst, ist wie sich aufweist, jedoch generell außen vor gestellt. Sowohl die Philosophie, wie die aus dieser hervorgegangenen Psychologie, vor allem die Naturwissenschaften unabdingbar, stellen als Grundsatz die sogenannte Introspektion außen vor, mit der zentralen Begründung, dies sei rein subjektiv, nicht objektiv erfaßbar und für die Ergründung der Objektivität somit nicht zu verwenden. Das diese damit allesamt eine Objektivität darüber abbilden, welche das Subjekt nicht beinhalten, ist eine Sache, denn auch der Objektivität bedingt es, zur Ergründung des Daseins. Das der Mensch jedoch nicht bemerkt, wie ihm darüber geschieht, ist ein ganz anderer Umstand, vor allem wenn dieser sich darüber seinem Selbst gegenüber distanziert und dies gar zur Ablehnung seines Selbst führt. Darauf basiert nämlich auch der Umstand, daß immer mehr Menschen ihr Selbst gar nicht mehr wahrnehmen, aufgrund der Nachahmung dessen, was darauf basiert, daß sich das Selbst aufgrund dieser Handhabe reflektiv dem verschließt. In der weiteren Ausführung geht es somit auch spezifisch darum aufzuzeigen, was man überhaupt in Betracht zieht und dem gegenüber nicht. So gilt es hierin auch auf das zuvor ausgeführte Prinzip zu achten, worüber sich das Naturwissenschaftliche spezifiziert, nämlich das sie das hervorbringen, was den Augen ersichtlich gemacht werden kann. Und somit bezieht sich dies auch einzig auf das 'physische Geschlechts- und Fortpflanzungswesen', separat zu den geistigen Erscheinungen. Die Statuierung der 'sexuellen Orientierung' weist auch spezifisch darauf hin, daß gemäß der 'Orientierung' es sich rein um das geistige Verhältnis darin dreht und eben nicht, was einzig angebliche Thematik darin ist, die veranlagte Präsenz. Gerade dies stellt sich indess als das Sexualwesen, welches zum Einen sich als ein eigenes Wirken erweist, jedoch auch das Zentrale, worüber sich auch das Geschlechts- und Fortpflanzungswesen umsetzt und somit sowohl des jeweilige Eigenwirken, wie auch das kollektive Gesamtwirken als solches, seiner Erachtung bedingt, um als solches auch wahrgenommen zu werden. Dem gegenüber handelt es sich im Geistigen um die sexuelle Identität, welche gerade sich darüber ergibt, gemäß dem dies seine Inbetrachtziehung und Erachtung erfährt.

Über nachfolgendes Bildnis noch einmal verdeutlicht, welches Substanzwesen man über die Innenschau antrifft. Neben dem, was die einzelnen Wirkwesen darin als Eigenart an Funktionalität hervorbringen, was man über die Unterscheidungen der Wirkwesen auch als Einziges als solche erkennt, ist vor allem auch der Verlauf der Wirkungen und deren Wandlung und Reflektionen das Wesentliche darin. Die sexuelle (mental veranlagte) Konstitution ist Bestandteil des Unterbewußtseins und erfährt mit dessen Wirkwesen verbunden seine Umsetzung, sodaß es über das instinktive und intuitive Erwirkungswesen hervortritt, gemäß dem es auch spezifisch über die Gefühle und das Handlungswesen erfahren wird. Dem gegenüber ist die geistige Vorstellung darüber ein substanziell sich davon Unterscheidendes, wie auch die Physis, welche sich hingegen über die Körperlichkeit repräsentiert. Das Mentalwesen, welches hierüber seine Abbildung erfährt, bezieht sich konkret auch auf das, was einzig über das Innenerleben erfahrbar ist, worüber sich auch dessen Eigenart gegenüber dem physisch-Körperlichen derart stellt. Als solches stellt es sich als Bestandteil der Inbetrachtziehungen der Seele, wohingegen es derart in keiner Weise irgendwo seine Erachtung findet. Vielmehr entspricht jedoch auch die Präsenz und das Wirken hingegen den Organen des Körperlichen, gemäß dem es sich auch mentale Organe nennt und darauf auch beruht, daß es die Mentalität ausmacht, was darüber seine Präsenz erfährt.

Bewußtsinn

Nachfolgend die erweiterte Detaillierung: bezüglich der äußeren Sinne besteht noch eine weitere Differenzierung der Wahrnehmung, nämlich zwischen den Sinnen, welche in ihrer Funktion Wirkungen, gemäß ihrer spezifizierten Einrichtung aufnehmen und weitervermitteln (wahrnehmen), gegenüber den Sinnen, bei welchen gemäß ihrer Funktion Wirkungen auf Sinnesreize übertragen werden, welche weitervermittelt werden (empfinden). Die vermittelnde Wahrnehmung gelangt direkt zum Bewußtsinn und erst darüber zum Instinkt, wohingegen die Empfindungsreize zunächst zum Gehirn und hiernach zum Instinkt gelangen, wonach die Reflektionen dessen über den Bewußtsinn erfahren werden. Aufgrund dieser Reflektion erwirkt dies auch den Wandel der ursprünglichen reinen Reize relativ des Wirkungsgrades der Reflektierung das daraus Hervortretende eines Harmonie- und Disharmonieverhältnisses, was man dem gemäß als Gefühle erfährt. So verfügen unsere Augen über beiderlei, dem Empfindungssehen und dem Wirkungssehen, wobei in Ersterem die Lichtreize als solche in Empfindungsreize übertragen werden und dem eigentlichen Sehen, worin die Lichtbildnisse als solche vermittelt werden, sodaß eine schattenmäßige Erscheinung instinktive Reflexe bewirkt, indess wenn die Bildnisse maßgeblich sind zur Ermessung, zunächst das Lichtbildnis über die Bewußtwerdung in Erscheinung treten muß, bevor eine Reaktion daraufhin stattfinden kann. Das Unterbewußtsein ist der Bereich (in der Bauchgegend), in welchem sich der Instinkt, die Langzeiterinnerung, sowie die mentalen Veranlagungen befinden und im Überbewußtsein (im Kopf) befinden sich der Bewußtsinn, die überbewußte Erinnerung und der Geist. Wie man dem entnehmen kann, sind sowohl die funktionalen Einheiten als solche, wie auch der Verlauf der Wirkungen hierin maßgeblich, bezüglich des Nachvollzuges der Vorgänge.

Bewußtwerdungsbezug

Was die institutionellen Verhältnisse betrifft, so hat man darin Prinzipien eingerichtet, worüber dieses Selbst zum Einen als solches außen vor gestellt wird, zum Anderen jedoch im Bezug der Wissenschaft gar nicht Erachtungsgegenstand sein kann. Es gilt gar hervorzuheben, daß die Relevanz des Maßstabes des Augenersichtlichen eine wesentliche Errungenschaft ist, würde man sich indess auch darauf beschränken. Tatsächlich erweist sich nämlich das Gehirn, gleich dem Überbewußtsein, rein als eine evolutionäre zusätzliche funktionale Erweiterung, welche zu dem Zentralsystem hinzu gelangte. Die Evolution führt uns gerade im Bezug auf das Gehirn, dieses Präsenz- und dessen Funktionsverhältnis unmißverständlich vor Augen, daß das Primäre nicht vom Gehirn ausgeht. Und auch die Pathologie hatte bereits vor über hundert Jahren, aufgrund ihrer ergründenden Erfahrungen, die Lokalisationslehre, zumal die im Gehirn, gänzlich verworfen. Der Punkt ist, daß einzig erklärlich ist, was ersichtlich ist und alles andere sich als wilde Spekulation erweist. Wie bereits erläutert, erfährt gerade aus der Innensichtung heraus auch so einiges damit Verbundene der Physis seine erfahrende Sichtung, sodaß auch im Bezug auf das Verbundswesen mit der Physis sich über diese Verbundenheit, vielfältiges an Aufklärung daraus ergibt. Hingegen bedingt es gleichermaßen auch hierin der Voraussetzung, sich auf das zu beziehen, was durch das Innere Auge ersichtlich ist. Und insofern man sich auf die Wahrnehmung der Wirkungen bezieht, was die Grundlage ist, was der Wahrnehmung ersichtlich ist, so gelangt man darüber auch zur Allseitssicht.

Philosophie/Psychologie, Wissenschaft und das Meinige im Nebeneinander

Divider

Der Geschlechtswandel

Divider

Bezüglich der Darstellungs- und Inbetrachtziehungswesen, welche man über die Geschichte in seiner Abbildung erfährt, gilt es hervorzuheben, daß der Bezug zu den Geschlechtsorganen sich gar nicht als solcher isolieren läßt, wie die Präsenzen es über die Darbietungen vermitteln, da dies unmittelbar mit den Ausscheidungsorganen verbunden ist. Gerade dies erfährt markanterweise überhaupt nicht seine Erachtung, obwohl es ein untrennbarer Umstand ist. Zieht man hierzu ethnische Vergleiche in Betracht, so trifft man nicht nur in den diversen Hochkulturen, auf einen wohlgeschätzten Grundsatz darin, sondern weitläufig auch in indigen und urstämmigen Kulturen. Wie man erfährt, so war im alten China gar aufgrund der eindringlichen Reinigungshandlungen das Jungfernhäutchen unbekannt, da es dadurch bereits im Kindesalter seine Zerstörung fand. Und auch in anderen Kulturen, war und ist es weitläufig Brauch und Sitte, für eine besondere hygienische Reinlichkeit, wie überhaupt der Pflegegebräuche des Geschlechts Sorge zu tragen. Hingegen ist selbst heutzutage, hierzulande die Genital- und Afterreinigung nach wie vor nicht regulärer Brauch und Sitte und wenn, dann aus eigenem Verhältnis heraus zur gewöhnlichen Reinigung, jedoch in keiner Weise eine Regel, nach dem Urinieren und dem Stuhlgang, wie auch nicht vor dem Geschlechtsverkehr. Es mag wohl auch damit zusammenhängen, daß es aufgrund des fehlenden Bewußtseins, dem gemäß weitläufig nicht seine Darbietung und Sichtung erfährt, jedoch verdeutlich sich auch hierüber mustergültig die systematisch stattfindenden eingegrenzten Sichtweisen, welche man regulär antrifft, in seiner unübersehbaren Deutlichkeit - und DAS ist es auch, was es zuvorderst zu verdeutlichen gilt - man erfährt wahrlich reinstes Scheuklappensichten - und gerade dies führte zu den diversen Unverständlichkeiten, die zuvor gar nicht existierten, indem es nämlich erst gar nicht in Frage gestellt wurde, sondern man es lebte!

So ist denn auch die ganze Entwicklung, wie sie sich bereits über den Begriffswandel darlegt, daraufhin eingerichtet, das Geschlecht als solches, gegenüber seinem Einheitswesen zu isolieren. Man trifft in den Jahrunderten, von der Renaissance ausgehend, nicht nur auf eine systematische Atomisierung dessen, was das Geschlecht ausmacht, sondern vor allem auch auf den Sachstand, den Atomkern dessen auszumachen. Indess gelangt man, gemäß der Atomwissenschaft letztendlich zu dem, daß gar kein Atom existiert, sondern das Ganze anders funktioniert, man indess gerade dies nicht nachvollziehen kann. Dem gegenüber gilt in beiden Fällen: es ist dem Auge nicht ersichtlich zu machen, da die Wahrnehmung darauf beruht, rein Wirkungen wahrzunehmen und nur DAS kann darin auch zu erachtender Bestandteil sein. Indess wendet man sich jeweils von dem zuvor Wahrgenommenen ab, um in einem anderen Bezugsfeld das Entsprechende zu finden und landet letztendlich gar in dem Wahnsinn, die geschlechtliche Differenzierung aufzulösen, da man keine solche 'explizit' findet. Was die Jahrhunderte indess hervorbringen, ist die Darlegung der menschlichen Individualität und DAS ist es, was hierin zählt.


Vierter Band
Verlag: G. Reimer
» «

Ueber den Geschlechtsunterschied und dessen
Einfluss auf die organische Natur(» S. 270 «)

Von der Wichtigkeit des Endzwecks erfüllt, welchem der Unterschied der Geschlechter zunächst gewidmet ist, pflegt man die Bestimmung derselben auf ihn allein zu beschränken. Man nimmt ihn unmittelbar mit in den Begriff derselben auf, denkt sich unter dieser Anstalt der Natur weiter nichts, als ein zur Erzeugung nothwendiges Mittel, und würde, wenn diese auf einem andern Wege zu erhalten wäre, einen Unterschied leicht entbehren zu können glauben, der die Entwicklung der Gattung in den Individuen nicht selten zu hindern scheint. Nur allenfalls im Menschen wird auch die gemeinste Beobachtung mehr auf die heilsame Einwirkung des einen Geschlechts auf das andere aufmerksam gemacht. Allein auch in der übrigen Natur ist diese Erscheinung nicht weniger sichtbar, und es bedarf nur einer mässigen Anstrengung des Nachdenkens, um den Begriff des Geschlechts weit über die beschränkte Sphäre hinaus, in die man ihn einschließt, in ein unermessliches Feld zu versetzen. Die Natur wäre ohne ihn nicht Natur, ihr Räderwerk stände still, und sowohl der Zug, welcher alle Wesen verbindet, als der Kampf, welcher jedes einzelne nöthigt, sich mit seiner, ihm eigenthümlichen Energie zu waffnen, hörte auf, wenn an die Stelle dieses Unterschiedes eine langweilige und erschlaffende Gleichheit träte.

Das Streben der Natur ist auf etwas Unbeschränktes gerichtet. Alles Grosse und Treffliche, was in endlichen Kräften wohnt, will sie, ohne Ausnahme, und zwar in ein Ganzes vereint, besitzen. Aber da diese Kräfte immer endlich und an die Gesetze der Zeit gebunden sind, so hebt die eine, sofern sie thätig ist, die andre auf, und es ist nicht möglich, dass sie alle zugleich wirken. Diess gilt aber nicht bloss von ihren einzelnen Kräften, sondern überhaupt von ihren beyden hauptsächlichsten Wirkungsarten, der Ausbildung des Einzelnen, und der Verbindung des Ganzen. Denn indess die Kraftübung Einseitigkeit hervorbringt, auf die auch die Beschaffenheit des Stoffs führt; so verlangt die verbindende Form Vielseitigkeit, und die eine Forderung vernichtet in dem Augenblick, da sie geschieht, nothwendig die andre. Wenn also, bei allen Schranken der Endlichkeit ein unendliches Wirken zu Stande kommen sollte, so blieb nichts anders übrig, als die zugleich unverträglichen Eigenschaften in verschiedene Kräfte, oder wenigstens in verschiedene Zustände derselben Kraft zu vertheilen, und sie nun durch den Drang eines Bedürfnisses zu gegenseitiger Einwirkung zu nöthigen. Diese beyden Merkmale sind aber gerade auch die einzigen, welche der Geschlechtsbegriff in sich fasst. Denn, geht man auch, um denselben aufzufinden, wie er sich wirklich in der Natur zeigt, am besten von dem Begriff der Zeugung aus, so kann man ihn doch auch, ohne alle Rücksicht auf diese in seiner völligen Allgemeinheit fassen; und alsdann bezeichnet er nichts anders, als eine so eigenthümliches Ungleichartigkeit verschiedener Kräfte, dass sie nur verbunden ein Ganzes ausmachen, und ein gegenseitiges Bedürfnis diess Ganze durch Wechselwirkung in der That herzustellen.

Denn in der Wechselwirkung allein beruht das Geheimnis der Natur. Ungleichartiger Stoff verknüpft sich, das Verknüpfte wird wiederum Theil eines grösseren Ganzen, und bis ins Unendliche hin umfasst immer jede neue Einheit eine reichere Fülle, dient jede neue Mannigfaltigkeit einer schöneren Einheit. Stoff und Form, so vielfach ineinander verschränkt, vertauschen ihr Wesen, und nirgends ist etwas bloss bildend oder gebildet. So erhält die Natur zugleich Einheit und Fülle, zwey scheinbar entgegengesetze, aber nah verwandte Eigenschaften, deren eine dem Geist wohlthätige Ruhe gewährt, wenn ihn die andre zu thätigen Nachdenken angespannt hat.

Von dem zauberähnlichen Wirken dieser zahllosen Kräfte erstaunt, verzweifelt der menschliche Geist, je in diess heilige Dunkel zu dringen. Dennoch fühlt er sich durch seine Natur aufgefordert, es zu versuchen. Soll nun der Versuch nicht gänzlich misslingen, so wene er seinen Blick von dem Zusammenfluss der Wirkungen ab auf die vereinzelten Kräfte. Was dort durch vielfaches Eingreifen in fremder und mannigfaltig verschiedener Gestalt erscheint, sieht er hier, vereinzelt, in seiner eigenthümlichen wieder. Denn jede Verbindung in der Natur geht aus der innren Beschaffenheit der Wesen hervor, und ihr stilles Wirken unterbricht keine eigenmächtige Willkühr. Was sich mit einander vereinigt, trägt in seinem Wesen selbst das Bedürfnis dieser Vereinigung; und alle Erscheinungen der Natur bestimmt der Charakter der wirkenden Kräfte. Ist indess der Weg auf diese Weise vereinfacht, so darf man ihn nicht zugleich auch erleichtert nennen. Sehr schwierig ist es, diesen verborgenen Charakter zu erspähen, der nicht in dem Inbegriff der, oft nur zufälligen Aeusserungen eines Dinges besteht, sondern ihr innerstes Wesen selbst ausmacht, nicht durch rhapsodistische Aufzählung der einzelnen Merkmale erschöpft wird, sondern in seiner ganzen Einheit aufgefasst werden muss. Gerade weil er die letzte Verbindung von jenen ist, darf er keine Trennung verstatten, ist er für die innere Anschauung, was die äussere Gestalt dem Auge, und enthüllt sich fast nur einem gewissen, ahnenden Gefühle, da er doch auf Begriffe zurückgeführt, und durch Beweise bestätigt werden soll.

Die passenden Worte, ausgeführt von Humboldt und seiner Erfahrung über die 'Funktionalität der Natur', im Verhältnis zu des Menschen Bestreben. Gerade das ist es auch, was maßgeblich die Zeit nach der Renaissance im Besonderen ausmacht, nämlich die völlige Zerlegung des Daseins der Natur in seine Einzelbestandteil, dem gegenüber die Natur als solche einem doch unmißverständlich vor Augen führt, daß ein Einzelnes für sich isoliert gar nicht existiert. Und selbst der Begriff des Geschlechts, welcher als solcher die Einheit demonstriert, dem gegenüber man nicht wahr haben will, daß es die Einheit ist, worüber sich das Dasein repräsentiert. Dem gemäß werde ich hierin auch nicht auf die extraordinäre Ausweitung der Entwicklung eingehen, sondern mich darauf beschränken, was an elementaren Erkenntnissen im 19. Jh. zum Vorschein gelangte und wesentlich sind, zur Abgrenzung, wie auch dem Verbund bezüglich des Aufzubringenden, denn gerade darüber erfährt es auch seine Klarheit. Es ist nämlich keineswegs so, daß dieser Weg sich gänzlich von dem zuvor entfernte, vielmehr dieser doch letztendlich immer wieder zu dem gelangt, wie es eh und je 'faktisch' ist. Hingegen verschaffte jedoch gerade diese Entwicklung eine hervortretende unübersehliche Trennung zwischen dem Ersichtlichen und den Spekulationen, was sich zuvor allzusehr vermischte. Maßgeblich für Kenner wird hierin somit auch selbstverständlicherweise sein, worauf es andere darauf aufmerksam zu machen gilt, daß die beiden Bestandteile, was man Ersichtliches zutage brachte, mit dem, was man daraus hervortretend interpretiert, voneinander zu scheiden ist. Gerade dies bildet die ungemeine Schere, worüber die Ersichtlichkeiten letztendlich wieder zu völligen Verklärtheiten führen und sich alles miteinander beständig im spekulativen Kreise dreht. Maßgeblich hierin ist, was sich darüber als 'den Augen Ersichtliches' und somit körperlich-physisch aufweist, dem gegenüber des Wesens Kern weder darüber, noch über die Isoliertheit der Inbetrachtziehung des Einzelnen in Erscheinung treten kann. Die Spekulation ist's, was dies verbirgt, vor allem jedoch auch das außen vor Stellen elementarer Gegebenheiten.

So bedingt es, sich vor allem auch zu verdeutlichen, was man bewußt über diese Handhabe außen vor stellt. Hierbei handelt es sich nämlich um des Wesens Kern der Menschlichkeit - das Selbst - welches gerade über die Sexualität seine ausgiebige Veranschaulichung erfährt, da es gerade in der sexuellen Vereinigung der Liebenden nicht rein aus dem eigenen Selbst ist. Auch dieser Sichtung hat man einen Riegel vorgeschoben, denn in den Erachtungen trifft man einzig auf eine Personifizierung, ohne des gegenüber Personifizierung überhaupt zu ersichten, sodaß auf der einen Seite ein(e) Homosexuelle(r) in Erscheinung tritt, hingegen auf der Gegenseite einzig das Geschlecht, gemäß Mann oder Frau. Und gerade hierin kann man sich einmal vor Augen führen, wie es sich darin, nicht nur für einen bisexuellen Dritten, gemäß seiner Gegebenheit stellt, daß aufgrund dessen man nämlich gar nicht darin in Erscheinung tritt und auch nicht treten kann, sich hingegen eine gänzlich verklärende Sichtweise auf die Gegebenheiten ergibt, da der Einheitsverbund als solcher nicht seine Sichtung erfährt. Es ist somit nicht nur die Warte der Inbetrachtziehung, sondern vor allem der Substanzbezug, woraus sich dies ergibt. Es wird jedoch das Jeweilige als solches ersichtlich, insofern man das Augenmerk darauf richtet und entsprechend den Fäden folgt, worüber es sich aufweist. Und so ist uns auch die alte Sprache noch in aktuellen Gegebenheit präsent, wie sich über Stalfort im Nachfolgenden verdeutlicht. Man vergleiche und verbinde hierin den Bezug zum zuvor Aufgebrachten des Billigens und man ersieht das Gemeinsame, was darüber zum Vorschein tritt, was sich zusammenfassen läßt über die instinktiven Triebe, die man zwischenzeitlich als 'angeborene Gewohnheiten' bezeichnet, um sie als solche zu verdecken. In einem selbst ist dies indess unmöglich und darin besteht das Wesentliche, denn darüber ist es unablässig präsent. Und noch so viele Worte können es nicht verdrängen und nur bedingt auch unterdrücken - es ist und bleibt präsent. Somit ergibt sich auch aus den Entwicklungen heraus, daß umso weiträumiger man die Körperlichkeit erfaßt, sich darüber auch das Eigenleben als solches darüber offenbart, denn wie nachfolgende Worte besagen, so gibt es das Eine auch hierin nicht ohne das Andere. Und wenn man sich auch noch so sehr müht, so sind Dinge nicht zu trennen, die aufgrund ihrer Gemeinsamkeiten bestehen. Und wenn man somit in der Gegenwart die Instinkte außen vor stellt, so findet man es dennoch in der Geschichte, über die Abhandlungen über das Gemüthsleben des Menschen.


Eine Studie über den historischen Wandel ...
Transcript Verlag

S. 188: Für das 17./ 18. Jahrhundert und die Theoretiker der 'Gemütsbewegungen' finden die Prozesse, die sie beschreiben, vor dem Hintergrund der menschlichen Dualität von Leib und Seele statt: 'Gemütsbewegungen' existieren an der Schnittstelle zwischen Körper und Seele, genauer, auf der Grenze zwischen Körperwelt und Seelenwelt. ... Wie Zedler schreibt, "das völlige Wesen des Menschen entsteht mit der Vereinigung der Seele und des Körpers".

Die Seele ist somit ein erster wichtiger Faktor im Erklärungsgefüge des 17./ 18. Jahrhunderts und eine für die Gelehrten der Zeit unerlässliche Denkvoraussetzung. Allerdings schwindet die Bedeutung, die der Seele für die Existenz des Menschen zugesprochen wird, zunehmend im Verlauf der Jahrzehnte. So ist das späte 17. Jahrhundert deutlich eine Zeit des Übergangs. Noch im 16. Jahrhundert galt die Seele für viele Denker als eigentlicher Grund für die Existenz des Körpers, und alle körperlichen Teile und Funktionen wurden auf ihre Zweckmäßigkeit für den Dienst an der Seele betrachtet. Im Denken des 17. Jahrhunderts gewinnt der Körper an Eigenbedeutung, nun wird er nicht mehr gedacht als ausschließlich von der Seele geführt, sondern eine Vielzahl der Lebensvorgänge und Leistungen werden auf ihn selbst zurückgeführt. Mit der Philosophie Descartes' greift die Vorstellung Raum, dass der Körper einem eigenständigen Prinzip folgt.

Mit dem Begriff 'Gemüt' und seiner Verwendung im 17./18. Jahrhundert eröffnet sich bei genauerem Hinsehen eine Selbstbeschreibung des Menschen, die wenig mit der unsrigen heute gemein hat und die nachzuvollziehen nicht einfach ist. Zwar gebrauchen wir in der Alltagssprache immer noch den Begriff 'Gemüt', meist zur charakterlichen Beschreibung einer Person ("Er hat ein ausgeglichenes Gemüt"). Jedoch ist diese Verwendung lediglich eine blasse Erinnerung an die Präsenz und Bedeutungsintensität von 'Gemüt' im 17./18. Jahrhundert. Denn das seit mittelhochdeutscher Zeit bezeugte Wort hat sich im Laufe seiner Geschichte bis in unsere Gegenwart hinein in seinem Bedeutungsspektrum stetig ausgedünnt. Von seinem Ursprung her bezeichnet 'Gemüt' sowohl die Gesamtheit der seelischen Empfindungen und Gedanken, wie auch den Ort ihrer Entstehung und Entfaltung.

Mit dieser Verwendungsweise ist eine Doppelstruktur vorgegeben, die nur wenigen Begriffen eigen ist: Das Gemüt ist sowohl ein Akteur, der handelt, verrichtet und wirkt, wie auch ein Raum, in dem Dinge geschehen, in dem Ereignisse stattfinden und der beobachtet werden kann.

Die Lokalisierung sämtlicher personaler Handlungsursachen, Antriebe und Motivationen im Gemüt verweist auf den Charakter des Raumes. Es gibt keinen treffenderen Begriff für das 'Innere', für das Nicht-sichtbare einer Person.

Der Gesamtheit der Aktivitäten des Gemüts kommt man in der Vielfalt der bis heute bekannten und aus dem mittelhochdeutschen 'muot/mut' abgeleiteten Begriffe (dessen Kollektivbildung 'Gemüt' ist) auf die Spur, auch wenn das ehemals starke Verb 'muten' (ungefähr: seine Aufmerksamkeit auf etwas richten, etwas begehren), inzwischen veraltet ist. Bis heute gebräuchlich sind 'anmuten', 'vermuten', 'zumuten', 'ermutigen', 'entmutigen', 'frohgemut', 'wohlgemut', 'mutig' und 'vermutlich'. Das Wort 'muot/mut' steckt auch in zahlreichen Zusammensetzungen, beispielsweise in 'mutmaßen', 'mutwillig', 'übermütig' und 'demütig'. Allen diesen Begriffen ist gemeinsam, dass sie von der psychischen Verfasstheit einer Person erzählen, dass sie Aufschluss geben darüber, was im 'Inneren' eines Anderen vorgeht. So umfasst im 17./18. Jahrhundert der Begriff 'Gemüt' die Vollständigkeit und das Wirksamwerden aller inneren Elemente und Kräfte, die wir heute psychisch nennen.

Die größten Bedeutungsüberschneidungen gibt es mit dem Begriff der Seele, sodass Zedler anmerkt, nicht alle Autoren würden zwischen Seele und Gemüt unterscheiden. Tatsächlich gehen aus beiden Begriffen Zusammensetzungen hervor, die annähernd gleich sind, so entsprechen sich beispielsweise Gemütsbewegungen und Seelenbewegungen, Gemiitsruhe und Seelenruhe. Doch gibt es zwischen 'Gemüt' und 'Seele' auch gravierende Bedeutungsunterschiede, beispielsweise gilt die Seele als unsterblich, eine Annahme, die in keiner Weise über das Gemüt gemacht wird. Zudem gilt das Gemüt als dasjenige, was im Menschen weitaus eher als erkenn- und erforschbar gilt, denn die Seele ist (zumindest in großen Teilen) unerforschlich und prinzipiell von metaphysischer Natur. Dennoch stehen Gemüt und Seele in engster Verbindung; Zedler führt an, dass unter Gemüt auch "[...] die angebohrne Art, oder die Seele verstanden [wird], vornehmlich wie sie in ihr selbst oder gegen die äusserlichen Dinge geneigt oder beschaffen ist". So zeigt das Gemüt die individualisierte bzw. personalisierte Seite der Seele, über die dann auch Gesamtaussagen möglich werden, beispielsweise in der Aussage: wenn die Seele eines Menschen "[...] sich auf etwas Rechtschaffenes wendet, heisset es ein gutes, ein edles Gemüth, wann sie sich aber zu bösen Dingen neiget, so nennet man es ein boßhaftes, ein lüderliches Gemüth".

Das Gemüt ist jedoch nicht nur die Wirkstätte der Seele und der Ort ihres Wirkens, es ist zugleich der Ort, an dem die Welt auf die Seele wirkt und ihre Spuren hinterlässt. Denn das Gemüt ist kein abgeschlossener, sich selbst genügender Ort, sondern er ist zum anderen, zum Mitmenschen und zur Mitwelt geöffnet. Es ist das Gemüt eines Menschen, das den anderen wahrnimmt, Kontakt zu ihm aufnimmt, die Welt erfährt und durchdringt.

Entsprechend dem Doppel-Konzept von 'Gemüt' als Aktivitätszentrum und als Ereignisraum können Zedler und mit ihm die anderen Autoren sich Gemütsbewegungen sowohl als Handlungen des Gemüts vorstellen, wie auch als passive Erlebnisweisen im Gemüt. Und insofern ist vielleicht doch zwischen den Bezeichnungen 'Gemütsbewegung' und 'Leidenschaft' eine kleine Differenz auszumachen. Mit dem jeweiligen Begriff korrespondiert eine Vorliebe der Betrachtung: Steht bei der Bezeichnung 'Gemütsbewegungen' oft der Aspekt der Aktivität der Seele im Vordergrund (die Seele aktiviert das Gemüt), weisen die Autoren unter der Bezeichnung 'Leidenschaft' darauf hin, dass die Seele die Bewegungen im Gemüt erleidet. Beide Betrachtungsweisen sind bei Zedler gut zu erkennen. Wenn wir seiner Erklärung zur Entstehung einer Leidenschaft folgen, können wir beobachten, wie aktive und passive Elemente sich ineinanderfügen, - zudem wird auch deutlich, worin für ihn und für die Mehrzahl der Autoren - die eigentliche Gernütsbewegung besteht: Zedler formuliert den Anlass einer Gernütsbewegung folgendermaßen: "Es ist wahr, die heftigen Bewegungen haben, in so weit sie heftig werden, den Grund in unserer Seele. Nachdem dieselbe vermeint ihre Glückseligkeit entweder gewiß, oder vollkommen in einer Sache anzutreffen, nachdem bestrebet sie sich, dasselbe zu erhalten."

Der erste Anlass für die Gemütsbewegungen ist demnach das Begehren der Seele nach etwas (vermeintlich) Glücklichmachendern. (Hier setzen einige Autoren etwas andere Akzente, wie wir noch sehen werden.) Zedler führt weiter aus: "Doch sind die meisten Mittel unserer, wo nicht wahren, doch vermeinten Glückseligkeit ausser uns. Mit diesen ist unsere Seele nicht unmittelbar verbunden, sondern der Leib ist das Band der äusserlichen Dinge mit der Seelen. In diesen würcket nun dieselbe und die Bewegung geschiehet in denen Lebens-Geistern". Zedler erklärt, dass Menschen die Mittel zur Glückseligkeit außerhalb ihrer selbst vermuten und sich daher das Streben der Seele auf die Außenwelt richtet. Die Seele ist mit der Außenwelt nur über den Körper verbunden, daher wird sie nun in ihm tätig. Der Impuls des Seelen-Begehrens wird an die Lebensgeister weitergegeben, sie werden in Bewegung versetzt.

Bei aller Verschiedenheit treffen sich die Positionen der Autoren in der Aussage, dass das Einlassen der Seele auf die Dinge der Außenwelt der eigentliche Anlass für eine Gemütsbewegung ist. Enthalten in dieser Aussage ist sowohl die Vorstellung, dass die Dinge die Seele direkt beeinflussen (wozu auch die Bedürfnisse des Körpers und das Temperament zählen), wie auch die Idee, dass die Seele ein eigenständiges Verlangen nach ihnen hervorbringt. Die erste Vorstellung verstärkt in den Gemütsbewegungstheorien den Charakter des Leidens der Seele, da die Welt auf diese Weise die Seele aus ihrer ursprünglich begierdelosen Haltung herauslöst. Die zweite hebt die aktive Rolle hervor, die der Seele beim Erwecken einer Gemütsbewegung zukommt, und sie zeigt auf, dass es die Seele selbst ist, die Begierden entwickelt. Die Autoren legen nicht alle Wert auf eine scharfe Trennung dieser recht unterschiedlichen Ausgangspunkte.

Die Autoren sind sich einig darin, dass das wahre Glück der Welt nicht in den Sinnlichkeiten zu finden ist [sie ersehen es in der Gemüthsruhe]. ... Daher ist es auch das erklärte Ziel dieser Zeit (und es wird bei allen Autoren gleichermaßen berücksichtigtl), eine Haltung gegenüber den Gemütsbewegungen einzunehmen, die man als 'erlernte Ignoranz' bezeichnen kann: Angestrebt wird die Unabhängigkeit von sinnlichen Empfindungen, von Lust und Unlust, von Begehren und Begierden, angestrebt wird die Abwesenheit aller Unruhe. Die Ratschläge der Autoren gehen daher einhellig dahin, die Herrschaft über die Gemütsbewegungen zu erringen, sie in ihrem Lauf zu unterdrücken, ihnen keine positive Bedeutung beizumessen und sie weitestgehend aus ihrem Leben auszuklammern.

Divider

Der Wandel der Neuzeit - Gefühl statt Gemüthsbewegung

S. 181: Insofern [sich in der entstandenen Psychologie des 19. Jh., in Abspaltung von der Philosophie, keine einheitliche Grundlage bildete] gibt es auch keine Phase der allgemeinen Anerkennung einer einzelnen Gefühlstheorie. Dennoch haben sich der Gefühlsbegriff und die Anerkennung von 'Gefühlen' als relevante Forschungsobjekte der Psychologie bis Mitte des 19. Jahrhunderts durchsetzen können. In den 50er Jahren des 19. Jahrhunderts ist das 'Gefühl' der Schlüsselbegriff zur Erforschung der menschlichen Emotionalität. Es hat sich um die Vorgänge im Innern des Menschen ein 'stillschweigendes Wissen' gebildet, welches die Forschungen in diesem Bereich leitet. 'Gefühle' sind aus dem Innenleben des Menschen von nun an nicht mehr wegzudenken, sie werden als eigenständige psychische Phänomene wissenschaftlich nicht mehr angezweifelt.

Zum Ende des 19. Jahrhunderts nimmt die Erforschung der Ernotionalität erneut eine Wendung. Die Einführung der experimentellen Psychologie verändert die bisher geisteswissenschaftlich orientierte Psychologie von einer Erfahrungswissenschaft (wie sie sich bis dahin selbst nannte) zur Experimentalwissenschaft im naturwissenschaftlichen Sinne. Das Experiment wird schnell zur psychologischen Methode schlechthin und erhält den Nimbus, der einzige Weg zu sein, der zu gesicherten psychologischen Erkenntnissen führt, sämtliche andere Forschungsmethoden treten von nun an in den Hintergrund. Insbesondere die Introspektion gerät in Veruf, sie war bisher die psychologische Methode erster Wahl. Diese Änderung in der Forschungsmethodik bewirkt für den Bereich der Gefühlsforschung eine deutliche Verschiebung des Forschungsinteresses und damit auch eine Neubewertung ihrer bisherigen Forschungsergebnisse. Lediglich diejenigen Theorien, die dem neuen Verständnis von Wissenschaftlichkeit entsprechen, werden in das Gedächtnis der sich nunmehr als Naturwissenschaft begreifenden Psychologie übernommen.

Dem gegenüber stellend, nachfolgend einmal den Konsenz, worüber man einst in seiner abgrenzenden Gegebenheit von Körper und Geist, dies dann doch als Einheit zu etablierten suchte, von Fechner auf den Punkt gebracht. Stellt man hierin einmal konkret die Frage, was denn nun eigentlich 'das Wahrnehmende' ist, so besagt man darin, daß es einerseits das Gehirn bezüglich des Äußeren und der Geist bezüglich des Inneren ist. Wie Fechner hervorhebt, kann man jedoch gar nicht aus dem Inneren heraus ins Gehirn 'schauen' und was nimmt eigentlich die Empfindungen und Gefühle war, wo es der Geist doch gar nicht ist? Repräsentiert das Gehirn oder der Geist das Ich? Wo befindet sich das Ich, welches das äußere Wirken wahrnimmt, dem gegenüber das Ich doch sich selbst wahrnehmen kann, wie im Inneren, so auch im Äußeren und es keineswegs die Trennung erfährt, wie es Fechner gemäß der allgemeingültig sich etablierenden Anwendung darlegt? Man verdeutliche es sich indess über die Computerhard und -software und darüber gelangt man zum Muster der tatsächlichen zugrundliegenden unterscheidenden substanziellen Gegebenheiten, worüber sich darlegt, wie es sich mit dem Inneren und Äußeren verhält. Der entscheidende Punkt hierin ist, daß man ebenfalls das über die äußere Wahrnehmung Hineingelangende im Inneren wahrnimmt und die bewußtwerdende Wahrnehmung gar nicht im Äußeren stattfindet, sondern einzig im Inneren, worin alles miteinander hervortritt. Man kehrt die Gegebenheiten indess darin um, worüber einzig noch das seine Erwägung erfährt, was über das Äußere ersichtlich ist (außer dem Geiste, desen es dazu eben auch bedingt!). Entfernt man hierin hingegen des Menschen innere Wahrnehmung, was sieht man dann noch - in jeglicher Weise nämlich nichts mehr, gemäß des Computers, worin man die Software herunterfährt. Und gerade darin besteht auch das Handikap darin, daß der ersichtende Mensch dies gar nicht abschalten kann, hingegen über die Ausgrenzung dann auch einzig noch sieht, was das Äußerliche darbietet, ohne zu erkennen, wie die Wahrnehmung und das Selbst überhaupt funktioniert, da es darin nämlich gar nicht in Erscheinung tritt. Hierzu gilt es mir hervorzuheben, daß der Computer hierin keineswegs metaphorisch gemeint ist, sondern es sich wahrlich derart stellt, wobei jedoch zu bedenken gilt, daß das Leben eben auch ein darüber hinaus Bestehendes ist, jedoch des Wesens Kern der substanziellen Unterscheidung darlegt. Der wesentliche Punkt hierin ist, daß das Sein gar nicht anders funktioniert, wie es in seiner Natur vorgegeben ist und man dem gegenüber zwar die Sichtweisen manipulierend ändern kann, nicht jedoch das Sein selbst, worüber es weiterhin ersichtlich bleibt (was man in der Philosophie leider nicht erkannte, indess in der reinen Vergeistigung stecken geblieben sind, worin es eben nicht ersichtlich ist, da die geistige Vorstellung kein Sein, sondern einzig ein Bildnis ist!).


Erster Theil
Verlag: Breitkopf und Härtel
» «

I. Allgemeinere Betrachtung über die Beziehung von Leib und Seele.

Indess die Lehre von der Körperwelt in den verschiedenen Zweigen der Naturwissenschaft zu einer grossen Entwicklung gediehen ist, und sich scharfer Principien und Methoden erfreut, welche ihr einen erfolgreichen Fortschritt sichern, indess die Lehre vom Geiste in Psychologie und Logik wenigstens bis zu gewissen Gränzen feste Grundlagen gewonnen hat, ist die Lehre von den Beziehungen zwischen Körper und Geist oder Leib und Seele bis jetzt fast blos ein Feld philosophischen Streites ohne festes Fundament und ohne sichere Principien und Methoden für den Fortschritt der Untersuchung geblieben.

Der nächstliegende Grund dieses ungünstigeren Verhältnisses ist meines Erachtens in folgendem factischen Umstände zu suchen, der freilich wieder nach seinem weiter rückliegenden Grunde fragen lässt. Die Verhältnisse der Körperwelt für sich können wir unmittelbar und im Zusammenhange durch Erfahrung verfolgen, die Verhältnisse der inneren oder geistigen Welt nicht minder ; jene zwar nur, so weit unsere Sinne und deren verstärkende Hülfsmittel reichen, diese, so weit eines Jeden eigene Seele reicht ; aber doch so, dass wir im Stande sind, Grundthatsachen, Grundgesetze, Grundverhältnisse in jedem beider Gebiete zu gewinnen, welche uns als sichere Unterlagen und Ausgangspuncte für den Schluss und weiteren Fortschritt dienen können. Nicht so mit dem Zusammenhange der körperlichen und geistigen Welt, indem von beiden unmittelbar zusammengehörigen Factoren dieses Zusammenhanges immer nur der eine auf einmal in die unmittelbare Erfahrung tritt, während der andere unter der Decke bleibt. Denn indess wir uns unserer Empfindungen und Gedanken unmittelbar bewusst sind, können wir nichts von den Bewegungen im Gehirne wahrnehmen, welche daran gebunden sind und an welche sie ihrerseits gebunden sind, das Körperliche bleibt hier unter der geistigen Decke ; und indess wir die Körper anderer Menschen, Thiere und der ganzen Natur unmittelbar der anatomischen und physiologischen, physikalischen und chemischen Untersuchung unterwerfen können, vermögen wir nichts unmittelbar von den Seelen, die den ersten, und dem Gotte, welcher der zweiten zugehört, zu erfahren ; das Geistige bleibt hier unter der körperlichen Decke. Und somit bleibt auch den Hypothesen und dem Leugnen grosser Spielraum. Ist überhaupt etwas unter dereinen und der anderen Decke, und was ist darunter zu finden?

Die Unsicherheit, das Schwanken, das Streiten über diese Thatfragen hat bisher noch keinen festen Ausgangspunct und Angriffspunct für eine Lehre von den Verhältnissen dessen, um dessen Thatbestand sich's grossentheils erst noch streitet, zugelassen.

Und was kann der Grund dieses eigenthümlichen Verhältnisses sein, dass wir Körper und Geist jedes für sich, und doch nie beides, wie es unmittelbar zusammengehört, auch unmittelbar zusammen beobachten können ; indess wir doch sonst das, was unmittelbar zusammenhängt, am leichtesten zusammen beobachten? Nach der Unverbrüchlichkeit, in der diess Verhältniss zwischen geistigem und körperlichem Gebiete besteht, dürfen wir vermuthen, dass es ein fundamentales, in ihrer Grundbeziehung selbst begründetes sei. Aber giebt es kein ähnliches, was uns die Thatsache desselben mindestens erläutern, wenn nicht auf den Grund führen kann?

Wohl lässt sich auf diess und das hinweisen. Z. B. wenn Jemand innerhalb eines Kreises steht, so liegt dessen convexe Seite für ihn ganz verborgen unter der concaven Decke; wenn er ausserhalb steht, umgekehrt die concave Seite unter der convexen Decke. Beide Seiten gehören ebenso untrennbar zusammen, als die geistige und leibliche Seite des Menschen und diese lassen sich vergleichsweise auch als innere und äussere Seite fassen ; es ist aber auch ebenso unmöglich, von einem Standpuncte in der Ebene des Kreises beide Seiten des Kreises zugleich zu erblicken, als von einem Standpuncte im Gebiete der menschlichen Existenz diese beiden Seiten des Menschen. Erst wie wir den Standpunct wechseln, wechselt sich die Seite des Kreises, die wir erblicken, und die sich hinter der erblickten versteckt. Aber der Kreis ist nur ein Bild, und es gilt die Frage nach der Sache.

Was dir auf innerem Standpuncte als dein Geist erscheint, der du selbst dieser Geist bist, erscheint auf äusserem Standpuncte dagegen als dieses Geistes körperliche Unterlage. Es ist ein Unterschied, ob man mit dem Gehirne denkt, oder in das Gehirn des Denkenden hineinsieht.*) Da erscheint ganz Verschiedenes; aber der Standpunct ist auch ganz verschieden, dort ein innerer, hier ein äusserer ; unsagbar verschiedener sogar, als in vorigen Beispielen, und darum eben der Unterschied der Erscheinungsweisen unsagbar grösser. Denn die doppelte Erscheinungsweise des Kreises, des Planetensystems, wird doch im Grunde nur von zwei verschiedenen äusseren Standpuncten dagegen gewonnen; inmitten des Kreises, auf der Sonne bleibt der Beobachter ausser dem Zuge des Kreises, ausser den Planeten. Aber die Selbsterscheinung des Geistes wird von einem wahren inneren Standpuncte des ihm unterliegenden Wesens gegen sich selbst, dem der Coincidenz mit sich selbst, die Erscheinung der zugehörigen Körperlichkeit von einem wahren dagegen äusserlichen Standpuncte, dem der Nichtcoincidenz damit gewonnen.

*) Aequivalent mit dem Hineinsehen ist, eine adäquate Vorstellung nach Schlüssen, gegründet auf äusserlich Gesehenes, fassen, wie der innere Zustand bei Wegräumüng der Hindernisse des Hineinsehens erscheinen würde.

Maßgeblich ist hierin, daß die vorausgehende Vorstellung über eine Gegebenheit, ohne sie tatsächlich als solche über die Sinne wahrlich wahrgenommen wurde, dazu führt, daß dies sich als Schablone der Wahrnehmung auswirkt. Man sieht die Gegebenheit dann einzig noch gemäß der schablonierten Filterung. Und das ist es auch, was man in sämtlichen Entwicklungen der Ergründungen antrifft, daß sich an jeglicher Anfang die Spekulation und Ideologie als solche repräsentiert, aus der heraus man die Dinge ergründet, repräsentiert und händelt. Was den Wandel zur tatsächlichen Inbetrachtziehung der Geschlechtsorgane beim Menschen betrifft, so fand dies zur Zeit der Renaissance, gemäß dem, auch nicht über die Anatomen statt, anhand der leblosen Körper des Wesens Kern auch nicht ersichtlich ist, wie des weiteren noch zur Darstellung gelangt, sondern abseits der regulären Anatomie, im rechtsmedizinischen Bereich, worin das augenscheinliche Wirkwesen zum rechtsklärenden Ermessungsgegenstand wurde. Hierin war es Jacques Duval, welcher das Bezugswesen darin revolutionierte und somit nicht mehr nur oberflächliche Äußerlichkeiten, sondern das Detailwesen der Geschlechtsorgane Inbetrachtziehungsgegenstand wurde. Spezieller Kontext der Ärzteschaft war von je her das Bezugswesen zu Abnormitäten, worüber sich in besonderer Weise die Funktionsweisen und somit auch das des menschlichen Konstruktes über die Kontrastierungen darbieten. Und so gibt es im Äußerlichen der Geschlechtsorgane ein ganz Bestimmtes, worüber sich auch die Verhältnisse spezifisch darlegen und das ist vor allem die Beschäftigung mit den Detailwesen der Differenzierungen, die gar nicht so eindeutig einher gehen, wie man es gedenkt (→Schablone). So wird hierin das Verhältnis zur Klärung des Penis zum eigentlichen Gegenstand, ob es sich hierbei um einen männlichen Penis oder weiblichen Penis - die Klitoris - handelt. Um dieses Detail des Verhältnisses dreht es sich auch, bezüglich Duval's Aufbringen der Einforderung des in Augenschein nehmens dessen und über dieses Detail zeigt sich auch über die Zeiten hinweg das Verhältnis des Menschen zum Speziellen des Geschlechtsorganwesens auf. Das Markante hierin ist vor allem, inwiefern dieses Detail sich überhaupt als ersichtende Präsent erweist. Man betrachte sich hierzu die Gegenwart und führe sich dies vor Augen. Wahrgenommen wird die Klitoris tatsächlich noch immer einzig von Wenigen und existiert in den meisten Köpfen nicht (→Schablone). Die meisten sehen in dem weiblichen Geschlechtsorgan nach wie vor einzig eine Körperöffnung, als Passform, in welcher der Penis sich einfügt und dies sind keineswegs nur Menschen, welche keinen sexuellen Geschlechtsverkehr praktizieren, sondern auch die Praktizierenden erfahren es weitläufig aus dem Schablonenverhältnis heraus, da die weiblichen Geschlechsorgane in keiner Weise eine derartige Sichtung erfahren, wie der männliche Penis, gemäß seiner herausragenden Erscheinung (→Schablone). So ist es denn auch hierin generell derart, daß die Klitoris einzig gemäß deren herausragenden Präsenz, in Erscheinung tritt. Darin besteht auch das Grundprinzip, welches man im Bezug auf das Händling des Geschlechtswesen antrifft und genau auf diesem Prinzip basiert, nämlich auf der Ermessung des herausragend Ersichtlichen und umso herausragender es sich stellt, es sich auch als eine Vermessenheit sich erweist, es nicht als solches anzuerkennen. Die Reflektion (der Schablone!) bildet hierin den Kern dieser Wesensart und darauf begründet es sich.

Traité des hermaphrodits (1612)
» Traité des hermaphrodits (1612) «


Mediziner in Basel um 1600
Campus Verlag
» «

Auszug aus der » Ausgabe von 2018 «

Um 1600 boomten Publikationen zu Hermaphroditen. In der berühmten Auseinandersetzung um den vermeintlichen Hermaphroditen Marie/Marin le Marcis zwischen den beiden Medizinern » Jean Riolan « und Jacques Duval wurde beispielsweise die Frage verhandelt, ob Marie/Marin als Tribade eine Frau geheiratet habe oder ob sie ein Hermaphrodit sei. Duval plädierte für Letzteres, womit er Marie/Marin vor der Todesstrafe bewahrte, während Riolan, der in seiner Anthropographica sogar für allgemeine Klitoridektiomen eintrat, Marie lediglich eine vergrößerte Klitoris zugestand.


Eine Genealogie des Geschlechtsbegriffs
Akademie Verlag GmbH

Mit Duvals Technik der Vivisektion korrespondiert die Erfindung eines neuen Gegenstandes: Innerhalb der Klinik der Sexualität erscheint die Organisation, das Zusammenspiel, das Tableau der Zeugungsglieder. Es tauchen die ersten Konturen dessen auf, was in Scultets Vivisektionsbericht des Zwitters Marta/Caspar Lechna Geschlecht genannt werden wird. Und noch eine Parallele zu Scultets Bericht wird offenbar: Scultet sagt, dass die alten Mediziner nichts als die Haare, die Stimme oder den Leib der Martha/Casper Lechna untersuchten. Ihm hingegen ginge es um das wahre Geschlecht. Und seine Ausführungen werden sich ausschließlich auf die Untersuchung der Zeugungsglieder des Zwitters Lechna beziehen. Hier wie dort betreten neue Fragmente dessen, was das Geschlecht sein wird, die Bühne des Wissens. Nicht mehr die Menschen-, Tier- oder Pflanzengeschlechter werden fortan die Folianten füllen, sondern die Tableaus der Zeugungsglieder. Die Frage nach den Geschlechtern wird sich auf einer vollkommen anderen Grundlage, als Frage nach dem Geschlecht, radikal neu stellen.


Ashgate Publishing Limited

Kathleen Long explores the use of the hermaphrodite in early modern culture wars, both to question traditional theorizations of gender roles and to reaffirm those views. These cultural conflicts were fueled by the discovery of a new world, by the Reformation and the backlash against it, by nascent republicanism directed against dissolute kings, and by the rise of empirical science and its subsequent confrontation with the traditional university system. For the Renaissance imagination, the hermaphrodite came to symbolize these profound and intense changes that swept across Europe, literally embodying these conflicts. Focusing on early modern France, with references to Switzerland and Germany, this work traces the symbolic use of the hermaphrodite across a range of disciplines and domains - medical, alchemical, philosophical, poetic, fictional, and political - and demonstrates how these seemingly disparate realms interacted extensively with each other in this period, also across national boundaries. This widespread use and representation of the hermaphrodite established a ground on which new ideas concerning sex and gender could be elaborated by subsequent generations, and on which a wide range of thought concerning identity, racial, religious, and national as well as gender, could be deployed.

Worum es sich jedoch tatsächlich dreht, in seiner Wesensart, beschreiben die darstellenden Worte nicht, denn vor allem in der alten Zeit, zieht man das Innenleben gar nicht in Betracht und ist auch fortwährend nicht Ermessungsgegenstand. Und gerade darauf basiert es auch, daß die Definition und Darstellung von Hermaphroditismus, bis hin zur Umdeklarierung als Intersexualität, seit der Zeit der Renaissance, seitdem man sich spezifisch damit befaßt, allzeit variiert und fortwährend hin- und herwankt, was es besagen soll, da man hierin etwas zu definieren sucht, was es gemäß dem gar nicht gibt. Und auch, wo man in späteren Jahren die beschreibenden Worte als solche in Betracht zieht, diese jedoch nicht vermitteln können, was die Gefühle in einem selbst als Wesensart hervorbringen, so ist es auch hierin generell ein äußerlich ersichtendes Schablonieren, was man antrifft, jedoch vermischt sich darüber alles Mögliche miteinander, da es keine Klarheit schafft. Zumal hierin sich zeigt, daß mit jeder Errungenschaft neuer Kenntnisse gleichermaßen eine Zerstörung des Bestandenen einher geht. So trifft man hierin bereits auf die Vermischung der Tribade/Tribadie mit der Homosexualität, was man in späterer Zeit als eine Neuentdeckung der Bisexualität anpreist und gar sich aus der Vermischung heraus anmaßt, die Gegebenheiten als solche in Erfahrung zu bringen, wobei doch gerade die Trennung die Klarheit schafft, die ebenfalls ursprünglich auch darin bestand, gemäß dem man es nicht nur anders benannte, sondern auch dem gemäß behandelte, was die Worte aus der Zukunft indess nicht zum Vorschein bringen, da sie es aus ihrer Sicht heraus betrachten. Maßgeblich hierin ist jedoch das Verhältnis des bedingenden zu-Zweit, was alles andere auch nicht als solches erscheinen läßt, wie es sich darlegt. Und dies ist keineswegs ein rein christliches Gebahren, woraus sich dies ergab, sondern hängt damit zusammen, jegliche Andersartigkeit über das Einheitswesen zu verdrängen, fundiert über das Staatsrecht, sich darüber hinweg zu heben, gegenüber dem aus der Gemeinschaft heraus bestehenden Rechtswesen. Die vereinheitlichen zur Monogamie stellt sich hierin gleich des Monismus, welcher hierin das Grundwesen bestimmt. Der Dualismus ist darin einzig geduldet, jedoch nicht erwünscht. Und so bildet sich über die Jahrhunderte letztendlich auch ein Bündnis darüber, worin es sich mit der Zeit immer mehr zuspitzt, zu vermitteln, daß es sich eben im Dasein nicht verhält, wie in der inneren und äußeren Sichtung des Kreises, sondern gemäß zweier Seiten einer Medaille, worauf auf der jeweiligen Seite etwas anderes aufgedruckt steht, das es zu demonstrieren gilt. Das ist, wie es Betroffene erfahren, daß ihnen nämlich von allen Seiten ein Stempel aufgedrückt wird, hingegen es jedoch keiner sehen kann, außer den Betroffenen selbst, da es einzig aus dem Erleben heraus in seinem Selbst erfahrbar ist.

Foucault hat den Fall » Barbin « und dessen Tagebücher aus dem 19. Jh. aufgearbeitet, worüber man einmal mustergültig einen konkreten Einblick erlangt, über die Gegenüberstellung der beiden Gegebenheiten. Das Selbst, welches das Seinige zu leben sucht und die Anderen, welche über die Identität ihres eigenen Selbst dies definieren. So zeigt die Lebensgeschichte hierin auch in seiner Deutlichkeit auf, daß über die Einpassung in das derartig erachtende Formwesen, das bestehende Sexualwesen gänzlich seinen Zerfall erfährt, da dies in keiner Weise mehr darin umsetzbar ist - dem in keiner Weise entspricht - und somit die Anpassung auch das Selbst zerstört. Gemäß dem nimmt sich Barbin auch das Leben, welches für diese(n) nicht weiter lebenswert ist. So ist das entstandene Recht auch kein Recht auf das Selbst, sondern einzig eine Bedingung, dieses Selbst dem anzumessen und Teil der Rechtmäßigkeit sein zu dürfen. Hervorzuheben ist, daß in jeglichen Bezügen des Geschlechts- und auch das später in Betracht ziehenden Sexualwesens, die Definition an aller Anfang steht und nicht erst aus den Ergründungen heraus entsteht. Vielmehr stellen die Beschreibungen, gemäß dem es sich bei diesem Begriff um das biologische Geschlecht handle, eine Verfälschung dar, denn wie sich über die Geschichte in aller Deutlichkeit darlegt, ist es das Umgangswesen und vor allem auch seit seiner Einführung auch das geschriebene Recht, welches dieses Geschlecht definiert und nicht die Biologie der Wissenschaft. Hingegen ist man sehr wohl daran interessiert, die Grundlagen zu ergründen, wohingegen jedoch die Art und Weise das eigentliche Handikap darstellt, denn darin erscheint eben doch nicht das Selbst selbst, sondern einzig äußerliche Inbetrachtziehungen. Zumal auch Worte es nicht vermitteln, was einem das Sinneswesen beschreibt, auch wenn die Worte zwar einen Sinn ergeben, kann man die Sinnlichkeit selbst doch nicht vermitteln, denn man richtet es sich nicht aus dem geistigen Willen und der Selbstverständlichkeit heraus, sondern es ist da und damit lebt man. Da fragt es/man sich nicht nach dem Sinn, sondern höchsten nach dem Unsinn, welches diesem widerfährt. Und gerade der Unsinn ist es jedoch auch wiederum, worüber es sich ebenfall als solches klärt - über das, was es nicht ist, zeigt sich ebenfalls das wahre Sein, vor allem aber wird es darüber noch deutlicher klar, wie es ist, da sich nämlich darüber dazu erforderliche Kontrastierung ergibt. Gravierend erweist es sich indess, wenn wie im Falle Berbin, man weder sich selbst, noch die anderen versteht. Daraus kann sich nämlich für weder noch ein Verständnis ergeben. Tatsächlich erweist sich dies jedoch als Regelfall der alten Zeit, wohingegen erst mit dem 20. Jahrhundert die Betroffenen selbst beginnen, sich selbst und ihr Dasein zu ergründen, worüber sich ein tatsächliches Ersichtungswesen ergibt, jedoch mit einer Besonderheit der Begebenheit: man stellt es unter den Scheffel der Wissenschaftlichkeit, sodaß sich auch darin das Althergebrachte fortsetzt, man jedoch zwischenzeitlich und letztendlich dazu übergeht, sich davon zu lösen, da man beginnt, zu erkennen, daß darin die Erfordernisse der Klärungen darüber nicht zu erlangen sind.

Herculine Berbin (Original - frz. 1978)
» Michel Foucault «

Herculine Barbin (1980)
amerikanische Übersetzung


Der Fall Barbin
Suhrkamp Verlag
Übersetzung von

Es dauerte sehr lange, bis man einklagte, daß ein Hermaphrodit ein einziges, ein wahres Geschlecht haben sollte. Jahrhundertelang gestand man ihm einfach zwei zu. Eine Mißbildung, die Schrecken auslöste und peinliche Strafen erforderlich machte. Tatsächlich lagen die Dinge sehr viel komplizierter. Zwar gibt es sowohl in der Antike als auch im Mittelalter mehrere Zeugnisse von Hinrichtungen. Aber es gibt auch eine umfangreiche Rechtsprechung ganz anderer Art. Im Mittelalter waren die Vorschriften des Rechts - des kanonischen und zivilen - in diesem Punkt äußerst klar: Hermaphroditen wurden diejenigen genannt, in denen die beiden Geschlechter variablen Anteilen nebeneinanderlagen. In diesem Fall hatte der Vater oder Pate (diejeningen also, die dem Kind 'den Namen geben') die Aufgabe, zum Zeitpunkt der Taufe das Geschlecht festzulegen, das beibehalten werden sollte. Gegebenenfalls riet man dazu, sich für dasjenige Geschlecht zu entscheiden, das zu überwiegen schien, das 'die größte Stärke oder 'die größte Hitze' hatte. Später aber, an der Schwelle zum Erwachsenenalter, wenn für ihn der Moment gekommen war, sich zu verheiraten, stand es dem Hermaphroditen frei, selbst zu entscheiden ob er noch immer zu dem Geschlecht gehören wollte, das man ihm gegeben hatte, oder ob er das andere vorzog. Einzige Vorschrift: es nicht mehr zu wechseln, dasjenige bis zum Ende seiner Tage zu behalten, das er jetzt anbag; sonst lief er Gefahr, als Sodomit zu gelten.

Wie im Kapitel der Anatomie bereits hervorgehoben, sind es vor allem jedoch auch die Ursprünge, welche eine besondere Hürde darstellen, denn aus deren Darstellungen begründen sich auch die Inbetrachtziehungen. Man bedenke hierzu das zuvor Beschriebene, gemäß dem die 'vorausgehende Vorstellung' sich in seiner markanten Weise gravierend auf die Wahrnehmung einwirkt, sodaß ein tatsächliches Ersichten, abseits dessen zunächst auch erst einmal seiner Erlangung bedingt. Und somit sind auch erst einmal die Bildnisse zu klären, welche dies verklären. Und gerade im Bezug auf die Hermaphroditen, gibt es wahrlich eine Vielfalt an Gegebenheiten, die sich gerade darin vermischen. So ist denn auch die eigentliche Errungenschaft, welche sich infolge der Renaissance einstellt, daß das Geschlechliche seine eigentliche Inbetrachtziehung überhaupt erst einmal erfährt, wohingegen es zuvor mehr Geschichten waren, um das es sich rankte, als eine tatsächliche Inbetrachtziehung der Erscheinungswesen derer Art. Wie man nachfolgendem entnehmen kann, so wurden gar siamesische Zwillinge als Hermaphroditen betrachtet, wobei gerade dieses Musterbeispiel verdeutlicht, daß grundlgende die Spekulation das Ermessende war. Und so ist die Renaissance auch eine Renaissance der Neuerung bezüglich des Sexualwesens, zu dessen klärenden Einsichten es jedoch noch der Jahrhunderte bedarf. Während man in der Botanik auf ein zuvor unbekannten Sachstand stieß und somit darin ein neuerlicher Weg zu bereiten war, galt es hierin vor allem jedoch erst einmal der Aufräumungsleistungen, sodaß es sich hierin auch ganz anders stellt und entwickelte.

Paire.jpg
The work of
Ambroise Paré

Ronsil.jpg
» Dissertation sur les Hermaphrodites «
Georges Arnaud de Ronsil


» Dissertation sur les Hermaphrodites «


deutsche Übersetzung
über die Hermaphroditen
Verlag: Amand König
Neuauflage: Nabu Press (2011)

S.3: Man versteht unter Hermaphrodit eine Person, deren Theile, die den Unterschied des Geschlechts bestimmen, entweder vollkommen oder unvollkommen mit einander vereinigt sind.

Das Wort Hermaphrodit kommt vom griechischen Wort Ἐρμῆς Mercurius, und Ἀφροδίτη, Venus, woraus ἑρμαφροδῖται entstanden. Beym Ovidion findet man die fabelhafte Geschichte, welche Gelegenheit zu dieser Bedeutung gegeben: er mache den Hermaphrodites zu einem Sohn der Venus und des Mercurs; er war nach ihm, von einer so vollkommenen Schönheit, daß die Nymphe Salmacis zum Sterben in ihn sich verliebte, da sie ihn in der Quelle, der sie vorgesetzt war, sich baden sahe: aufgebracht, daß sie ihn nicht gegen ihre Liebe empfindlich machen konnte, bat sie die Götter sie beyde zu vereinigen, so daß ihre Körper nur einen ausmachten, in dem beyde Geschlechter deutlich verschieden waren. Dieses wurde ihr gewährt.

Spon hat in seinen Untersuchungen der Merkwürdigkeiten des Altherthums, zwey kostbare Steine angeführt, auf welche die Fabel vom Hermaphroditen gegraben ist. Der eine, ein Carniol, stellt ihn im Bade vor, im Begriff die Nymphe Salmacis zu umarmen, mit welcher er ein Körper zu werden anfängt, der doch die Kennzeichen beyder Geschlechter behält. Der zweyte zeigt ihn schon verändert, auf die Art wie man ihn zu Rom in Bildsäulen von Marmor und Erz antrifft.

Die alten, an Fabeln so fruchtbaren Dicher, verschleyerten mit ihnen die Wahrheit, die glückliche Genies aber wusten sie zu enthüllen, unmoralisch oder politisch zu erklären. Die Folge dieser Abhandlung wird vieleicht die Nennung derer begünstigen, welche den Sinn dieser Fabel nicht schwer zu erklären glauben; denn läßt sie uns nicht vermuthen, wie Mertru (a) behauptet, der darin mit dem Abt Bellegarde (b) einstimmig ist, daß "die Alten Kenntniss von der Vereinigung beyder Geschlechter in einer Person gehabt haben, und daß diese Grille der Natur der Ursprung dieser vom Ovid in seinen Verwandlungen erzählten Fabel sey. Ovid dichtete, sagt der Abt von Bellegarde, daß Hermaphrodites ein Sohn des Mercurs und der Venus gewesen sey, und gründete sich auf die Beobachtung einiger Naturforscher die bemerkt haben, daß Kinder, während der Vereinigung dieser beyden Planeten gebohren, öfters Hermaphroditen sind und sich beyde Geschlechter vereinigen".

Sonst haben noch die Griechen diese Geschöpfe Androgyni und Gyantropi genannt, welche Benennungen charakteristischer scheinen, da die erste einen Mann und eine Frau, und die andere eine Frau und Mann bedeutet. Inzwischen bedient man sich des Wortes Hermaphrodit, welches am gebräuchlichsten ist.

Ich will mich nicht in die Streitigkeiten einiger Rabinen einlassen, welche behaupten, Adam wäre vor dem Fall ein Hermaphrodit, und dazu bestimmt gewesen in diesem Zustande zu bleiben : man kann hierüber Casp. Bauhin nachlesen, er widerlegt sie mit der tiefsten Gelehrsamkeit.

Die Hermaphroditen sind durch eine so große Menge Schriftsteller bezeugt, daß ihre Wirklichkeit bey sehr vielen Leuten außer Verdacht zu seyn scheint. Aristoteles zweifelt nicht daran ; er führt Nachrichten darüber an, die von einigen bewundert, und von andern lächerlich gemacht sind. Ich unternehme hier nicht diese Nennungen zu entscheiden ; jeder hat das Recht seine Begriffe nach dem Maße seiner Erkenntnis zu entwickeln : mein Zweck ist bloß das Ansehn der Schriftsteller anzuführen, die gehört werden verdienen. Ich werde nicht darthun, ob dieser Weltweise träumte oder ob er Recht hatte, wenn er sagte, daß einige Hermaphroditen die recht Brust wie ein Mann hätten, und die linke wie ein Frauenzimmer, und daß sie sich wechselweise änderten ; es kann seyn, oder es kann nicht seyn, ich weis es nicht : die Natur stellet uns täglich die sonderbarsten Abweichungen vor, so daß man sich nicht unterstehen darf, Aristoteles zu widersprechen.

Ambrosius Pareus, der die Natur als wahrer Wundarzt studierte, hatte deutlichere und bestimtere Begriffe von Hermaphroditen als Aristoteles wegen seines angegebenen Unterschiedes, der beym ersten Anblick alles erkennen läßt ; er hat Abbildungen davon hinterlassen, unter denen eine hermaphroditische Zwillinge vorstellet, die mit dem Rücken zusammengewachesen, gebohren sind.

Die besten Schriftsteller, welche diese Materie abgehandelt haben, sind dieser Eintheilung gefolgt, wie Casp. Bauhin ; er hat darüber ein weitläufige und sehr gelehrte Abhandlung geschrieben, Nicol. Venette Verfasser vom Tableau de l'amour confideré dans l'état du mariage, handelt gleichfalls davon in einem eignen beträchtlichen Capitel ; er folgt ohngefehr derselben Eintheilung, aber seine Erklärungen sind ganz dunkel. Martin Schurig in seiner Spermatologia historico - medica, giebt die sonderbarsten Beyspiele ; er folgt derselben Eintheilung.

Diese Schriftsteller, und viele andere vor ihnen, als Hippocrates, Galenus, Realdus, Columbus, Paul Aegineta, Fortunius Licetus, und andere haben sich bemühet zu erklären was sie als die Ursache der Erzeugung der Hermaphroditen glaubten, von der Art die ihnen bekandt war ; aber was sie hierüber geschrieben haben ist nicht hinreichend genug, um sich dabey aufzuhalten ; um wie alles, was ich selbst davon sagen könnte, nicht so sehr unterhalten würde, als die Erklärung dessen, was uns die Natur für Augen legt.

Divider

» De generatione animalium «
Aristoteles
Über die Zeugung der Geschöpfe ()
Deutsche Übersetzung (auf Basis des griechischen Textes)

» Reprint Verlag Schöningh (1975)«

» De hermaphroditorum monstrosorumque partuum natura (1614) «
» Caspar Bauhin «

» The workes of that famous chirurgion « » Ambroise Paré « (1649)
Of the Generation of Man - 24. Book (S. 590)
Of Monsters and prodigier - 25. Book (S. 648)

Des weiteren gilt es hervorzuheben, daß außer in spezifizierten Geschichtsfassungen, keinerlei Bezugnahmen zur hiesigen (vor allem 'indigen') Kultur anzutreffen ist, sondern wie nachfolgend verdeutlichend, Sachbezüge des geschriebenen Rechts und somit der Territorialrechte und damit verbundener Verhandlungsgebahren, zu dem man jedoch zwischenzeitlich auch die Gerichtsakten sichtet, um darüber konkreteres über den inhaltlichen Ablauf und somit den Wesensarten zu erfahren. Zumal die Rechtswesen auf römischen Rechtsverhältnissen beruhen, haben indess jedoch auch die Ergründungen rein formelle Gründe und werden aus dem jeweiligen Form- und Fachwesen heraus für das Gegenwartswesen aufbereitet, sodaß im Rechtswesen einzig die Inbetrachtziehung aus dem Gegenwarts- und römischen Recht, in der Biologie einzig die biologischen Verhältnisse, gemäß dem gerade diese auch ihre rückwirdenden Umschreibungen erfahren, wohingegen in der Medizin noch gar keine tatsächliche Geschichtsschreibung überhaupt existiert, aufgrund dessen Ursprunges der Umsetzung hierzulande durch das Kirchenwesen und der völligen Andersartigkeit der Neugenerierung des Gegenwartsverhältnisses, dem gegenüber man das Alte für Hokus-Pokus erklärt. Und was es gibt, darin bezieht man sich einzig auf das Arztwesen und somit nicht auf das von den Patienten, was als solches bis heute keine Dokumentation erfährt. Zu bedenken ist somit auch, inwiefern das eigentliche Subjekt - der Mensch - gemäß seines Subjekts, überhaupt sein Bildnis erfährt darin. Darüber hinaus ist vor allem jedoch auch der Sprachgebrauch zu bedenken, denn wie man Nachfolgendem entnehmen kann, so zeigt sich die jeweilige Kultur als solche, vor allem über die andersartigen Sichtweisen und Benennung der Gegebenheiten, dem man hingegen nur zu folgen braucht, um zum Jeweiligen der Beschreibung zu gelangen, wie sich über die Sexualbegriffe jedoch in aller Deutlichkeit aufweist, gar nicht praktiziert wird. Elementar ist dem gegenüber jedoch, wie nachfolgend beschrieben, daß in dem geschriebenen Recht von Anbeginn an, nicht nur die Hermaphroditen, sondern vor allem gerade über diese auch das männliche und weibliche Geschlecht als solches, ihre rechtliche Berücksichtigung fanden, indess dies mit dem neuerlichen bürgerlichen Recht seine Beendigung fand, aufgrund der Statuierung, daß keine Hermaphroditen existieren würden. Es handelt sich somit auch gar nicht um ein biologisches Geschlecht, wie es allgemeingültig verlautbart wird, sondern um ein rechtsgerichtetes Geschlecht, worüber sich von je her die Anwendung der Definition im Bezugsverhältnis jeglichen Formalwesens bestimmt. So dreht es auch nicht um das Geschlecht, was man allgemeingültig handhabt, sondern einzig um das rechtsgerichtete Statut, woraus die geschlechtliche Anerkennung resultiert. Und gemäß dem man in der Biologie dem entspricht, ergibt sich daran anhänglich auch daraus das rechtlich anerkannte biologische Geschlecht und eben nicht umgekehrt. Vielmehr bedingt es der Wissenschaft, dem rechtsgerichteten Geschlecht zu entsprechen. Achtet man auf die Vielfalt wissenschaftlicher Errungenschaften, so kann man darüber erfahren, daß es dies als solches darin gar nicht gibt, indess erfährt einzig seine popularisierende Anwendung, was dem einzig entspricht.


Nomos Verlag

Hermaphroditen im römischen Recht

Im römischen Recht waren Frauen deutlich schlechter gestellt als Männer. Sie konnten zum Beispiel nicht die Position des pater familias, also des Familienoberhaupts, bekleiden und waren somit von der gesetzlichen Vertretung ihrer eigenen Kinder (selbst der unehelichen) ausgeschlossen. Außerdem waren sie nicht als Zeuginnen bei förmlichen Rechtsgeschäften zugelassen, wozu etwa die Errichtung eines Testaments zählte. Ob eine Person als Frau oder als Mann galt, hatte folglich erheblichen Einfluss auf die jeweilige Rechtsposition. Römische Juristen setzten sich daher auch mit der Rechtsstellung intergeschlechtlicher Menschen auseinander, die sie mit dem aus dem Griechischen entlehnten Begriff hermaphroditus bezeichneten. Hermaphroditos war in der griechischen Mythologie das Kind des Götterboten Hermes und der Liebesgöttin Aphrodite, ein zweigeschlechtliches Wesen, das als Jüngling mit langem Haar und weiblichen Brüsten dargestellt wurde. Die klassischen römischen Juristen entwickelten verschiedene Zuordnungsregelungen: Ein Hermaphrodit sollte jenem Geschlecht gleichgestellt werden, "das bei ihm überwiegt" (Dig. 1, 5, 10 Ulpianus libro 1. ad Sabinum) oder "dessen Begierden sich ihn ihm regen" (Dig. 22, 5, 15, 1 Paulus libro 3. sententiarium).

Älteres deutsches Recht

Umstritten ist, ob auch die mittelalterlichen Rechtsquellen des deutschen Sprachraums Regelungen zur Rechtsstellung von intergeschlechtlichen Menschen kannten. Als wichtigstes deutsches Rechtsbuch des späteren Mittelalters gilt der Sachsenspiegel, in dem um 1220 Eike von Repgow das überlieferte Recht niederschrieb und der in Teilen bis ins 19. Jahrhundert in Geltung blieb. In seinem Landrechtsteil widmete sich der Sachsenspiegel vor allem den bäuerlichen Rechtsverhältnissen, der Lehnrechtsteil gab die Rechtsgewohnheiten hinsichtlich der Verhältnisse der Feudalherren untereinander wieder. Einige Handschriften des Sachsenspiegels enthielten eine Passage, deren Bedeutung nicht ganz geklärt ist und die sogenannte "altvile" vom Lehensrecht wie auch vom Erbrecht ausschloss. Einige Rechtshistoriker übersetzten "altvil" mit "allzuviel": Die Rechtsstelle bezöge sich folglich auf jene, die "zuviel" an menschlichen Gliedern hätten - nämlich weibliche und männliche. Die Vorschrift wurde als Aussage über die Rechtsstellung von intergeschlechtlichen Menschen verstanden. Seit dem Ende des 19. Jahrhunderts gilt diese Vorstellung als überholt. "altvile" bezeichne nicht Intergeschlechtliche, sondern Menschen mit psychischer Beeinträchtigung.

Erst durch den zunehmenden römischrechtlichen Einfluss gelangten Rechtsvorschriften in die heimische Rechtspraxis, die sich unzweifelhaft auf Intergeschlechtliche bezogen. Die Gründung von Universitäten - vor allem im italienischen Raum - bewirkte eine wissenschaftliche Auseinandersetzung mit dem römischen Recht. Glossatoren und Kommentatoren versahen die Schriften der klassischen römischen Juristen mit Erklärungen und passten das römische Recht an die Bedürfnisse der mittelalterlichen Lebenswelt an. Es entstanden zahlreiche Kommentare, Lehrbücher und Abhandlungen zu einzelnen juristischen Sachthemen. Große Bedeutung erlangte die Summa legum brevis levis et utilis aus dem 14. Jahrhundert. Dabei handelte es sich um ein von Raymundus Partenopensis verfasstes Lehrbuch zum weltlichen Recht, das vor allem in Österreich, Böhmen, Polen und Ungarn Verbreitung fand. Die Summa legum war nicht nur auf Latein, sondern auch auf Frühneuhochdeutsch verfasst. Das bedeutete, dass auch weniger gelehrte Praktiker darin lesen konnten. Hinsichtlich des "Standes der Menschen" unterschied die Summa legum drei Kategorien:

"Allen menschen sein entweders man oder frawen oder ermofrodite, (verstee ains teils man, eins tails weib.)" (Cap. 1.21)

Mit dieser Aufzählung war allerdings keine Anerkennung von Intergeschlechtlichen als eigenem Geschlecht mit entsprechender Rechtsstellung verbunden. Wie die Rechtsposition intergeschlechtlicher Menschen zu beurteilen war, klärte die Summa legum unter Rückgriff auf jene Kriterien, die bereits das römische Recht entwickelt hatte:

"Die hermofrodite in irem geschlecht, in welchen sie mehr taugent (oder vermugent), nach dem wirt er geacht." (ebd.)

Eine eigenständige Lösung hatte das kanonische Recht entwickelt: Wenn bei intergeschlechtlichen Menschen kein Geschlecht "überwog", konnten sie ihre Geschlechtszugehörigkeit frei wählen. Hier zeigte sich erstmalig eine Anerkennung des subjektiven Empfindens. Gleichzeitig mit der Wahl mussten intergeschlechtliche Menschen allerdings der jeweils anderen Geschlechtsrolle durch Eidleistung abschwören. Ganz ähnlich regelte der Codex Maximilianeus bavaricus civilis den Umgang mit intergeschlechtlichen Menschen. Der Codex Maximilianeus stammt aus dem Jahr 1756. Er steht ideengeschichtlich zwar an der Schwelle zu den großen Naturrechtskodifikationen, wie etwa dem französischen Code civil oder dem österreichischen Allgemeinen bürgerlichen Gesetzbuch, gehört selbst jedoch noch einer früheren Periode der Rechtsentwicklung an. Der Codex Maximilianeaus wollte weniger neues Recht schaffen, als vielmehr das gültige Recht sammeln. Subsidiär galt weiterhin das "gemeine Recht" (also das römisch-kanonische Recht des Mittelalters und der Frühen Neuzeit).

Für intergeschlechtliche Menschen traf der Codex Maximilianeus recht detaillierte Regelungen: Primär sollten Sachverständige die Geschlechtszugehörigkeit beurteilen. Kamen sie zu keinem Ergebnis, dann konnten Intergeschlechtliche selbst wählen, durften allerdings von der einmal getroffenen Wahl nicht abweichen. Taten sie dies doch, drohte dieselbe Strafe wie bei einem crimen falsi. Als crimen falsi fasste das gemeine Strafrecht eine Reihe von Delikten zusammen, denen eine Täuschungsabsicht zugrunde lag und die schwer - häufig mit dem Tod - bestraft wurden.

Mit dem Preußischen Allgemeinen Landrecht aus 1794 trat nicht nur das Selbstwahlrecht für intergeschlechtliche Menschen deutlich in den Vordergrund, es brachte auch eine stärkere Berücksichtigung der sozialen Dimension des Geschlechts mit sich: Kam ein intergeschlechtliches Kind zur Welt, hatten zunächst die Eltern zu entscheiden, ob es als Mädchen oder als Bub erzogen werden sollte. Nach Vollendung des achtzehnten Lebensjahres konnten Intergeschlechtliche selbst ihre Geschlechtszugehörigkeit wählen:

"Nach dieser Wahl werden seine Rechte künftig beurteilt." (Paragraf 20 PrALR)

Nur dort, wo die Geschlechtszugehörigkeit Auswirkungen auf die Rechte Dritter hatte, überwog das Urteil von Sachverständigen.

Eindeutigkeit im Recht

Den dargestellten Rechtsvorschriften ist eines gemein: Sie hielten die Existenz von Menschen, die weder weiblich noch männlich waren, zwar nicht für alltäglich, aber doch immerhin für möglich. Bis wann und in welchem Umfang in der Rechtspraxis Geschlechtseide und Wahlrechte tatsächlich vorkamen, geht aus den einzelnen Kodifikationen freilich nicht hervor. Im 19. Jahrhundert verschwinden die Bezugnahmen auf intergeschlechtliche Menschen aus den Gesetzeswerken. Im französischen Code civil, dem österreichischen Allgemeinen bürgerlichen Gesetzbuch oder dem deutschen Bürgerlichen Gesetzbuch sucht man sie vergeblich. Franz von Zeiller, der die Endredaktion des Allgemeinen bürgerlichen Gesetzbuches besorgte und als "Vater" des heute noch geltenden Gesetzes gilt, hielt in seinem "Commentar zum allgemeinen bürgerlichen Gesetzbuch" fest: Die Existenz von "Zwittern" werde "von neueren Aerzten bestritten". (zu Pragraf 21 ABGB)

Entscheidenden Einfluss auf die österreichische Rechtswissenschaft übte ab Mitte des 19. Jahrhunderts Joseph Unger aus. Er bereitete den Weg für eine vornehmlich an der deutschen Pandektenwissenschaft orientierte Privatrechtsdogmatik. Unger war mit dem klassischen römischen Recht und mit den deutschen Partikularrechten vertraut und kannte die darin enthaltenen Vorschriften zur Rechtsstellung von Intergeschlechtlichen. Mit Blick auf die österreichische Rechtslage schrieb Unger:

"Zwitter, bei denen eine gleiche Mischung der Geschlechter stattfinden soll und welche daher in juristischer Beziehung weder als Mann noch als Weib anzusehen wären, werden vom Recht als nicht vorhanden angenommen."
(System des österreichischen allgemeinen Privatrechts, Band I, 1856, Seite 279)

Elementar hierin ist, daß die Ergründungen der Geschlechtlichkeit dazu geführt haben, daß ein Jahrtausende gepflegtes Verhältnis auf einmal nicht mehr existiert. Auf einmal ist alles ganz anders. Es existiert einzig noch das Männliche und das Weibliche für sich, gemäß seiner Getrenntheit des Fortpflanzungswesens und was dem nicht eindeutig entspricht, ist darin unvollständig ausgebildet. Die Gegebenheit wird hierin regelrecht kastriert, worin es doch darum ging, daß es sich bei den Hermaphroditen doch um ein Mehr handelte, dessen Inbetrachtziehung es zuvor erfuhr. Das eigentlich Gravierende ist jedoch, daß sowohl als auch der Gegebenheit entspricht, denn wie sich über die weiteren Ergründungen aufzeigen, so erfährt darin zum Einen das Verhältnis der Unausgebildetheiten des einen Geschlechts eine Ausbildung des anderen Geschlechts, dem gegenüber sich hingegen auch ein gleichermaßen darüber Hinausentwickelndes - sich ein dem gemäß davon (synonym) Differenzierendes - daneben stellt, dessen Unterscheidung jedoch nicht mehr seine erforderliche Erachtung erfährt (und gemäß der Bisexualität gebährend aus dem Raster fällt!). So zeigt sich auch hierüber, daß man sich einzig von der einen Warte in eine Andere begeben hat, was regulär überhaupt sich als das leitende Entwicklungswesen darlegt. In Jeglichem trifft man auf eine Umkehr um 180 Grad, sodaß einzig andere Warten und darüber Bestandteile ersichtlich werden, worüber zuvor Ersichtliches gar nicht mehr in Erscheinung tritt. Und so gelangt man auch überhaupt erst über die Beschäftigung mit Beidem zu einer tatsächlichen Gesamtsicht. Zu bedenken ist dazu jedoch, daß die Sexualität nicht das Einzige ist, worüber sich die Persönlichkeit heraus ergibt, sondern nur ein anteiliger Bestandteil. Gerade dies wird jedoch nirgends in Betracht gezogen, sodaß man gerade dies auch gar nicht in Erwägung zieht. So steckt in der Fixierung auf das körperliche Geschlecht vor allem auch eine manipulierende Maßnahme, um nämlich gerade darüber nicht zu diesem elementaren Bestandteil zu gelangen, welcher nämlich gar nicht über das Körperliche erklärlich ist. Gerade aus diesen Verhältnissen gilt mein Blick jedoch auch auf die alten Herkünfte, da es darin noch enthalten ist, die Wesensschau Mensch, dem gegenüber man im Verlaufe des 20. Jahrhunderts, sich völlig davon entfernt hat und erst einmal eine Sozialwissenschaft in Erscheinung treten muß, um darauf aufmerksam zu machen, wie es sich damit stellt. Es ist schon gravierend, was sich darüber darbietet, denn zuvor war das Geschlechtswesen als solches gar nicht selbst Inbetrachtziehungsgegenstand, hingegen jedoch bis auf den Grund gehend später, indess ist es in dem Vorigen überhaupt ersichtlich, indess im späteren nicht mehr. Wie gesagt, es existiert nichts für sich isoliert, indess schaute man einst einzig in die eine Richtung und in den Neuerungen einzig in die Andere und in beidem ist tatsächlich das Selbst einzig aus diesen beiden Perspektiven heraus gesehen, jedoch nicht aus dessen Perspektive des Selbst, sodaß es auch in weder noch als solches tatsächlich in Erscheinung tritt und treten kann, da es darin gar nicht beinhaltet ist.

Hierzu gilt es sich aber auch zu verdeutlichen, wie es überhaupt dazu kam, denn wie man Nachfolgendem entnehmen kann, war die Inbetrachtziehung zu jener Zeit wahrlich noch auf des Menschen ganzheitliches Erscheinungswesen hin ausgerichtet, hingegen wandelt sich dies kontinuierlich bis hin zur Inbetrachtziehung der Gene und Chromosomen und somit zu etwas, was dem Menschen selbst gar nicht ersichtlich ist. Es ist die Technik, welche den Menschen zwischenzeitlich darlegt, nicht mehr der Mensch selbst. Was hierin jedoch nicht bedacht wird ist, daß die Technik eine Sache von Leblosigkeit ist. Wie kann somit eine Leblosigkeit das Leben ermessen? Nämlich gar nicht, hingegen gelangt man zu dem, was einst bereits Descartes aufbrachte, daß der Mensch nichts anderes sei, als eine Maschine. Und gemäß dem erfährt man auch die Inhaltlichkeit der Beschreibungen, zumal man das Gehirn als zentrale Steuerungseinheit beschreibt, wohingegen doch bereits die Phrenologie- und Lokalisationslehre als solche einst verworfen wurde, da die pathologischen Ergründungen nicht nur darlegten, daß es sich nicht derart verhält, sondern auch, wie es sich tatsächlich verhält und das Gehirn einzig ein Zusätzliches ist und nichts mehr. Wie kommt es jedoch dazu, zeigt sich darüber, daß sich weder das Staats-, noch das Wissenschaftswesen, aus ihrer präsenten Gegebenheit heraus gebähren kann - es bedingt diesen der Expansion, worüber sie sich einzig nähren - Mehrwert und Steuer befördern das inhaltliche Wesen und das erweist sich als das eigentliche Steuerruder, worüber sich die Gegebenheiten ergeben. Es wird als Fortschritt verkauft und darüber gelingt auch das Verdecken dessen, jedoch vermag es die damit einher gehende Zerstörung nicht! So war gerade das 18., vor allem jedoch das 19. Jahrhundert, elementar bezüglich der Erkenntnisbildungen zur Präsenz der Körperlichkeit, worüber vielfältiges zur Sichtung gelangte, was in späterer Zeit gar nicht mehr vorhanden scheint. Speziell was die Lehren betrifft, so ist es gerade darin besonders prekär, da speziell darin einzig das Aktuelle als Lehrgrundlage gilt, hingegen darüber auch fortwährend das Alte verworfen wird und darüber dieses Mißwesen seine Verbreitung findet. Auch hier wiederum gilt mustergültig, was sich über die Anatomie aufweist, daß die Theorien und die Praxis zwei Welten repräsentieren und diese sich elementar voneinander unterscheiden. Da hierin prinzipiell keine Autodidakten, sondern einzig Belehrte die Präsenz bilden, ergibt sich daraus dann auch der entsprechende Bumerangeffekt und vor allem auch die stattfindende Abschneidung gegenüber dem Allgemeinwesen. Man spricht darin nicht nur eine andere Sprache, sondern händelt auch etwas ganz anderes, als der Mensch ersieht und wird diesem aber auch erst ersichtlich, wenn er sich dort hinein begiebt.


Zweiter Teil
Palm'sche Verlagsbuchhandlung

§ 117 a - II. Eintheilung der Menschen in Rücksicht auf das Geschlecht.

II. In Rücksicht auf das Geschlecht sind die Menschen entweder männlichen oder weiblichen Geschlechts. Ob es nicht noch eine dritte Menschengattung gebe, nämlich solche, welche beyderley Geschlechts zugleich sind, ist noch nicht entschieden. Man pflegt sie Zwitter oder Hermaphroditen zu nennen. Die Gesetze unserer Pandecten gedenken ihrer an verschiedenen Orten. Sie stellen den Grundsatz fest, daß man die Hermaphroditen zu demjenigen Geschlecht zählen müsse, dem sie am ähnlichsten sind (Nach dem allgemeinen Preuß. Staaten 1. Th. 1. tit. § 19. ff. bestimmen die Eltern, zu welchem Geschlecht sie erzogen werden sollen. Jedoch steht einem solchen Menschen, nach zurückgelegtem achtzehnten Jahre, die Wahl frey, zu welchem Geschlecht er sich halten wolle. Nach dieser Wahl werden seine Rechte künftig beurtheilt.). Während sie also dem überlegenen Geschlecht nach männlich, so würden sie als Mannspersonen anzusehen seyn. Prävalierten aber bey ihnen die Kennzeichen des weiblichen Geschlechts, nämlich Geburtstheile, Stimme, Brüste, und übriger körperlicher Bau, so würde man sie zu diesem Geschlechte rechnen müssen. Zu Folge dieses Grundsatzes entscheiden nun die Gesetze all die sie betreffenden Rechtsfragen, wobey es auf den Unterschied des Geschlechts ankommt. Z. B. ob ein Hermaphrodit als Testaments-Zeuge gebraucht werden könne. Allein die neuern Aerzte *) wollen es gänzlich läugnen, daß es wahre Zwitter gebe. Die weitere Untersuchung liegt ausser meiner Spähre.

*) » G. Duverney « » Oeuvres anatomique [1761] « T. II. p 369.
» Valmont « de Bomare Dictionn. d' Historie natur. art. Hermaphrod [1764-1800].
» Teichmeyer « » medicin. legal. [1723] « p. 99.
» Faselius « » elem. medicin. legal. [1741-1772] « § 40.
Arnaud » über die Hermaphroditen [übers. 1777] «. Tab. I-IV.
» Metzgers « » kurzgef. System der gerichtlichen Arzneywisschenschaft [1793] « § 496. u. 497.
und » Ploucquet « » über die physischen Erfordernisse der Erbfähigkeit [1779] «

In Absicht auf die Eintheilung der Menschen in Manns- und Weibspersonen ist nun noch zu bemerken

1) daß die Namen Weib oder Frau und Mann überhaupt die ganze Geschlechtsgattung bezeichnen, ohne Unterschied, ob eine Person verheyrathet, oder ledig ist. Eben so werden auch die lateinischen Benennungen mulier und femina in unseren Gesetzen von allen Personen weiblichen Geschlechts gebraucht, ohne Unterschied, sie mögen Jungfern, Eheweiber oder Witwen seyn; so wie in einer eben so weitläufigen Bedeutung das Wort vir all Perseonen männlichen Geschlechts, sie seyen Männer oder Knaben, bezeichnet.

2) Zwischen beyden Geschlechtern findet zwar ein merklicher Unterschied der Rechte statt, doch gilt im allgemeinen die Regele, daß ordentlicher Weise Manns- und Weibspersonen gleiche Recht zu genießen haben, in sofern nicht die Gesetze in einzelnen Fällen einen Unterschied in Ansehung des Geschlechts machen. Hieraus folgt, daß wenn ein Gesetz überhaupt etwas verordnet, ohne die Weibspersonen aufzunehmen, solches auch mit auf dieselben zu erstrecken sey. So z.B. kommen die dem Erben zu Gunsten verordnete Rechtswohlthaten allerdings den weiblichen Erben so gut als den männlichen zu statten. Ja, wenn auch in einem Gesetz nur des männlichen Geschlechts vorzüglich wäre gedacht worden, so ist deswegen das weibliche nicht gleich für ausgeschlossen anzusehen, wenn nicht das Gegentheil entweder aus dem Geist und dem Gegenstande des Gesetzes, oder aus andern Gesetzen deutlich erhellet. Es ist also immer nur Ausnahme von der Regel, wenn die Gesetze in manchen Stücken dem männlichen Geschlecht Vorzüge vor dem weiblichen geben, in andern Fällen aber dem weiblichen Geschlecht wieder Vortheile zugestehen, an welchen das männliche keinen Antheil nimmt. Diese Ausnahmen sind nun aber freylich sehr erheblich, und beruhen auch nicht auf einem und demselben Grunde, sondern sind aus verschiedenen Quellen herzuleiten. Die Gesetzgeber selbst haben bey Bestimmung der besondern weiblichen Rechte verschiedene Gründe ihrer Legislation angegeben.

1) Die erste und vorzüglichste Quelle ist unstreitig in dem eigenthümlichen Charakter des weiblichen Geschlechts, in ihrer körperlichen Beschaffenheit, und der Hauptbestimmung derselben zum Kindergebähren, und zur Versorgung des Hauswesens, zu finden. In dieser Rücksicht wird

a) den Frauenspersonen eine gewisse Schwäche des Geschlechts zugeschrieben, welche in unsern Gesetzen nicht nur als die Ursache angegeben wird, warum Frauenspersonen keine Bürgschaft gültig übernehmen können, sondern warum sie auch überhaupt von öffentlichen Aemtern ausgeschlossen sind.

Unter jene Schwäche des Geschlechts, oder wie sich die Gesetze eigentlich ausdrücken, sexus imbecillitas, infirmitas fueminarum, ist jedoch nicht sowohl Mangel des Verstandes, als welcher ihnen von den Gesetzen keineswegs abgesprochen wird, auch nicht natürliche Schwachheit des Körpers zu verstehen, sondern vielmehr

1) eine gewisse gutmüthige, dem weiblichen Geschlecht, natürliche Neigung, sich andern gefällig zu beweisen, vermöge welcher sich Frauenspersonen, im Vertrauen auf die Redlichkeit Anderer, nur gar zu leicht pflegen zu Handlungen bewegen zu lassen, die ihnen zu großem Nachtheil gereichen können. Aus diesem Grunde will daher der Vellejanische Rathschluß die Frauenspersonen auch nur in den Fällen schützen, wo sie eine fremde Verbindlichkeit aus bloßer Gefälligkeit übernommen hatten, ihr Vermögen zu des Schuldners Besten aufzuopfern. Wegen eben dieser dem weiblichen Charakter eigenen Gutmüthigkeit sind ferner Frauenspersonen an vielen Orten einer beständigen Curatel untergeordnet.

2) Heißt auch Schwäche des weiblichen Geschlechts eine von der Erziehung sowohl als der diesem Geschlecht wesentlichen Bestimmung zum Kindergebähren herrührende Unfähigkeit, männliche Arbeiten, welche eine ausdauernde Anstrengung des Körpers, und öffentlichen Aemter, welche Einsichten und Gelehrsamkeit erfordern, zu versehen. Deswegen sind zwar Frauenspersonen in der Regel von allen öffentlichen Aemtern ausgeschlossen, doch mache die Regentinen hiervon eine sehr bedeutsame Ausnahme; so wie auch bey Vormundschaften die Mütter und Großmütter, als welche Vormünderinnen ihrer Kinder werden können, bekannten Rechten nach ausgenommen sind.

Dem weiblichen Charakter wird

b) eine vorzügliche Sittsamkeit und Schamhaftigkeit (pudicitia sexui congruens) zugeeignet. Deswegen dürfen Frauenspersonen

1) überhaupt keine negotia virilia d.i. keine solche Geschäfte vornehmen, wobey die Gesetze nur Mannspersonen zulassen. So z.B. verbieten ihnen die Gesetze, für andere vor Gericht zu postulieren, sie können ferner bey solchen Geschäften nicht Zeugen seyn, wo mehr als zwey Zeugen Feyerlichkeit wegen erforderlich sind, z.B. bey Testamenten und Codicillen. Wo es hingegen blos auf Wahrheit ankommt, da ist das Zeugniß der Frauenspersonen eben so vollgültig, als das Zeugniß der Männer. Nach teutschen Rechten machen auch Handelsgeschäfte eine Ausnahme von jener Regel, als von welchen die Frauenspersonen nicht ausgeschlossen sind. Es ist vielmehr zur Sicherheit und Begünstigung des Handels heutiges Tages der Grundsatz angenommen, daß alle diejenigen Rechtswohlthaten, die sonst den Weibern, wegen der Schwäche ihres Geschlechts, in Ansehung ihrer bürgerlichen Rechstgeschäfte verliehen sind, solche Frauenspersonen nicht zu statten kommen, welche entweder auf eigenen Gewinn und Verlust, oder gemeinschaftlich mit ihrem Manne, vermöge einer zu dem Zweck eingegangenen besondern Gesellschaft, Handlung treiben, und welche daher im eigentlichen Verstande Kauffrauen (feminae mercatrices) genennt werden. Eine Kauffrau kann sich daher in den Handelsgeschäften nach Wechselrecht verbinden, und hat sie Beziehung auf ihren Handel ein Bürgschaft übernommen, so kann sie sich auf den Vellejanischen Rathsschluß nicht berufen.

2) Aus eben dem Grunde der weiblichen Schamhaftigkeit verordnen ferner die römischen Gesetze, daß keine Frauensperson, wenn sie auch des schwersten Verbrechens schuldig wäre, ins Gefängnis gesetzt, sondern dieselbe entweder in einem Kloster verwahrt, oder andern sichern Weibern zur Aufsicht übergeben werden solle, damit ihre Keuchheit durch Inhaftierung nicht in Gefahr gesetzt werde. Jedoch findet dieses Vorrecht des weiblichen Geschlechts nach der gegründeten Bemerkung practischer Rechtsgelehrten heutiges Tages nicht mehr statt.

Zu dem eigenthümlichen weiblichen Charakter gehört endlich

c) die frühere Mannbarkeit und Reife des weiblichen Geschlechts zur Kinderzeugung. Sie werden daher um zwey Jahre eher mündig als Mannspersonen, können früher testiren, früher heyrathen u.d.

II) Eine andere Hauptquelle besonderer weiblicher Rechte ist die gesetzliche Oberherrschaft des Ehemannes über die Frau, und die überhaupt durch die Ehe entstehende genaueste und innigste Vereinigung zwischen Eheleuten. Denn so wie deshalb zwar die Frau an der Würde und dem Stande des Mannes Antheil nimmt, dessen Namen führt, und den nämlichen Gerichtstand hat; so entstehen daraus auch wieder auf der andern Seite manche unangenehme Folgen. Denn da die Frau selbst der Gewalt des Mannes unterworfen ist, so kann sie keine solche Gewalt über ihre Kinder haben, dergleichen die Gesetze nur dem Vater geben. Eine wichtige Folge davon ist, daß Frauenspersonen keine suos heredes haben können, qui foeminae in potestate liberos non habent, wie Justinian sagt. Da ferner die Ehefrau durch ihre Verheyrathung den Namen ihrer Familie mit dem Namen, Stand und Würde ihres Mannes vertauscht, und die Kinder, welche die Hausmutter während der Ehe zur Welt bringt, nicht zu ihrer, sondern allemal zur Familie des Vaters gerechnet werden, so erhält hieraus der Ausspruch Ulpians sein Licht, mulier familiae suac finia est; und eben dies ist auch der Grund, warum Frauenspersonen in Familien Fideicommisse und solche Güter, welche nach der Absicht des Erwerbers bey seiner Familie, das heißt, sinen männlichen Nachkommen unversehrt verbleiben sollen, so lang ein männlicher Seccessor vorhanden ist, weder succediren, noch solche Güter, wenn sie außer der Familie veräußert worden sind, retrahiren können. Denn durch sie wird die Familie nicht erhalten.

III) Daß endlich manche besondere weiblichen Rechte nur Billigkeit zum Grunde haben, beweisen die Worte des R. Justinians: Quis mulinerum non misereatur propter obsequia, quae maritis praestant, propter partus periculum et ipsam liberorum procreationem, pro quibus multa in legibus nostris inventa sunt privilegia, ich will auch nicht gerade läugnen, daß Zärtlichkeit und Eifersucht, vielleicht auch Justinians Gemahlin die Theodora an einigen Vorzügen und Rechten des schönen Geschlechts Antheil haben könne.

So wird aber auch erst über die Parallelerachtung deutlich, wie es sich mit der tatsächlichen Entwicklung bezüglich der sexuellen Orientierung verhält und hierin das übernommen wird, was sich über das Geschlechtswesen darlegt. Darauf basiert das Verhältnis, was vor allem über Kinsey seine offizielle Darlegung erfährt, worin man auf der einen Seite die Heterosexualität und auf der anderen Seite die Homosexualität antrifft und darüber ein Dazwischenliegendes attestiert, was man als Bi-/Ambisexualität deklariert. Grundlage ist hierin eben auch das Geschlecht, obwohl doch gerade das Geschlechtswesen durchweg aufweist, daß das körperliche Geschlecht, die Geschlechtsidentität und auch die sexuelle Konstitution, nicht miteinander im Verbund einher gehen, sondern jeweilige Eigenwesen aufweisen. Zumal man in jeglichem körperlichen Verhältnis keinerlei Grundlagen erlangen kann, für diese Differenziertheit, bindet man es trotz dessen an den Körper. Warum? Weil es darin keine Alternativen gibt. So gilt aber auch gleichermaßen für die Hermaphroditen das einzige Prinzip, was darin möglich ist, nämlich als Gegenstand der Abnormalität erachtet zu werden, der, wie man dessen Verlauf entnehmen kann, zum Schluß nichts anderes mehr Handlungsgegenstand ist, als dies zu beseitigen und man sie kastriert. Und auch hier wiederum gleiches Verhältnis, wie bei den Bisexuellen, worin die Grundlage der Monogamie des zu Zweit sie gleichermaßen kastriert, indem man es als Polygamie stellt und darüber die Inhalte masakriert. Die Norm ist das Einzige was zählt und DAS ergibt sich als Resultat jahrhundertelanger Erforschung, daß es letztendlich zu nichts anderem dient, als einzig die Norm zu wahren. Wie man darüber ersehen kann, ist tatsächlich der Fortschritt nicht dazu da, um zu verändern, sondern im Gegenteil, um zu bewahren, was die Grundlage des Daseins repräsentiert. Indess deklariert man den Fortschritt obendrein noch als Aufklärung, sodaß dies letztendlich mehr zerstört, als es in irgend einer Weise fördert. Wie jedoch bereits der Volksmund sagt - "wie der Herr, so's Geschärr" - so findet man gerade darüber auch den Durchblick über die Gegebenheiten, die aus zwei klaren, sich gegenüberstehenden Seiten bestehen, hingegen das Dazwischenliegende für das Irrwesen Sorge trägt, sodaß es auch mir an dieser Stelle noch einmal Kinsey's Worte hervorzuheben gilt, daß die Unterscheidung, welche man gerade darin antrifft, die eigentliche Klärung erbringt. Gemäß dem gilt es mir auch das klärende Verhältnis zur Bisexualität darzulegen und zu vermitteln, worüber sich auch das Weitere klärt, gemäß seiner darüber entstehenden Klarheit. Maßgeblich hierin ist, daß die miseren Handlungswesen, einzig im Bezug auf die Unklarheiten derart stattfinden können, sodaß es sich als unausweichliche Bedingung stellt, daß sie ihre Aufklärung erfahren.

Hermaphroditen - Medizinische, juristische und theologische Texte aus dem 18. Jahrhundert


Medizinische, juristische und theologische
Texte aus dem 18. Jahrhundert

Psychosozial-Verlag
Maximilian Schochow, Florian Steger

Im Jahr 2012 veröffentlichte der Deutsche Ethikrat seine Stellungnahme zur Intersexualität. Diese Stellungnahme, die vielfältig und kontrovers diskutiert wurde, enthielt unter anderem Vorschläge zur Stärkung der Selbstbestimmung intersexueller Menschen, zum Abbau bürokratischer Hürden sowie zur Änderung des Personenstandrechts. Vor allem der letztgenannte Vorschlag, ein drittes Geschlecht einzuführen und damit die binäre Geschlechterordnung aufzuheben, wurde als ein längst überfälliger Schritt hervorgehoben und begrüßt. Aus der Perspektive des 17. und 18. Jahrhunderts scheinen diese gegenwärtigen Diskussionen in gewisser Weise anachronistisch. Bereits 1794 wird mit dem Allgemeinen Landrecht für die Preußischen Staaten reflektiert, dass nicht alle Neugeborenen geschlechtlich eindeutig männlich oder eindeutig weiblich sind. Diese Tatsache ist mit den sogenannten »Zwitter«-Paragraphen des Allgemeinen Landrechts für die Preußischen Staaten insofern rechtlich anerkannt, als die Eltern bestimmen können, zu welchem Geschlecht sie ihr Kind erziehen. Darüber hinaus hat ein Zwitter nach dem 18. Lebensjahr die freie Wahl, in welchem Geschlecht er künftig leben wolle und genießt die entsprechenden Rechte.

Hermaphroditen oder Zwitter sind im 17. und 18. Jahrhundert nicht nur ein Gegenstand des Rechts. Vielmehr werden sie in dieser Zeit in sehr unterschiedlichen Kontexten thematisiert. Gleich zu Beginn des 17. Jahrhunderts erscheint ein Kompendium des Schweizer Anatomen und Botanikers Caspar Bauhin (1560-1624), in dem eine Vielzahl von Berichten, Erzählungen und Geschichten über Hermaphroditen seit der Antike zusammengefasst ist. Kurz darauf wird in Frankreich der Gerichtsprozess gegen Marie/Marin le Marcis veröffentlicht, in dem die Ärzte Jacques Duval (1555-1620) und Jean Riolan (1577-1657) als Gutachter auftreten, um das »wahre« Geschlecht von Marie/Marin le Marcis zu bestimmen. Mitte des 17. Jahrhunderts erscheinen zahlreiche literarische Verarbeitungen - beispielsweise die anonyme Sammlung französischer Liebesgeschichten, in denen unter anderem die Verwechslungskomödie 'Die schöne Hermaphroditin' enthalten ist. Schließlich folgen in der zweiten Hälfte des 17.Jahrhunderts unzählige Berichte bzw. Protokolle über Untersuchungen von Hermaphroditen, die von Naturforschern und Ärzten durchgeführt wurden, etwa 1684 vom Ulmer Arzt Johann Scultetus (1595-1645). Diese meist mit Abbildungen versehenen Abhandlungen bilden noch Ende des 17. Jahrhunderts die Grundlage für Nicolas Venettes (1633-1698) Tableau der Hermaphroditen oder Zwitter. Darin fasst Venette Hermaphroditen zu fünf Arten zusammen: drei männliche Arten, eine weibliche Art und eine Art, bei der kein Geschlecht dominant ausgeprägt ist. Dieses Tableau bildet im 18. Jahrhundert die Vorlage für viele Klassifizierungen von Hermaphroditen und fließt in Standardwerke des 18. Jahrhunderts ein. Auch Denis Diderot (1713-1784) bezieht sich in der Encyclopédie auf Venette und fügt im Supplementband eine Kupfertafel mit vier Darstellungen von Hermaphroditen an, von denen zwei auf dem Cover abgebildet sind. In dieser Darstellung werden sie nicht über das gonadale Geschlecht, welches die inneren Genitalien bestimmt, sondern ausschließlich über die Stellung des genitalen Geschlechts, den äußeren Genitalien, definiert. So stehen beim weiblichen Hermaphroditen die weiblichen über den männlichen äußeren Genitalien.

Jenseits der vielen einzelnen Beschreibungen von Hermaphroditen, die seit der zweiten Hälfte des 17. Jahrhunderts veröffentlicht werden, sind eine Reihe von Texten zu finden, in denen sich Ärzte, Naturforscher und Juristen jeweils zu einem Hermaphroditen äußern. Beispielsweise diskutieren Anfang des 18. Jahrhunderts Ärzte, Naturforscher und Juristen aus England und Frankreich über den Hermaphrodit Marguerite/Arnaud Malaure und besprechen in Form von Briefen, Einzelblattveröffentlichungen oder mehrseitigen Abhandlungen, welches Geschlecht bei Malaure dominiere oder ob es wahre Hermaphroditen gebe. So entwickeln sich internationale und interdisziplinäre Netzwerke des Wissens um Hermaphroditen. Solche Netzwerke aus medizinischen, juristischen und theologischen Diskursen um Hermaphroditen sind in der bisherigen Forschung kaum berücksichtigt worden. Dies ist insofern erstaunlich, als Hermaphroditen vor allem im 17. und 18. Jahrhundert sehr mobil waren und durch Europa fuhren, um sich Interessierten aller Fachgebiete gegen eine finanzielle Entschädigung zu präsentieren. Unter anderem zeigte sich der Hermaphrodit Michel Anne Drouart 1750 in London, reiste 1753 nach Kopenhagen und 1755 nach Genf, ließ sich 1762 in Dijon, 1763 in Brieg oder 1765 in Nürnberg und 1767 in Paris von Ärzten untersuchen. So vielfältig die Reiseziele waren, so unterschiedlich wurde sie klassifiziert; beispielsweise als männlicher Hermaphrodit, als weiblicher Hermaphrodit und sogar als vollkommener Hermaphrodit. Während ihrer Reisen führte Drouart die Protokolle der vorangegangenen Untersuchungen mit sich, sodass die Anatomen und Chirurgen jeweils auf die vorherigen Klassifizierungen reagieren konnten.

Interdisziplinäre Netzwerke aus Ärzten, Juristen oder Theologen werden auch im vorliegenden Band anhand edierter Originaltexte aus dem beginnenden 18. Jahrhundert sichtbar. Im Mittelpunkt der Edition stehen zwei Hermaphroditen: Zum einen der Hermaphrodit M. W., dessen »wahres« Geschlecht im Verlauf eines Scheidungsprozesses bestimmt wurde, und zum anderen der weibliche Hermaphrodit Sempronia, welcher der Sodomie verdächtigt wurde. Bei den hier zum ersten Mal zusammengestellten sieben Originaltexten und zwei deutschen Übersetzungen aus dem Lateinischen handelt es sich um Beiträge von Ärzten, Juristen und Theologen. Die Originaltexte sind nicht nur medizinische Gutachten und Abhandlungen, sondern juristische Beurteilungen und Traktate zu den beiden Hermaphroditen sowie eine theologische Abhandlung zu einer der beiden Personen. Die Autoren der Originaltexte nehmen jeweils Bezug auf die Positionen der anderen Autoren und diskutieren die Perspektive vor dem Hintergrund ihrer fachlichen Herkunft.

Die Auseinandersetzungen um den Hermaphroditen M. W. werden von dem Arzt Johann Krus aus Schleswig sowie Carl Friedrich Luther (1663-1744), Arzt und Hochschullehrer aus Kiel, geführt. Ergänzt wird diese Debatte um Ausführungen des Theologen Christian Gottlieb Koch (? 1736). Im Mittelpunkt der Auseinandersetzung steht der Hermaphrodit M. W. und die Frage, ob und auf Grundlage welcher Voraussetzungen dieser zur Ehe befähigt ist. Die Frage, ob grundsätzlich Hermaphroditen zur Ehe fähig sind, war im 16. und 17. Jahrhundert sehr strittig. Der Arzt und Naturforscher Ulisse Aldrovandi (1552-1605) vertrat beispielsweise die Position, dass Hermaphroditen generell entsprechend ihres dominierenden Geschlechts heiraten können. Dahingegen schränkte der Jurist Jacob Möller (? 1693) diese generelle Erlaubnis ein, indem er die Ehefähigkeit an die Reproduktionsfähigkeit eines Hermaphroditen knüpfte. Jeder Hermaphrodit müsse sich vor der Heirat einer medizinischen Untersuchung unterziehen, in deren Rahmen die Funktionsfähigkeit des dominierenden Geschlechts nachzuweisen sei. Diese Meinung vertrat auch Nicolas Venette, wenn er die Ehefähigkeit an die Voraussetzung band, dass Hermaphroditen die Ehe mit einem der beiden Geschlechter vollziehen können müssen.

Vor dem Hintergrund dieser sehr unterschiedlichen Positionen wird der Hermaphrodit M. W. am 3. November 1703 auf Order der »Hohen Landes Obrigkeit« sowie des »Ober-Consistorial-Gerichts« und in Gegenwart von zwei Chirurgen sowie von Johann Krus untersucht. Im Ergebnis kommt Krus zu dem Schluss, dass bei M. W. das männliche Geschlecht dominiert, er aber impotent und demzufolge zur Ehe nicht fähig sei. Carl Friedrich Luther, der 1704 eine Dissertation über die Anomalien des Herzbeutels, der Lunge und der Genitalien in lateinischer Sprache verfasst, greift die Untersuchungsergebnisse von Johann Krus in seiner Dissertation auf und kritisiert diese scharf. Krus habe ausschließlich die äußerlich sichtbaren phänotypischen Geschlechtsteile untersucht und auf dieser Grundlage den Hermaphrodit M. W. für impotent erklärt. Luther verweist auf die Bedeutung der innenliegenden Geschlechtsorgane und deren Funktionsfähigkeit. Vor allem diese Geschlechtsorgane hätten für die Entscheidung über die Reproduktionsfähigkeit eines Menschen große Bedeutung und seien wesentliche Kriterien für die Bestimmung der Ehefähigkeit.

Die Gültigkeit dieser beiden Kriterien - phänotypische Geschlechtsteile einerseits oder innenliegende Geschlechtsorgane andererseits - wird im 16. und 17. Jahrhundert kontrovers diskutiert. Für eine ausschließliche Begutachtung der äußeren Geschlechtsteile sprechen sich unter anderem der Chirurg Ambroise Paré (1510-1590) oder Johann Scultetus aus. Die Größe der Genitalien, ihr Umfang oder die Beschaffenheit der äußeren Geschlechtsteile würden Auskunft geben, welches Geschlecht bei einem Hermaphroditen dominiert. Diese Merkmale müssten observiert und getastet werden, um eine Bestimmung des Hermaphroditen durchführen zu können. Der Arzt und Mitbegründer der Rechtsmedizin Paul Zacchia (1584-1659) stimmt diesen Kriterien und diesem Vorgehen grundsätzlich zu. Er erweitert aber die Kriterien, indem er auf die Repräsentation von innenliegenden Geschlechtsorganen abhebt. So sei eine Person mit Menstruation als weiblicher Hermaphrodit anzusehen, selbst wenn der Hermaphrodit männliche Insignien trage - beispielsweise kurze borstige Haare am Anus oder einen Penis in angenehmer Größe. Ähnlich argumentiert auch Jacques Duval im Prozess um das »wahre« Geschlecht von Marie/Marin le Marcis, wenn er auf die Funktion der im Inneren des Körpers liegenden Geschlechtsorgane hinweist.

Jedoch stehen sich generell zwei extreme Verhältnisse gegenüber: die Ideologien, welche aus der geistigen Grundlage heraus das Dasein zu verherrlichen und somit auch zu beherrschen suchen und das Verhältnis, daß eben nicht der (geistige) Wille, sondern das (instinktive/intuitive) (V)Erlangen die Grundlage der Handlungspräsenz bestimmt. Darauf basiert es, daß einzig der Geist als repräsentierendes Innenwesen überhaupt noch seine Inbetrachtziehung erfährt, denn dieser ist der Mittler und gleichzeitig auch Diplomat. Foucault bringt die Grundlagen auf den Punkt, wie man aus den Verhältnissen abseitig des Subjekts, dieses formiert und darüber ein integres Subjektwesen gestaltet - ein Subjekt, welches nicht aus dem Subjekt selbst, sondern aus seinem Das-Seins-Verhältnis als Objekt geschaffen wird. Foucault hat sich diesbezüglich mit den Detailwesen beschäftigt, worüber sich dieser Konstruktivismus gestaltet. Hingegen ist es aus dem jeweiligen Selbst heraus ersichtlicht: die Gesetzgebung, welche nicht aus der Gemeinschaft heraus begründet wird, sondern ihr gegenüber gestellt wird; die wissenschaftlichen Erkenntnisse, die ein Innenleben beschreiben, ohne überhaupt aus dem Inneren heraus eine Inbetrachtziehung zu vollziehen. Überhaupt ist es das Erleben des Selbst, welches über das außen vor Stellen des Selbst, mit Bildnissen und Händlings konfrontiert wird, welche sich rein auf Gegenüberstellungen von Äußerlichkeiten begründen. Gerade darüber gelangt man zum Ersichten all der Formenwesen, die einem gegenüber stehen und einem das Korsett gegenüber halten, um es sich anzuziehen. Dem gegenüber ist nämlich auch Foucault's Aufbringen indess aus der Objektivität heraus dargestellt. Das Kernwesen dessen basiert hingegen auf dem grundsätzlichen Mißverhältnis, das Selbst in sich selbst überhaupt wahrzunehmen, denn tatsächlich wird es überhaupt denen unwiederruflich vor Augen geführt, welche entsprechend ausgeprägt veranlagt sind, sodaß die inneren Triebe und deren Wirken gar nicht übergangen werden können. Vor allem sind es aber auch die Selbstverständlichkeiten, welche das tatsächliche Sichten weitläufig nicht erwirkt. Und so sind gerade auch die Einheiten auf regulären Selbstverständlichkeiten begründet, gemäß dem es der Mehrheit entspricht, sodaß man hierin mit relativen Übermaßen konfrontiert ist, die es als solches bereits darüber nicht in Erscheinung treten läßt. Klar ersichtlich wird es somit jedoch zwangsläufig Denjenigen, welche in das Korsett nicht einpassungsfähig sind, da die Ausgeprägtheit ihrer Veranlagung dies nicht zuläßt. Es ist somit aber auch heutzutage nichts anderes, als es schon immer war, nämlich ein reiner Sachverhalt der Kräfteverhältnisse. Gerade dies ist jedoch ganz natürlich und vor allem von meiner Seite aus, in keiner Weise unbedacht - im Gegenteil - gerade dies gilt es mir hervorzuheben.


Leben - Werk - Wirkung
Verlag: J.B. Metzler
, ,
» Michel Foucault «

In seinem 1982 veröffentlichten Nachwort zur Monographie von Dreyfus und Rabinow heißt es über das Ziel seiner Arbeit der 'letzten zwanzig Jahre': "Es ging mir nicht darum, Machtphänomene zu analysieren oder die Grundlagen für eine solche Analyse zu schaffen. Vielmehr habe ich mich um eine Geschichte der verschiedenen Formen der Subjektivierung des Menschen in unserer Kultur bemüht. Und zu diesem Zwecke habe ich Objektivierungsformen untersucht, die den Menschen zum Subjekt machen". In eine ähnliche Richtung geht der Vorschlag Schneiders, Foucaults Gesamtprojekt auf die von ihm in einem Anfang der 1980er Jahre von ihm selbst verfassten und in seinem Todesjahr 1984 erschienenen Lexikonbeitrag gebrauchte Formel einer 'Kritischen Geschichte des Denkens' zu bringen. Es gehe ihm - so Foucault in diesem zunächst unter einem Pseudonym erschienenen und in der Tat von großer Distanz gegenüber der eigenen Arbeit geprägten Text - um "die Regeln, nach denen mit Bezug auf bestimmte Dinge das, was ein Subjekt sagen kann, der Frage des Wahren und des Falschen untersteht", also um die reziproke Frage, unter welchen Bedingungen ein Subjekt "zum legitimen Subjekt dieser oder jener Erkenntnis" und "unter welchen Bedingungen eine Sache zum Objekt für eine mögliche Erkenntnis" werden könne. Damit ist nicht nur der interdisziplinäre, alle Kulturwissenschaften betreffende Aspekt Foucault'schen Forschens benannt, sondern auch sein vorrangiger Gegenstand. Dass hierbei die Frage der Subjektkonstitution eine so zentrale Rolle spielt, könnte man angesichts der Tatsache, dass Foucault in den 1960er Jahren gerade durch die provokante These vom 'Tod des Subjekts' berühmt geworden ist, zunächst für ein Missverständnis halten. Aber dieses Missverständnis entpuppt sich bei näherem Hinsehen als scheinbares. Foucaults frühe Polemik richtete sich gegen jegliche universalistische, also transzendentalphilosophische oder ontologische Theorie des menschlichen Subjekts. Sein eigenes Denken "in der Leere des verschwundenen Menschen" rekonstruiert jene Produktions-, Macht- und Sinnverhältnisse, jene historisch-sozialen Praktiken, in denen sich Subjektivität als Erkenntnisgegenstand historisch konstituiert. Kritik einer Theorie des Subjekts durch Rekonstruktion der historischen Modi und Möglichkeitsbedingungen von Subjekt-Objektbeziehungen - auf diese sehr allgemeine Formel kann man Foucaults Forschungsprogramm durchaus bringen.

Dem gegenüber haben sich jedoch wahrlich auch die Sichtungen des Selbst geändert, zwar nicht wirklich in der Sichtung des Selbst, sondern in des Ersichtens der Innerlichkeit des Menschen von außen. Und man gelangte über die äußerlichen Ergründungen diesem tatsächlich immer näher, was vor allem auch darauf basiert, daß das Formwesen sich nämlich über die Erkenntnisse nährt und dies somit auch seine entsprechende Förderung erfährt. Man vergleiche hierzu einmal den Verlauf der Anatomie, so ist es doch erstaunenswert, welches Detailwesen sich ausbreitend bis ins 19. Jh. bereits entwickelte. Und so trifft man gerade hierin auch über die Außergewöhnlichkeit wiederum auf Sichtungen, die man ansonsten gar nicht sieht. Neben dem, daß man ja doch das Tier nicht (mehr) mit dem Menschen zu vergleichen sucht, bringt indess gerade dies die Gegebenheiten zur Klarheit und Sichtung, die man beim Menschen gar nicht zu sehen gedenkt. Und so zeigt gerade auch das Musterbeispiel Klitoris wiederum das Extrem der Gegebenheiten auf, wie es sich verhält mit den vordefinierten Gegebenheiten, die sich bis in die Gegenwart, gerade darin auch fortsetzen. Gerade über die sich bildenden Kenntnisse indess, ergibt sich jedoch überhaupt erst ein klares Bildnis des Fortpflanzungs- und Geschlechtswesen, zumal deren Differenzierung und somit auch über das, was nicht diesem körperlich-Physischen entspricht. Somit gelangt man hierüber auch indirekt zu dem davon Scheidenden der sexuellen mentalen Veranlagung - dem initiativen Wirken des Selbst, gegenüber dem rein Reflektiven des Körperlichen, denn auch über das 'ist-nicht' gelangt man zu der Präsenz, die ist, vor allem jedoch auch unterstützend, um es als solches in Klarheit ersichtlich werden zu lassen. Dies ist wesentlich, denn ohne dies ist es wahrlich auch nicht derart klar ersichtlich, da nämlich die Wirkwesen kombiniert miteinander einher gehen, sodaß es der spezifischen funktionalen Sondierung bedingt, um das Jeweilige für sich, gemäß seiner spezifischen Konzipierung, in Erfahrung zu bringen. Und hierin besteht auch des Wesens Kern der Selbsterkenntnis, daß man darüber in seinem Selbst auf hinleitende Weise zu diesem Selbst gelangt, auch und gerade wenn es einem als solches nicht ersichtlich ist. Elementar waren hierin nämlich vor allem auch die Ergründungen des Empfindungswesens und spezifisch das Empfindungs- und Gefühlswesen machen das Sexualwesen in seinem Gesamtwesen aus, gemäß dem Kobelts erläuternde Hervorhebungen des Wirkwesens wahrlich die elementarste Bereicherung jener Zeit darstellt, dessen Kenntnisse darüber sich bis heute darin nicht sonderlich erweitert haben. Dies stellt sich jedoch auch vor allem als besonders markant, da es nämlich zu der Zeit sein Aufbringen findet, dem gegenüber man beginnt die sexuellen (mentalen) Orientierungen zu ergründen, ohne daß dies überhaupt seine erforderliche Erachtung findet. Indess zieht man darin einzig das Geschlechtswesen bis heute in Betracht, wobei sich doch gerade darüber darlegt, daß es dem gar nicht entspricht.

Kobelt's detaillierten Aufbringen gilt es noch hinzuzufügen, was ebenfalls bis heute nicht seine tatsächliche Sichtung erfährt, nämlich das sogenannte Brunftwesen, das es auch beim Menschen gibt. Insofern es überhaupt seine Erachtung findet, geht man indess von einer Selbstverständlichkeit aus, welche hierin gar nicht gegeben ist. So findet die Plateauphase, in welcher Zeit sich ein brunftmäßiges Gebahren bei den Frauen einstellt, nicht gemäß den Erwartungen, zur Phase der Befruchtungsfähigkeit und somit in der Mitte, zur Zeit des Eisprunges um den 14. Tag des Menstruationszykluses statt, sondern hingegen während der letzten 3 Tage vor, bis in den ersten Tag der Periode hinein. Gravierend hierin ist, das die Frauen regelmäßig dies gar nicht bewußt bemerken und Männer damit verbunden gleichermaßen nicht als Derartiges erachten, selbst wenn gar extreme Aktivitäts- und Charakterenwandel damit einher gehen und das auch noch in der Beständigkeit gemäß der Perioden. Dies beruht darauf, daß ein solches Brunftwesen beim Menschen gar nicht seine Erachtung findet, da man davon ausgeht, daß wenn, dann in der Mitte der Periodizität, zur Zeit der Geschlechtsreife, stattfinden müßte, indess zeigt sich generell, daß man dem Menschen das Tierische abspricht und somit es gerade darüber nicht seine Erachtung findet. Auch hierin trifft man somit auf ein herausragendes Musterbeispiel der Erwirkungen vordefinierter Vorstellungen, dem gegenüber das Wirkwesen gar nicht gemäß dessen Erscheinung seine Erachtung findet. Vor allem ist dies ein prädestinierendes Musterbeispiel von Unbewußtsein und somit doch den Menschen als Tier darin stellt, indem dieser darin rein unbewußt handelt und es gar nicht bemerkt. Man geht von dem Prinzip aus, daß der Geist es ist, welcher den Menschen vom Tier unterscheidet, dies ist wohl war, daß es sich jedoch auf die geistig projizierten Vorstellung bezieht, hingegen nachweislicherweise eindeutig nicht. Wie also kann es sein, daß der Mensch instinktiv handelt und dieser es doch nicht bemerkt? Es ist der Geist und dessen monistische Zentrierung, worüber sich dies klärt. Zu beachten ist somit auch, daß in der körperlichen Anatomie der Geist nicht anzutreffen ist, sondern eben auch nur das, was das Körperliche ausmacht.

Kobelt_Tafel-1.jpg
» Erste Tafel «

Kobelt_Tafel-3.jpg
» Dritte Tafel «


des Menschen und einiger Säugethiere
in anatomisch-physiologischer Beziehung

Verlag: Emmerling
» «

» Erste Tafel «
Figur 1: Die männlich Ruthe von unten
Figur 2: Vorderer Theil des Gliedes eines Hypospadiaeus von unten
Figur 3: Verbreitung der Nerven in der Eichelsubstanz und Eichelhaut
Figur 4: Die Clitoris in natürlicher Größe von unten
Figur 5: Der penis von mus decumanus von unten
Figur 6: Ruthe von mus decumanus von unten

» Dritte Tafel «
Figur 1: Die menschliche clitoris vergrössert
Figur 2: Das passive weibliche Wollustorgan in seiner Lage und Verbindung von der Seite
Figur 3: Das weibliche Wollustorgan in seiner Lage von vorn
Figur 4: Die beiden Vorhofzwiebeln gegen die Mittellinie zusammengedrängt
Figur 5: Die linke Vorhofzwiebel von der convexen Seite

» Transitives weibliches Wollustorgan (S. 53) «
(Corpus cavernosum clitoridis, musculus ischio-cavernosus und vagina)

Der Ruthenschaft, beim Manne gross und gewaltig, hat beim Weibe nur eine dürftige körperliche Ausbildung erhalten. Das Geschäft, dem er dort vorstand, ist ihm hier grossentheils entzogen und hier an eine, jener Hervorragung entsprechende Einstülpung, an die Mutterscheide übergegangen.

So unendlich oft das corpus cavernosum clitoridis anatomisch untersucht worden, so ist doch in unseren Hand- und Lehrbüchern nicht einmal seine Stellung und äussere Gestalt der Natur gemäss angegeben, Und doch zeigt die clitoris gerade in dieser Beziehung die auffallendste Abweichung vom männlichen Gliede. Untersucht man, wie gewöhnlich, die clitoris im nicht injicirten Zustande, so sieht man sie, wie das männliche Glied, vom Scheitel des Schoosbogens schlaff herabhängen. Man versuche nun einmal, sie ohne vorgäingige Durchschneidung der unter ihr liegenden Theile, nach oben aufzurichten, so wird man finden, dass dies ohne gewaltsame Zerrung des Bändchens und des praeputium nicht angeht. Sind nun aber vollends die clitoris, die pars intermedia und ihre Gefässverbindungen mit dem frenulum, den Nymphen und den grossen Schaamlefzen mit erstarrter lnjectionsmasse angefüllt (1), das Ganze also in künstlicher Turgescenz begriffen, so ist eine solche Aufrichtung der clitoris ohne Zerreissung dieser Gefässe gar nicht möglich. Die injicirte clitoris hat nämlich folgende Stellung und Gestalt angenommen. Die crura clitoridis und das hintere Dritttheil ihres Körpers richten sich unter demselben spitzen Winkel wie der erigirte penis nach oben und vorn gegen die Schoosfuge auf (Taf. Ill. Fig. 2. l.); plötzlich aber wendet sich der vordere Theil des corpus clitoridis mit einer knieförmigen Biegung (Taf. Ill. Fig. 2. k. Fig. 1. b) gerade nach abwärts, so dass er gegen die aufsteigenden crura einen spitzen Winkel bildet (Taf. Ill. Eig. 2. i. k. l.), wodurch die glans clitoridis vor den oberen Rand des Scheideneinganges zu stehen kommt (Taf. Ill. Fig. 2. e. Fig. 3. f.) (2). Dies finde ich bei Lieutaud wenigstens theilweise, bestätigt: "Le clitoris n'a point la direction de la verge; il se port dans un sous contraire, c'est-à-dire, de haut en bas, sans qu'il puisse se relever dans son action"(3). Bei der Stute, Ratte, Katze, beim Hunde und Schweine ist diese Kniebiegung des Kitzlers noch viel auffallender, als beim Menschen. Die Scheidewand des corpus clitoridis ist weniger durchbrochen, als beim penis, und erstreckt sich bis in die vorderste Spitze. Die crura clitoridis sind im Verhältniss zum Umfange des Clitorisschaftes von sehr bedeutender Grösse (Taf. IV. Fig. 1.) (4), zeigen (bei b. b.) eine analoge, zwiebelartige Anschwellung (bulbus corporis cav. clitoridis), gehen in eine frei liegende, ahgerundete Spitze aus (e) und sind nur mit einer schmalen Längslinie ihrer hinteren Fläche an den vorderen, umgeworfenen Rand des Schoosbogens befestigt, so dass sie nicht sowohl unter, als vor denselben zu liegen kommen. Das Parenchym des Zellkörpers der clitoris ist ganz dasselbe, wie das des penis (5); nur sind die einzelnen Maschen und Gefässchen seines venösen Wundernetzes noch ungleich zarter und feiner als dort (Taf. IV. Fig. I. e.). Das Ganze ist von einer dünnen fibrösen Scheide umgeben. Seine Gefässe sind denen des corpus cav. penis vollkommen entsprechend (cfr. oben pag. 27 und Fig. 1 der Taf. III. u. IV.). Die Nerven werden zum Theil von Müller und Valentin heschrieben, stehen aber zum sensibeln Nervenreichthume der Clitoriseichel in keinem Verhältnisse.

1) In den zahlreichen anatomischen Sammlungen, die ich bis jetzt, mit besonderer Aufmerksamkeit auf die injicirten Präparate perlustrirte, habe ich auch nicht eine einzig gelungene Injection der clitoris gefunden.
2) Zur weiteren Veranschaulichung dieser eigenthümlichen Stellung des Kitzlers vergleiche man z.B. auch die Wachsabgüsse der verschiedenen Hermaphroditen, die fast in allen anatomischen Museen aufgestellt sind, und dazu ferner J.F. Meckel Handbuch der pathologischen Anatomie. II. 1. pag. 209. Somit wäre also die Clitoriseichel in ihrem Blüthezustande gleich einem Sinnesorgane am Eingang des allgemeinen Begattungscanales aufgestellt und Burdach's Bezeichnung derselben als "Tastorgan des Zeugungssystemes" gerechtfertigt.
3) Lieutaud, I. c. II. pag. 310
4) Ich habe auf der angeführten Tafel die Wurzel und Schenkel des Kitzlers, in dem Maasse vergrössert dargestellt, dass der Clitoriskörper (a) dem penis an Umfang gleich kommt, und man bemerkt nun das sehr beträchtliche Vorwiegen der crura clitoridis (b) vor den Schenkeln des penis (Taf. II. Fig. 5. d. d.). Auf diesen Unterschied zwischen dem corpus cavernosum des Kitzlers und der männlichen Ruthe hat schon Graaf aufmerksam gemacht; "Primo quod partes ejus bifurcatae duplo longiores sint, quam conunctae; in pene vero partes conjunctae quadruplo longiores sint bifurcatis".
5) J. Müller, der dem Kitzler überhaupt nur eine ganz untergeordnete Bedeutung zugesteht, stützt sich hierin unter anderem auch darauf, dass er im Körper des 3 1/2'' langen Kitzlers von Ateles-Weibchen gar kein erectiles Gefüge, sondern nur dichtes Fett gefunden habe (cfr. Müller über zwei verschiedene Typen in dem Bau der erectilen männlichen Geschlechtsorgane bei den straussartigen Vögeln etc. pag. 22). Allein ich befürchte sehr, es möchte hier ein kleine Präoccupation unterlaufen sein. Ohne vorgängie Ausspritzung lässt sich über dieses Organ kein vollständiges Urtheil fällen. Wer sich viel mit Injectionen beschäftigt, der weiss, dass die Substanz vieler Gebilde, in denen das Auge zuvor kaum Gefässe bemerken konnte, nach der Injection ganz und gar aus solchen zu bestehen scheint, wie man sich z.B. an den Knochen, zumal des Kinderschädels, an der vagina, an der pars membranacea urethrae, am Blasenhalse etc. zur Genüge überzeugen kann. Das Innere des corpus cavernosum clitoridis der Stute scheint ohne Einspritzung gleichfalls nur aus einer derben Fasermasse gebildet zu sein, nach der Injection bewährt es sich aber als ein wahres rete mirabile venosum.

Nun einige Worte über die Function der eben beschriebenen Theile. Schon beim Manne, wo der Ruthenschaft als Hauptorgan der transitven Wollusterregung auftrat, mussten wir demselben auch an der Erzeugung des Wollnstgefühles im eigenen Körper einigen indirecten Antheil einräumen. Beim Weibe zieht sich dessen anatomischer Repräsentant , das corpus cavernosum clitoridis, hinsichtlich seiner Einwirkung auf das andere Geschlecht, fast ganz in den Hintergrund zurück und seine physiologische Bedeutung beschränkt sich fast nur auf jene entfernte Theilnahme an der subjectiven und eine geringe Mitwirkung zur transitiven Wollusterzeugung. Für sich aber ist der Zellkörper der clitoris wegen seines geringen Nervengehaltes und seiner fibrösen Umhüllung einer specifischen Empfindung und Anregung dazu von aussen her ebenso wenig fähig, als der Zellkörper der männlichen Ruthe.

Was oben pag. 31 über die Leistungen des Ruthenschaftes als Träger und Widerlage des passiven Wollustorganes und ferner in Beziehung auf seine Füllung und Feststellung angeführt wurde, das gilt mit wenigen Einschränkungen auch vom Clitorisschafte.

Wir begegnen hier der Frage: Erfährt die clitoris, oder vielmehr das corpus cavernosum clitoridis bei der gesehlechtlichen Aufregung des Weibes eine Erhärtnng und Aufrichtung, ist sie überhaupt einer Erectien fähig oder nicht?

Die clitoris spielt in unserer Kenntniss vom Begattungsgeschäfte eine so untergeordnete Rolle, dass R. de Graaf's Worte: "Summopere mirati sumus quosdam anatomicos, non majorem hujus partis mentionem facere, ac si in rerum Natura non existeret" noch heute ihre Geltung haben. Besonders aber hat sich Müller (1) mehrfach gegen die Erectionsfähigkeit der clitoris ausgesprochen, und glaubt gerade hierin die wesentlichste Verschiedenheit der clitoris von der männlichen Ruthe zu finden. Sehen wir denn aber nicht die äusseren Geschlechtstheile aller unserer weiblichen Haussäugethiere schon mit herannahender Zeit der Brünstigkeit und noch weit mehr während derselben und im Begattungsgeschäfte selbst durch vermehrte Succulenz auschwellen und äusserlich hervorragen, und sich in ihrer Empfindlichkeit auf's höchste steigern? Sollte hievon nur eben die nervenreiche clitoris ausgeschlossen sein, deren passives und transitives Schwellorgan in seiner bewunderungswürdigen Einrichtung mit dem analogen männlichen Schwellapparate bis ins kleinste Detail so durchgreifend harmonirt und durch künstliche Füllung von seinen Gefässen aus zur vollständigen Erstarrung und Erection gebracht werden kann? Sollte dies die Natur selbst bei jener offenbaren geschlechtlichen Congestion nicht vermögen? Schon Plazzonus sagt: "Igitur etiam actio clitoris, quae est penis muliebris, erit erectio. Hanc erectionem ipsae lascivientes falentur foeminae, dum sibi aliquid in naturalibus indurari et prominere, cum tentigine laborant, affirmant" (2). Und wahrlich! wären unsere physiologischen Lehrbücher in so vieler Frauen als Männer Hände, wir würden manchem ungläubig lächelnden Gesichte begegnen. Wir haben fast täglich Gelegenheit, uns bei Thierweibchen von der Erection der clitoris zu überzeugen. Bringt man z. B. bei einer läufigen Hündin vor dem Aufspringen des Hundes den Finger in den Wurf, so trifft derselbe auf einen resistenlen Körper, der nichts anderes ist, als die cliloris, die jetzt, aus ihrer Tasche hervorgehoben, frei und starr in den Canal des Vorhofes hineinragt. Ja, bei dem bekannten Umstülpen der Schaamlefzen rossiger Stuten sieht man deutlich, wie der entblösste starre Kitzler in raschen Bewegungen gegen die Achse des Vorhofes einwärts gedrängt wird (3). Die Ursache dieser veränderten Lage, Stellung, Resistenz und Bewegung liegt zum Theil in der strotzenden Füllung des, im Knie gebogenen corpus cavernosum clitoridis, anderen Theils aber auch in der Contraction der vorderen Abtheilung des musculus constrictor cunni, wodurch die clitoris wie ein einarmiger Winkelhebel ins Innere des Vorhofes hineingezogen wird (4). Betrachten wir diese Muskelparthie mit einiger Aufmerksamkeit auf ihre Beziehungen zur clitoris und zum Verhofe, so wird uns diese Wirkung schon ziemlich einleuchtend. Drückt man aber bei letzterwähntem Versuche mit dem behutsam eingebrachten Finger rasch auf die erigirte glans clitoridis, so fühlt man im Bereiche des cunstrictor cunni urplölzlich ein Einwärtsdrängen der beiden aufgeschwollenen bulbi und ein Heben und Anpressen der steifen clitoris an den Finger; wobei ein gleichzeitiges Aufzucken des Thieres die stossweise, subjective Wollustemplindung desselben auch objectiv erkennen lässt (5). Zugleich ergibt sich hieraus, dass beide Abtheilungen des constrictor cumni zur glans clitoridis in genauestem Reflexverhältnisse stehen. Dieser Einfluss des Scheidenschnürers auf die Stellung der clitoris war auch einigen älteren Beobachtern nicht entgangen; denn Santorin (6) sagt mit Rücksicht auf die Lage seiner Bündel: "ut eo facilius, et quo vaginam amplexantur, sphincteris mumus obeant, et quo clitoridem deducunt, suo magis magisque munere fungi possint" und noch bestimmter Lieutaud (7): "auxquels on a donné le nom de constricteurs: il est vrai qu'ils peuvent avoir cet usage; mais ils sont destinés principalement a rapprocher le gland du clitoris vers l'ouverture du vagin".

Der Analogie nach ist ferner mit ziemlicher Gewissheit anzunehmen, dass auch der musculus ischio-cavernosus demselben Reflexverhältnisse unterworfen ist, und dass mit seiner Contraction die höchste Füllung und Steifung des corpus cavernosum clitoridis eintritt, wodurch das Entweichen des Blutes aus der pars intermedia durch die venae communicantes ins Lumen dieses Schwammkörpers unmöglich wird. Alle diese Effecte fallen auch hier auf die erfolgte Eichelreizung in einen Moment zusammen.

Die Scheide muss, vermöge ihres erectilen Gewebes, zur Zeit der Sexualcongestion eine Art von Erection erfahren, wie man dies nach der Injection deutlich zu sehen bekömmt. Graaf (8) hat mithin nicht ganz Unrecht, wenn er sagt: "Vaginae actio erectio est, cum in coitu Vaginae ductus a Pudendo ad Uterum usque erigatur; sic ut Penis regià quasi vià ad Uterum pervenire queat. Natura autem in Vagina talem erectionem molita est, ut congrua Pudendoruin affricatio ad semen eliciendum necessaria fieret, et semen facilius ad Uteri fundum pertingeret". Mit der Aufsteifung ihrer Wände muss sich aber ihr Lumen, wie das der Harnröhre aufziehen, wodurch sie sich gleichsam zu einer Saugröhre umgestaltet (9). Daher mag es auch kommen, dass man in dem Momente, wo das männliche Thier durch eine ungeschickte Bewegung die noch strotzende Rothe rasch aus der Scheide zurückzieht, ein ähnliches Schnalzen hört, wie bei einem derben Kusse, der ja auch nichts anderes ist, als ein plötzlich abgerissenes Saugen. Vergleicht man das weit ausgedehnte, ungemein reichliche, venöse Schwellgewebe der Scheide mit den spärlichen arteriae vaginales, so ermisst man leicht, dass dieselben für die rasche Füllung dieser Venenmassen offenbar viel zu unergiebig sind. Sie erfolgt vielmehr bei den rhythmischen Contractionen des musculus compressor bulbi durch die oben erwähnten Wurzeln aus dem Inhalte des bulbus vestibuli. Ja es dehnt sich vielleicht die Wirkung dieses Pumpapparates (Sexualherzens) in gewissen Momenten selbst bis auf die Tuben und Fimbrien aus (10). Eine solche schwammig elastische Auspolsterung des Seheidenrohres, zu der noch die beiden bulbi am Scheideneingange hinzukommen, qualificirt die vagina vortrefllich zu ihrem Hauptgeschäfte, nämlich zu einem sanften und doch innigen Umfassen und zur blanden Friction der männlichen Ruthe von den verschiedensten Grössenverhältnissen, wozu der constrictor cunni beim Menschen einiges, bei manchen Säugethieren vieles beitragen mag. Hören wir hierüber de Graaf (11): "Nisi enim partes illae constringi ac dlilatari possent, impossibile foret, ut generationis actus tam feliciter inter diversae magnitidinis et aetatis homines celebraretur; mulierum enim Vagina tam affabre facta est; ut se omnibus et singulis fere mentulis accommodet; sic ut brevi occurrat, longae cedat, crassae dilatetur, tenui constringatur: Natura enim omnibus Penis differentiis consuluit, ut non opus sit, sollicite vaginam cultello aequam quaere; sed ubiquc Opificis beneficio inveniatur; ita ut omnes viri cum omnibus foeminis, et omnes foeminae cum omnibis viris convenire possint, si eaetera consentiant."

1) Müller, Physiologie II. VII. 2. Ferner, Müller über zwei verschiedene Typen etc. pag. 22: "Die Erectionsfähigkeit dieses Theiles hat man zu allgemein genommen etc. Beim Menschen sah ich zwar im Inneren der corpora cavernosa clitoridis venöses Maschengewebe. Indess ist auch hier die Erectionsfähigkeit der Clitoris bei normalen Individuen nicht constatiert und jedenfalls kein constantes Phänomen.
2) Plazzonus de partibus generationis. ept. XII pag. 147.
3) Günther I. c. § 33 "Der Wurf (pudendum) zeigt das sogenannte Blinken, das heisst ein krampfhaftes Umklappen und Aufziehen der Ränder mit gleichzeitigem Aufrichten und Heben der 'clitoris'." Ebenso Hausmann I. c. pag. 30. 4) Eine ganz ähnlich Vorkehrung findet sich selbst in der Classe der Vögel. Bei der Ente enthält die an der inneren Fläche der unteren Schaamlippe liegende clitoris einen Knorpel und wird duch einen Muskel aufgerichtet. (Spangenberg disquisitio circa partes genitales foemineas avium. Göttingen 1813. 4. cum tab. pag. 26 seqq.)
5) Müller (I. c. II. VII. 2.) erwähnt, um seine Ansicht über den geringen Antheil des Weibes am Begattungsacte zu begründen: "Bei dem weiblichen Geschlechte wird keine Nerventhätigkeit auf den Act einer Erection verwendet, keine rythmischen heftigen Zusammenziehungen erfolgen auf dem Culmulationspunkte, der geschlechtlichen Erregung" etc. Eine lebenskräftige junge Frau klagte einem meiner Freunde, einem Arzte, dass sie an ihrem Eheherren keine Befriedigung finde, und in Folge dessen während ihrer weiblichen Arbeiten öfter von heftigem Geschlechtsdrange geplagt werde, wobei sie ohne ihr Zuthun dieselben rhytmischen Zuckungen und explodirenden Erschütterungen empfinde, wie bei der Begattung.
6) Santorin I. c. pag. 206
7) Lieutaud I. c. pag. 310
8) Graaf I. c. pag. 87. In ähnlicher Weise spricht sich Plazzonus (I. c. p. 161) aus: "Siquidem cum penis erigitur, durus rigidusque efficitur eo quod fibrae ejus lacae tendantur: pariter com erigitur vagina dura et tensa conspicitur repleta nimirum illius media substantia laxa et rara".
9) Ueber die Saugfähigkeit der Scheide cfr. Günther I. c. § 56. 57
10) Soll sich das Schwellgewebe der Scheide usw. füllen, so darf sich die hintere Portion des musc. constr. cunni nicht zusammenziehen, weil ihre Sehne den Zugang zu ihm versperrt. Es scheint deshalb, dass, je nach den verschiedenen Bedürfnissen und Zwecken, bald die eine, bald die andere Abtheilung, bald beide zugleich zur Zusammenziehung bestimmt werden.
11) R. de Graaf I. c. pg. 82

Divider


Eine Genealogie des Geschlechtsbegriffs
Akademie Verlag

In der ersten Phase [der Genese der Geschlechtsorgane], so Meckel, die vom Moment der Befruchtung bis zur sechsten Woche andauert, "fehlt jede Spur von Geschlechtstheilen" (Meckel 1820: 584). Erst ab der sechsten Woche lassen sich erste Teile des Geschlechtssystems nachweisen. In dieser zweiten Phase, die bis zum dritten Monat anhält, sind die Geschlechtsteile "in allen Embryonen ganz nach demselben Typus gebildet, es findet mithin durchaus noch kein Geschlechtsunterschied statt, indem Gestalt, Größe und Lage jener Theile bei allen völlig dieselben sind." (Meckel 1820: 584) Nach dieser Phase der geschlechtlichen Indifferenz setze ab dem dritten Monat, so Meckel weiter, die Geschlechtsdifferenzierung ein: Die Eierstöcke werden "beständig kleiner als die Hoden, sie liegen mehr wagerecht, und die Ruthe unterscheidet sich von dem Kitzler" (Meckel 1820: 586).

Zehn Jahre nach Meckel veröffentlicht Johannes Müller seine "Bildungsgeschichte der Genitalien" und greift auf dessen Beschreibungen zurück. Müller seinerseits analysiert nicht die zweite oder dritte embryonale Entwicklungsphase, sondern die "ursprünglichen Entstehungsmomente" (Müller 1830: 98). Aus welchem Teil des Embryos, so fragt Müller, entstehen all jene Organe, "welche zum Systema urinarium et genitale gehören, nämlich Wolff'sche Körper, Hoden und Eierstöcke, Nieren, Nebennieren, Harnleiter, Ausführungsorgane der Wolff'schen Körper und der Geschlechtstheile?" (Müller 1830: 99) Seine Antwort: Die Geschlechts- sowie die Ausscheidungsorgane werden ursprünglich von Drüsen gebildet, die "aus der ersten Anlage des Darmschlauches" (Müller 1830: 99) entstehen. Aus ihnen bilden sich, so Müller, einerseits die Ausscheidungsorgane - Nieren und Nebennieren - und andererseits die Geschlechtsorgane.

Die Genese der ersten Geschlechtsorgane verläuft, so Müller, bei allen Säugetieren gleich. Bei ihnen können "im Anfang dieselben Wolff'schen Körper mit ihren kurzen Ausführungsgängen" (Müller 1830: 98) beobachtet werden. Etwas zeitversetzt - beim Menschen ab der sechsten Woche - erscheint "bei allen Embryonen jederseits ein neuer Gang an der äussern Seite des Wolff'schen Körpers, ohne Gemeinschaft mit diesem" (Müller 1830: 98) zu haben. Beide Gänge, der Ausführungsgang des Wolff'schen Körpers sowie der von Müller entdeckte und nach ihm benannte Gang, "sind anfangs bei allen Embryonen oben blind" (Müller 1830: 98). Und weiter heißt es: Bei "den weiblichen werden sie in die Bauchhöhle geöffnet, und bleiben gerade und erweitern sich, nur bei den männlichen kräuseln sie sich mit der Verkleinerung des Wolff'schen Körpers zum Schwanz des Nebenhodens und treten in Wechselwirkung mit den vasa efferentia des keimbereitenden Organs oder Hodens. Ist das Geschlecht entschieden, so sind die früher beiden Geschlechtern gemeinschaftlichen Organe verschwunden." (Müller 1830: 98f.) Wie aber gestalten sich die Prozesse der Verwandlung oder Metamorphose?

Divider

Jacques-Pierre Maygrier
» Nouvelles démonstrations d'accouchemens (1825) «
» gynäkologische Untersuchung «
» Jacques-Pierre Maygrier «

Handbuch der Anatomie des Menschen
» Erster Band () «
» Zweiter Band (1830) «
» Dritter Band (1831) «
» Vierter Band (1832) «
Verlag der Schulbuchhandlung
,

Gynäologie () «
Das Geschlechtsleben in seinem ganzen Umfange

Zweiter Band
» Dritter Band «
Verlag: Fr. Henne
» «

Bezüglich der weiteren Entwicklung darin, gibt es im Verlaufe der Zeit keine tatsächlichen Veränderungen in der regulären körperlichen Ersichtung, bis auf das kleine Detail, welches O'Connel erst kürzlich aufbrachte, wobei, wer Kobelt gelehrsam studiert hat, darin herauslesen kann, daß dieser es bereits kannte, hingegen nur nicht zuordnen konnte und somit auch nicht dessen Funktionsweise (sich) erklären konnte. Im Verhältnis zum Zeitraum, an sich nichts Neues, auf dem Gebiet der Anatomie des Sexualwesens. Hingegen gilt es hervorzuheben, daß die Präsenz und Funktionalität der Klitoris zumindest eine gewisse Aufmerksamkeit erlangt hat, dem gegenüber jedoch das Bändchens (Frenulum) nach wie vor noch gänzlich außen vor steht und auch einzig eine schattenhafte Benennung und Beschreibung einzig als Hautfalte erfährt, jedoch nichts über deren maßgebliches Wirkwesen bei beiden Geschlechtern, indess man dies Wirken anderem zuschreibt, dem es jedoch so nicht ist und auch diesbezüglich vieles durcheinander bringt und die erforderliche Aufklärung dazu noch offen steht. Tatsächlich hat man sich nämlich in ganz andere Hemnisphären begeben, welche einst mehr versprachen, als sich hieraus ergab, sodaß es regelrecht in seiner Zeit stehen geblieben ist darin. Hingegen hat man sich in der Masse der erneuernden Errungenschaften verloren, dem gegenüber sich letztendlich fragt, inwiefern man in der Erforschung überhaupt noch die Geschlechtsorgane als solches sieht? Sie sind tatsächlich gar nicht mehr Ermessungsgegenstand, gemäß des Augen-Ersichtlichen, sondern einzig noch, was die Instrumente und Theorien besagen. Hingegen besagen doch die Ersichtungen dessen etwas ganz anderes, als den Augen ersichtlich ist und alles ist ganz anders darin und Nichts ist mehr, wie es einmal war. Was ist das für eine Wissenschaft geworden, in welcher das, was man vor Augen sieht, nicht mehr der Ermessungsgegenstand ist - die Evidenz repräsentiert? Indess zeigt sich vor allem jedoch über die globale Ausweitung darin, daß es doch wahrlich um den Kern der Sache sich dreht, ob denn nun gemäß Plato oder Aristoteles, sich die wahre Wahrheit zeigt. Man hält es für ein Tauziehen, doch dem gilt es einzig zu entgegnen, daß es weder noch für sich ist, sondern es der funktionalen Einheit dessen bedingt, worüber sich die Wahrheit darlegt. Jedoch will man diese tatsächlich wissen? Es hat den Anschein, jedoch ist es eindeutig doch nicht die Ermessung, sonst würde man nicht voneinander trennen, was einzig in seiner Einheit funktioniert. Und gerade darauf gilt es auch im Anatomischen, wie überhaupt in den Ermessungen zu beachten, inwiefern überhaupt das Einheitswesen seine Erachtung findet. Im Bezug auf das Geschlecht hat es nämlich ebenfalls nur den Anschein, tatsächlich zeigt sich jedoch unübersehbar, daß es darin einzig um die Trennung dessen sich dreht.

clitoris.jpg
» Anatomy of the clitoris (2005) «

» Anatomy of the clitoris (2005) «
The Journal of Urology
Helen E. O'Connell


Weibliche und männliche Genitalbeschneidung
Verlag: Tredition

Embryonale Entwicklung

Die männlichen und weiblichen Genitalien entwickeln sich aus ein und demselben embryonischen Gewebe. In den ersten sieben Schwangerschaftswochen, dem sogenannten sexuell indifferenten Stadium, verläuft die Entwicklung noch bei beiden Geschlechtern gleich. Erst am Ende der 7. Schwangerschaftswoche beginnen sich die Geschlechtsorgane zu differenzieren. Beim männlichen Embryo entwickelt sich die Keimdrüse (Gonade) zum Hoden (Testis). Dort wird das männliche Geschlechtshormon Testosteron gebildet. Unter dessen Einfluss entwickelt sich aus den Geschlechtswülsten der Hodensack (Skrotum) und der Genitalhöcker wird zum Penisschaft. Die Genitalfalten schließen sich und bilden die Eichel (Glans penis). Aus einer Gewebefalte der Eichelfurche entsteht die Vorhaut (Präputium penis), welche durch das Vorhautbändchen (Frenulum) mit der Eichel verbunden ist. Der Hoden behält während der Schwangerschaft seine intraperitoneale Lage und wandert erst kurz vor der Geburt von der Bauchhöhle in den Hodensack.

Beim weiblichen Embryo entwickelt sich die Keimdrüse zum Eierstock (Over), in welchem das weibliche Geschlechtshormon Östrogen produziert wird. Die Geschlechtswülste bilden sich zu den großen Schamlippen (Labia majora) und die Genitalfalten zu den kleinen Schamlippen (Labia minora) aus. Der Genitalhöcker entwickelt sich zur Klitoris als weibliches Äquivalent zum Penis, mit dem Unterschied, dass sich diese im Inneren des Körpers befindet und nur die Eichel (Glans clitoridis) sowie die Vorhaut (Präputium clitoridis) von außen sichtbar sind. Anders als beim männlichen Embryo schließt sich der Urogenitalspalt nicht, wodurch die Vaginalöffnung zu Stande kommt.

Die Klitoris

Obwohl die wissenschaftliche Erforschung der Genitalien weit in die Vergangenheit zurückreicht, wurden sowohl das klitorale System, als auch die spezialisierte Struktur der männlichen Vorhaut erst in den 1990er Jahren detailgenau beschrieben. Die ersten bedeutsamen Beschreibungen der Anatomie der Klitoris erschienen in der Renaissance Mitte des 16. Jhs. durch die Anatomen Charles Estienne, Realdo Colombo und Gabriele Falloppio. Seitdem wurde die Klitoris in verschiedenen wissenschaftlichen Schriften thematisiert. Als besonders einflussreich gelten diesbezüglich die Untersuchungen des Anatomen Georg L. Kobelt Mitte des 19. Jahrhunderts.

In der nachfolgenden Zeit wurde die Erforschung der Klitoris jedoch weitestgehend vernachlässigt und ihre verborgenen Strukturen gerieten zunehmend in Vergessenheit. Bis heute wird die Klitoris häufig auf die sichtbare Eichel reduziert. So wird die Klitoris beispielsweise im Duden immer noch als ein "am oberen Ende der kleinen Schamlippen gelegenes weibliches Geschlechtsorgan" definiert.

In den 1990er Jahren begann sich die australische Urologin Helen O'Connell mit ihrem Forschungsteam eingehender mit der Anatomie der Klitoris und deren Beziehung zu den umliegenden Organen zu befassen. Dabei stellte sie fest, dass die klitoralen Strukturen weitreichender sind, als bislang angenommen wurde. Nach dem bisherigen Verständnis setzte sich die Gestalt der Klitoris aus einem Körper (Corpus clitoridis), zwei Schenkeln (Crura clitoridis) und der Eichel (Glans clitoridis) zusammen. In den gängigen Beschreibungen der Anatomielehrbücher erstreckte sie sich lediglich auf einer Ebene, ohne direkten Bezug zur Harnröhre (Urethra) und den beiden Schwellkörpern (Bulbi vestibuli) des Scheidenvorhofs (Vestibulum vaginae). Die Untersuchungen von O'Connell zeigen jedoch, dass die Schwellkörper in direktem Zusammenhang zur Klitoris und zur Harnröhre stehen und weniger dem Scheidenvorhof zuzuordnen sind. Demnach ist die Bezeichnung Vorhofschwellkörper (Bulbi vestibuli) ihrer Ansicht nach nicht ganz zutreffend, weshalb sie eine Umbenennung in KlitorisschweI/körper (Bulbi clitoridis) vorschlägt.

Durch diese zusätzlichen Elemente ergibt sich eine veränderte Gestalt der Klitoris. Mit den Schwellkörpern dehnt sie sich auf eine weitere Ebene aus und stellt somit einen bis zu 9 cm großen dreidimensionalen erektilen Komplex dar, welcher gemeinsam mit Harnröhre und Vagina eine funktionelle Einheit bildet. Das gesamte klitorale System weist zudem eine hohe neurovaskuläre Versorgung auf. Vor allem die Klitoriseichel ist besonders dicht innerviert, da die Stränge des Nervus dorsalis clitoridis dort fast vollständig, mit nur minimaler Verzweigung, ankommen.

Ihr Vorschlag, die Schwellkörper umzubenennen, wurde zwar nicht umgesetzt, ihre Untersuchungsergebnisse wurden jedoch zum Teil aufgegriffen und entsprechende Veränderungen in Anatomielehrbüchern vorgenommen. So werden die Schwellkörper im "Lehrbuch Anatomie" 2011 nicht mehr dem Scheidenvorhof zugeordnet, sondern der Klitoris.

Divider

Sophia_Wallace.jpg
Vagina Art by Sophia Wallace

» Sophia Wallace Art «

Άδάμας (pronounced Adamas is a Greek word meaning "unconquerable") is, to my knowledge, the first anatomically correct sculpture of the clitoris. To make it I had to consult widely divergent images, as so few accurate representations of the true anatomy are available. At first, I imagined the sculpture suspended from the ceiling. As I developed it further, I realized that I wanted the sculpture to stand face to face with viewers. To be viewed as a subject after being absent for so long.

» The Great Wall of Vagina «
» The Spice of Life « » Press Galery «
» Portfolio «
Jamie McCartney

Female genitalia have long been a source of fascination, recently of celebration but generally of confusion. Today it seems that creating images of the vagina is the sole preserve of pornographers, erotic artists and feminists. Step in British artist Jamie McCartney who has grasped the nettle to create a monumental wall sculpture all about this most intimate of places. For 400 women their privates have gone public...

The 9 metre long polyptych consists of four hundred plaster casts of vulvas, all of them unique, arranged into ten large panels. McCartney set out to make this project as broad and inclusive as possible. The age range of the women is from 18 to 76. Included are mothers and daughters, identical twins, transgendered men and women as well as a woman pre and post natal and another one pre and post labiaplasty.


Springer Verlag
,

Während man einerseits sich von der regulär den Augen ersichtlichen Anatomie entfernt, worüber die Wesensschau eine ganz andere, ein Atomare wird und gar Farben darüber bestimmen läßt, das Geschlecht zu ermitteln, entwickelt man anderweitig genau den Gegensatz, in welchem die substanziell unterschiedlichen Grundlagen des Mensch-seins, zu Einem wird und darüber seine Farben verliert. Gerade darin besteht jedoch das größte Übel, denn darüber erfährt des Menschen Wahrnehmung seine eigentliche Manipulation, indem er darüber diese Farben gar nicht mehr in Betracht zieht. Die Phrenologie ist die Grundlage dessen, woraus sich die Lokalisationslehre des Gehirns heraus entwickelte und bis heute die Grundlagen dafür repräsentiert. Doch nennt man es heute anders, obwohl es gar nichts anderes ist. Dies bildet indess vor allem auch die Grundlagen der entstehenden Psychologie, worin die Seele und das Gemüt, und somit auch die Veranlagungen der Sexualität, nicht, wie man denken würde, über den Geist hervortritt, sondern tatsächlich der Geist es ist, welcher dies repräsentierend ist. Dies wird indess weitläufig mißverstanden, aufgrund der logischen Denkweise im Bezug zum Ursprünglichen der Philosophie, jedoch bedingte es der entstehenden Psychologie einer substanziellen Differenzierung und diese besteht gerade darin - man achte auf die Markantz dieser Unterscheidung. Die Worte über Gall's Ausführung verdeutlichen es mustergültig, daß darin Seele und Gemüt das Resultat geistiger Tätigkeit sind. Es handelt sich hierbei um die zwangsläufige logische Konsequenz, gemäß Descartés' Aufbringen, wonach die Wahrnehmung über das Denken stattfindet, sodaß es aus diesem Verhältnis heraus sich auch zwangsläufig auch derart stellt. Im Verbund von Geist = Gehirn, ergibt sich daraus dann auch kein sonderliches Verwundern darüber, sondern es stellt sich wie es ist, da kein anderes angeblich ist. Der Lauf der Dinge basiert somit auch darauf, daß man systematisch die Seele auf die Physis übertragen hat, sodaß man dem gegenüber stehend auch nichts mehr findet, was dem 'als solches' fehlt und sich als vollständig erweist. Und so erweist sich darüber auch die Transformation als vollzogen.

So steckt tatsächlich hierin der Kern der Sache, doch sieht man augenscheinlicherweise nicht, daß man doch hierin einem Organ all die unterschiedlichen Funktionalitäten zuspricht, ohne zu erkennen, obwohl man sich doch auf den Vergleich bezieht, daß doch gerade die Organe der Körper es sind, worüber sich verdeutlicht, daß es derart gar nicht sein kann, sondern jedes Organ eine ganz eigenständige Funktionalität repräsentiert und somit auch eine jeweilige eigenständige Funktionalität eine eigenständige Präsenz darlegt. Und darauf basiert es auch, daß man diese 'Geisteslehre' letztendlich wieder fallen ließ, hingegen über das Gehirn genau dies fortsetzt und den einzelnen Lokalitäten, gemäß organischer Unterscheidungen, die unterscheidenden Funktionalitäten zuspricht. Theoretisch ergibt es seinen Sinn, jedoch auch einzig theoretisch, was hingegen die Praxis widerlegt, zumal das Gehirn nun einmal nur ein Organ ist und kein aus mehreren Zusammengesetztes, worin es vielfältige Verknüpfungen gibt, aber doch die Funktionalität eine einheitliche ist. Indess hat nämlich auch das wahre (Er)Leben noch ein Wörtchen dabei mitzureden, wie sich gerade im Weiteren auch immer ausweitender sich dem gegenüber repräsentiert, denn das ist es, was man dem gemäß 'behandelt' und gerade dies besagt, daß dies absolut unstimmig ist, gegenüber dem, was sich darüber aufzeigt, sodaß auch die Pathologen bereits im 19. Jh. durchweg diese Hirnlokalisationslehren über ihre praktisches Erleben wiederlegen und man indess munter fortschreitet, da nichts anderes ist, was 'belegt', daß da ein Anderes sei, was es sei, daß es hervorbringt, was man erlebt. Man bedenke in dem Bezug auf den Vergleich zum Rechtswesen und die Umkehrung, welche darin stattfand. So findet nämlich gerade hierüber auch genau derselbe Wandel statt, über die Abwendung von der Innensichtung zur reinen Außen- und somit Fremdsichtung, sodaß die Auskunft eines Selbst darin kein Ermessungsgegenstand mehr ist, sondern einzig das, was über Andere(s) darüber besagt wird, sodaß auch das Geschlecht und die sexuelle Orientierung sich einzig noch über andere überhaupt noch abbildet und die Inbetrachtziehung des Selbst sich einzig noch über die Äußerlichkeiten begründen.

SEELE → Hervorbringendes
GEIST → Hervorbringendes (Bestandteil der Seele)
GEMÜT → Hervorgebrachtes (Bestandteil der Seele - 'was in der Seele' bringt es hervor?)

Scheve.jpg
Phrenologische Bilder
Gustav Scheve


zur Naturlehre des menschlichen Geistes
und deren Anwendung Wissenschaft und Leben

Verlag: J.J. Weber
» «

» Grundzüge der Phrenologie (S. 3) «

Die Phrenologie - Geisteslehre - ist die Lehre vom Geiste und von seinen Organen. Die erste Aufgabe der Geisteslehrer ist, die Grundkräfte des Geistes aufzufinden, d. i. diejenigen Geisteskräfte, welche allen Geistesthätigkeiten zum Grund liegen oder auf welche sich alle Geistesthätigkeiten zuletzt zurückführen lassen.

Die Phrenologie, als Geisteslehre, ist eine neue Wissenschaft. Denn obgleich von jeher die Geistesforscher die Grundkräfte des Geistes aufzufinden suchten, so ist ihnen dieses doch vordem nicht gelungen. Sie meinten alle, auf dem Wege der Selbstbeobachtung dieses Ziel erreichen zu können. Allein das eigene Gefühl, die Selbstbeobachtung, das Selbstbewußtsein, giebt uns von der inneren Beschaffenheit, gleichsam von dem Baue unseres Geistes - wenn das Bild gestattet ist - ebenso wenig Kenntnis, als vom inneren Bau, von den Organen und Eingeweiden unseres Körpers. Wir fühlen nur, daß wir, aber nicht, wie wir geistig und körperlich leben.

Die ganze Geschichte der Geisteslehre ist nur ein fortlaufender Beweis für das Gesagte. Alle Geistesforscher, weil sie immer suchten, nie fanden, waren unter sich verschiedener Ansicht über den inneren Geistesbau, jeder nahm andere Grundkräfte des Geistes an, der eine zwei, der andere drei, der andere sieben, der eine diese, der andere jene. Einer sagt z. B., Empfindung und Gedächtnis seien zwei Grundkräfte; ein anderer, das Gedächtnis sei nur die Wiederholung der Empfindung, beide seien daher nur eine Grundkraft. Einige neuere Geistesforscher meinen dem ewigen Streite dadurch ein Ende zu machen, daß sie gar keine Grundkräfte im Geiste unterschieden wissen wollen, sondern alle, wenn auch scheinbar noch so verschiedenen Geisteskräfte, z. B. Verstand und Gemüth, für im Grunde eines und dasselbe erklären. Aber der alte Streit ist durch die neue Meinung nur vergrößert, ein Streit, der auf dem bisherigen Wege nicht entschieden werden kann.

Welcher andere denkbare Weg aber, außer dem der Selbstbeobachtung, könnte zur Kenntnis des Geistesbaues führen? Noch weniger, könnte es scheinen, die Beobachtung des Geistes anderer Menschen. Gleichwohl ist nur dieser Weg der allein richtige und mögliche.

Da nämlich der Geist der einzelnen Menschen ein sehr verschiedener ist, so ist in dieser Verschiedenheit des Geistes das Mittel zur Kenntnis des Geistesbaues gegeben. Da z. B. ein Mensch sehr viel Verstand und sehr wenig Gemüth, ein anderer sehr wenig Verstand und sehr wohl Gemüth haben kann, so ist dadurch gleichsam mathematisch bewiesen, daß Verstand und Gemüth nicht nur scheinbar, sondern im Geistesbau selbst verschieden sind; gerade so wie (von Organen abgesehen) das Sehvermögen vom Hörvermögen als im Geistesbaue dadurch als getrennt erscheint, daß ein Mensch gut sehen und schlecht hören, ein anderer schlecht sehen und gut hören kann. Die auf diesem Wege der Forschung geschaffene Geisteslehre ist bereits mit vielem Fleiß und vielem Erfolg bearbeitet worden. Hier eine kurze Andeutung über das Gefundene.

Der Geistesbau zeigt doch im Allgemeinen drei getrennte Gruppen der Geisteskräfte: die 'niederen' oder 'thierischen' Sinne, die 'Gemütssinne' und die 'Verstandessinne'. Denn irgend welche dieser Gruppen wird oft bei einem Menschen sehr stark oder sehr schwach vor den übrigen gefunden. Es giebt Menschen, welche vorzugsweise leidenschaftlich sind, andere, welche Gefühlsmenschen, andere, welche Verstandesmenschen sind. Jedoch die Unterscheidung der drei Sinnesgruppen als solcher ist deswegen von geringem Werth, weil wieder einzelne Sinne selbstständig und unter sich getrennt sind; es kann im Allgemeinen stark, aber einer dieser Sinne schwach sein. Ein Mensch kann von Charakter leidenschaftlich in der einen Beziehung und leidenschaftslos in der andern sein.

Divider

Phrenologie: altgriechisch 'phrenós' (Geist, Gemüt, Seele) und 'lógos' (Lehre).

Nach Galls Vorstellung war das Gehirn der eigentliche Sitz aller geistigen Tätigkeit des Menschen. Der Charakter und das Gemüt und letztlich auch die Intelligenz ergaben sich für ihn aus dem Zusammenspiel der in verschiedenem Maße vorhandenen geistigen Anlagen.

In all den Veränderungen, welche in dieser Zeit stattfinden, geht es vor allem um das Sortieren, wie man allzuleicht nicht übersehen kann. Die Wissenschaft etabliert und expandiert ihr zugrundeliegendes Ordnungssystem, nun auch in besonderer Weise von der neu entstehenden Staateneinheit getragen. Nicht mehr wie einst, wo es vom Gönnertum abhing und vor allem nicht mehr nur innerhalb des Ihrigen, sondern sie wird in jeglichem Bezug zur Leitpräsenz des kulturellen Daseinswesens. Sie repräsentiert die Darlegung des 'wahren Lebens' und wird damit verbunden zur neuen Maßregel jeglicher Daseinsverhältnisse. Sie trennt sich gleichzeitig aber auch von jeglichem Alten und somit auch explizit vom Glauben und der Mystik. Zumindest ist es ihr Bestrehen, oder vielmehr doch die Anforderung, die man an sie stellt, dem zu entsprechen. Doch gibt es hierin ein wesentliches Problem: das Substanzwesen. Das Sein ist, gegenüber den sich umsetzenden ideologischen und technischen Revolutionen, nicht von diesen begründet, sondern im Bezug auf das Sein 'als solches, ist sie nicht mehr, als ein Teil davon. Und darin gibt es weder einzig 'ihr Neues' und auch ist der Mensch ein Individuum, sodaß sich gar innerhalb der Wissenschaft Kontraste bilden, Kontraste, worüber sich gar jegliche Prinzipialität in Frage stellt, zumal man gar keine tatsächliche Kenntnisse über die Substanzgesetzmäßigkeiten des Seins verfügt. Das Substanzprinzip, auf dem sie ihr Gebäude aufbauen, basiert in seinem Grunde, auf der Ideologie, wie es denn sei - es ist indess überhaupt nicht (be)greifbar bis heute! Zieht man dazu den Vergleich zum kulturellen Leben, kann man es darin wieder finden: die Atome, welche den Raum (des Universums) ausfüllen und die Bewegung derer bewirkt, worüber alles miteinander seinen Urgrund hat, welches man gemäß der Ordnungen und Regeln leitet, um es zu beherrschen, was sich darin ergibt. Das ist die Ideologie in beiden Bereichen, worüber sich ihre Einheit begründet, doch wie stellt sich diese Situation dieser Grundlage der reinen Ideologie?

In der Natur des Seins existieren keine Widersprüche.

Darin besteht der Kern der Sache und nur darüber klärt sich auch tatsächlich auf, inwiefern man über die Wahrnehmung, wie auch über die Vorstellung, mit realen Verhältnissen konfrontiert ist, oder nicht! Es ist die Natur des Daseins selbst, welche einem dessen Sein vermittelt, hingegen sind des Geistes Bildnisse einzig Gebilde und nicht das Sein selbst. Das, was im Geiste erscheint, ist in keiner Weise real, sondern gleicht einem mit dem Bleistift auf Papier gezeichneten Bildnisse. Es ist richtig, daß dessen Hervortreten aus der Erinnerung stammt, dessen Inhalt sich aus der Wahrnehmung heraus begründet, doch ist es nicht das Wahrgenommene selbst, sondern einzig ein Abbildnis dessen Verhältnisse, die man in der Erinnerung antrifft - gemäß einer daraus hervortretenden Zeichung. Darin besteht der Kern der Angelegenheit. Somit kann man in diesen Bildnissen auch verweilen und sich vorstellen, daß die Dinge derart real seien, jedoch nur solange man/sich die Gegebenheit nicht realisiert - im wahren erlebenden Leben als solches, über seine Sinne erfahrend seine wirkungsbasierende Inhaltlichkeit erfährt. Und darauf basiert auch das Verstandeswesen, genau dies im Auge zu behalten und entsprechend dieser beiden Gegebenheiten zu ergründen, wie es sich damit verhält, was jedoch voraussetzt, daß beide Bildnisse miteinander in Erscheinung treten. Hierüber erklärt sich auch der Bumerangeffekt, den man darin etabliert, daß insofern man sich mit Gegebenheiten beschäftigt, die als solche sinnlich gar nicht erfahrbar sind, man darüber auch ein Brücke schlägt, die es trägt und geleitet.

Maßgeblich für das Geschlecht ist jedoch, daß aufgrund der Bestrebungen darin, es seine derartig atomisierende begründenden Beschreibung und Spezifizierungen erfährt, hingegen es einzig dem Einzelnen sich als tatsächlich Suchenden und Ergründenden im Wissenschaftsverhältnis stellt, jedoch nicht für die Wissenschaftsbelange und dessen Konstrukt an sich. Vor allem, daß es das Geschlecht selbst ist, welches dessen Natur repräsentiert, darum dreht sich der Kampf ums Erlangen, gemäß der Vorgabe der Naturgesetzlichkeit, derer man darin folgt. Und so ist auch der folgende Verlauf, vor allem zum Ende des 20. Jahrhundert hindurch, vor allem auch damit gepflastert, gerade dies zu widerlegen, daß es sich einzig aus sich selbst heraus ergibt - das Geschlecht vor allem auch von außen seine ausbildende (Trans-)Formation erfährt und gleichermaßen auch eine sexuelle Vereinigung eine Gegebenheit ist, die sich nicht auf das Selbst beschränkt - nicht rein auf dem beruht. Und so (trans-)formiert man einerseits die Einen zu etwas, was sie nicht sind, dem gegenüber sich Diejenigen (trans-)formieren, denen es nicht einerlei ist - nicht gegeben ist, so zu sein, wie man vorgibt es sei. Tatsächlich entwickelt sich ein einziges Debakel, die auf Grundlagen basieren, die gar nicht existieren. Man hat sie nicht und zwar allseits. Die Einen beschreiben und händeln etwas, was ihnen vorgegeben ist und die Anderen ersehen und erkennen etwas, aber man kann es gar nicht beschreiben - denn die Worte, die es beschreiben, die gibt es nicht. Es sind Gegebenheit des Erfahrens und darin ist es nicht diese Sprache, welche darin in Erscheinung tritt, sondern es sind Wirkungen - Wirkungen des Seins, worüber dies selbst sich bemerklich macht und aufzeigt, wie es ist. Es ist somit auch an sich gar nicht des Verstandeswesens nötig, sondern es stellt sich gar einzig als ein Zusätzliches, des menschlichen Daseins, damit der Mensch nicht erst gegen die Wand rennen muß, um sie als solche zu erfahren. Doch gibt es Menschen, die trotz dessen, daß sie vor einer Wand stehen, selbst wenn sie den Menschen fortwährend daran hindert, sich darüber hinaus fortzubewegen, ihn darin nicht unbedingt darin hindert, gar beständig gegen diese zu laufen, wie ein Fliege, die versucht durchs Glas im Fenster zu fliegen, worüber sich auch die Präsenz des Verstandes oder nicht darlegt. Illusion ist eine Sache, Verstandeslosigkeit indess eine ganz andere, gerade dies sollte man sich verdeutlichen, denn darauf kommt es an - sie ist nämlich eine Veranlagung, worüber man die Illusion erkennt, indess wird über die Illusion weder der Verstand, noch die Veranlagungen als solche ersichtlich. Und ob man sie mit seinen Augen ersieht, ist hierin nicht wesentlich, sondern daß man sie erfährt, daß sie eine gegebene Präsenz des Daseins ist.


& die sieben Welträthsel
Verlag: Veith & Company
» «

» S. 24 « Ein physikalisches Atom, d. h. eine im Vergleich zu den Körpern, die wir handhaben, verschwindend klein gedachte, aber trotz ihrem Namen in der Idee noch teilbare Masse welcher Eigenschaften oder ein Bewegungszustand zugeschrieben werden, wodurch das Verhalten einer aus unzähligen solchen Atomen bestehenden Masse sich erklärt, ist eine in sich folgerichtige und unter Umständen, beispielsweise in der Chemie der mechanischen Gastheorie, äußerst nützliche Fiktion. In der mathematischen Physik wird übrigens deren Gebrauch neuerlich möglichst vermieden, indem man, statt auf diskrete Atome, auf Volumelemente der kontinuierlich gedachten Körper zurückgeht.

Ein philosophisches Atom dagegen, d. h. eine angeblich nicht weiter teilbare Masse trägen wirkungslosen Substrates, von welcher durch den leeren Raum in die Ferne wirkende Kräfte ausgehen, ist bei näherer Betrachtung ein Unding.

» S. 30 «So werden durch diese grundlegende Verschiedenheit zwischen den Individuen der toten und denen der lebenden Natur die Vorgänge in letzteren dem Gesetz der Erhaltung der Energie Untertan. Neben ihr verschwinden an Bedeutung, sofern sie nicht darin aufgehen, die von Ernst Heinrich Weber scharfsinnig ausgedachten, die beiden Klassen von Individuen mehr äußerlich trennenden Merkmale. Den sonst vom Vitalismus hervorgehobenen Unterschieden, der angeblich höheren Unbegreiflichkeit und Unnachahmlichkeit der Lebewesen, ihrer Zweckmäßigkeit, verschiedenen Reaktion und Unteilbarkeit liegt meist unrichtige Auffassung zugrunde. Was insbesondere die Unteilbarkeit betrifft, so beruht zwar die sogenannte Teilbarkeit mancher Organismen nur auf einem weitreichenden Regenerationsvermögen. Doch sind in der Idee Lebewesen nach Art der Kristalle teilbar in konstituierende Elementarorganismen, so daß sie kaum noch Individuen heißen dürften; andererseits sind Maschinen unteilbar nach Art der Lebewesen, da in beiden die Wirkung des Ganzen die der Teile, die Wirkung der Teile die des Ganzen bedingt. So erklärt sich ohne grundsätzliche Verschiedenheit der Kräfte im Kristall und im Lebewesen, ohne Lebenskraft in irgend einer Form oder Verkleidung, daß beide miteinander inkommensurabel sind wie ein in lauter ähnliche Werkstücke spaltbares Bauwerk und eine Maschine, und somit ist für den Forscher kein Grund vorhanden, zwischen beiden Reichen jene absoluten Schranken gelten zu lassen, wie sie der unbefangene Menschensinn freilich allerorten und jederzeit erblickt hat und erblicken wird, und wie eine erst in unseren Tagen abgelaufene Periode der Wissenschaft sie zum Dogma erhob.

» S. 37 «Mit einem Wort, der gelungenste Beweis, daß keine Wechselwirkung von Körper und Seele möglich sei, läßt dem Zweifel Raum, ob nicht die Prämissen willkürliche seien, und ob nicht Bewußtsein einfach als Wirkung der Materie gedacht und vielleicht begriffen werden könne. Für den Naturforscher muß daher der Beweis, daß die geistigen Vorgänge aus ihren materiellen Bedingungen nie zu begreifen sind, unabhängig von jeder Voraussetzung über den Urgrund jener Vorgänge geführt werden.

» S. 40 «Was nun aber die geistigen Vorgänge selber betrifft, so zeigt sich, daß sie bei astronomischer Kenntnis des Seelenorgans uns ganz ebenso unbegreiflich wären, wie jetzt. Im Besitze dieser Kenntnis ständen wir vor ihnen wie heute als vor einem völlig Unvermittelten. Die astronomische Kenntnis des Gehirnes, die höchste, die wir davon erlangen können, enthüllt uns darin nichts als bewegte Materie. Durch keine zu ersinnende Anordnung oder Bewegung materieller Teilchen aber läßt sich eine Brücke ins Reich des Bewußtseins schlagen.

Bewegung kann nur Bewegung erzeugen, oder in potentielle Energie zurück sich verwandeln. Potentielle Energie kann nur Bewegung erzeugen, statisches Gleichgewicht erhalten, Druck oder Zug üben. Die Summe der Energie bleibt dabei stets dieselbe. Mehr als dies Gesetz bestimmt, kann in der Körperwelt nicht geschehen, auch nicht weniger; die mechanische Ursache geht rein auf in der mechanischen Wirkung. Die neben den materiellen Vorgängen im Gehirn einhergehenden geistigen Vorgänge entbehren also für unseren Verstand des zureichenden Grundes. Sie stehen außerhalb des Kausalgesetzes, und schon darum sind sie nicht zu verstehen, so wenig, wie ein Mobile perpetuum es wäre. Aber auch sonst sind sie unbegreiflich.

Es scheint zwar bei oberflächlicher Betrachtung, als könnten durch die Kenntnis der materiellen Vorgänge im Gehirn gewisse geistige Vorgänge und Anlagen uns verständlich werden. Ich rechne dahin das Gedächtnis, den Fluß und die Assoziation der Vorstellungen, die Folgen der Übung, die spezifischen Talente u. dgl. m. Das geringste Nachdenken lehrt, daß dies Täuschung ist. Nur über gewisse innere Bedingungen des Geisteslebens, welche mit den äußeren durch die Sinneseindrücke gesetzten etwa gleichbedeutend sind, würden wir unterrichtet sein, nicht über das Zustandekommen des Geisteslebens durch diese Bedingungen.

» S. 44 « Der unlösliche Widerspruch, in welchem die mechanische Weltanschauung mit der Willensfreiheit, und dadurch unmittelbar mit der Ethik steht, ist sicher von großer Bedeutung. Der Scharfsinn der Denker aller Zeiten hat sich daran erschöpft, und wird fortfahren, daran sich zu üben. Abgesehen davon, daß Freiheit sich leugnen läßt, Schmerz und Lust nicht, geht dem Begehren, welches den Anstoß zum Handeln und somit erst Gelegenheit zum Tun oder Lassen gibt, notwendig Sinnesempfindung voraus. Es ist also das Problem der Sinnesempfindung, und nicht, wie ich einst sagte, das der Willensfreiheit, bis zu dem die analytische Mechanik reicht.

Damit ist die andere Grenze unseres Naturerkennens bezeichnet. Nicht minder als die erste ist sie eine unbedingte. Nicht mehr als im Verstehen von Kraft und Materie hat im Herleiten geistiger Vorgänge aus materiellen Bedingungen die Menschheit seit zweitausend Jahren, trotz allen Entdeckungen der Naturwissenschaft, einen wesentlichen Fortschritt gemacht. Sie wird es nie. Sogar der Laplacesche Geist mit seiner Weltformel gliche in seinen Anstrengungen, über diese Schranke sich fortzuheben, einem nach dem Monde trachtenden Luftschiffer. In seiner aus bewegter Materie aufgebauten Welt regen sich zwar die Hirnmolekeln wie in stummem Spiel. Er übersieht ihre Scharen, er durchschaut ihre Verschränkungen, und Erfahrung lehrt ihn ihre Gebärde dahin auslegen, daß sie diesem oder jenem geistigen Vorgang entspreche; aber warum sie dies tue, weiß er nicht. Zwischen bestimmter Lage und Bewegung gewisser Atome eigenschaftsloser Materie in der Sehsinnsubstanz und dem Sehen ist so wenig Beziehung wie zwischen einem ähnlichen Hergang in der Gehörsinnsubstanz und dem Hören, einem dritten in der Geruchsinnsubstanz und dem Riechen, usw., und darum bleibt, wie wir vorhin sahen, die objektive Welt des Laplaceschen Geistes eigenschaftslos.

An ihm haben wir das Maß unserer eigenen Befähigung oder vielmehr unserer Ohnmacht. Unser Naturerkennen ist also eingeschlossen zwischen den beiden Grenzen, welche die Unfähigkeit, einerseits Materie und Kraft zu verstehen, andererseits geistige Vorgänge aus materiellen Bedingungen herzuleiten, ihm ewig steckt. Innerhalb dieser Grenzen ist der Naturforscher Herr und Meister, zergliedert er und baut er auf, und niemand weiß, wo die Schranke seines Wissens und seiner Macht liegt; über diese Grenzen hinaus kann er nicht, und wird er niemals können.

Je unbedingter aber der Naturforscher die ihm gesteckten Grenzen anerkennt, und je demütiger er in seine Unwissenheit sich schickt, um so tiefer fühlt er das Recht, mit voller Freiheit, unbeirrt durch Mythen, Dogmen und alterstolze Philosopheme, auf dem Wege der Induktion seine eigene Meinung über die Beziehung zwischen Geist und Materie sich zu bilden.

Divider

» Geflügelte Worte (1920) «
der Zitatenschatz des deutschen Volkes
Verlag: Haude & Spenerschen Buchhandlung
Georg Büchmann

Emil du Bois-Reymond (1818-96) schloß seine 1872 zu Leipzig gehaltene Rede 'Über die Grenzen des Naturerkennens' mit den Worten: "In bezug auf die Rätsel der Körperwelt ist der Naturforscher längst gewöhnt, mit männlicher Entsagung sein Ignoramus auszusprechen. In Rücksicht auf die durchlaufene siegreiche Bahn trägt ihn dabei das stille Bewußtsein, daß, wo er jetzt nicht weiß, er wenigstens unter Umständen wissen könnte und dereinst vielleicht wissen wird. In bezug auf das Rätsel aber, was Materie und Kraft seien und wie sie zu denken vermögen, muß er ein für allemal zu dem viel schwerer abzugebenden Wahrspruch sich entschließen:

Ignorabimus

Wir werden es nie wissen.

Dies Wort wiederholte du Bois-Reymond 1881 in der Rede über die sieben Welträtsel. Am 8. Juli 1858 hatte er in der Gedächtnisrede auf Johannes Müller gesagt, es habe Müller nie verdrossen, "als das Ergebnis noch so langer und mühsamer Erörterung den altschottischen Wahrspruch niederzuschreiben: 'Ignoramus'". Dies "Ignoramus" ("wir wissen es nicht") ist somit der Keim seines geflügelten Wortes. "Ignoramus" war die Formel der Geschworenen Altenglands im Fall ihrer Unentschiedenheit, ob eine Anklage begründet oder unbegründet sei. Nach R. Gneist, Engl. Verfassungsgesch., 1882, S. 604 Anm. suchte König Karl II. dies "Ungeheuer", wie er es nannte, zu beseitigen, das "in den Jahren 1680 - 82 in der City von London gewütet habe", als es sich für die Krone um die Frage handelte, "ob Verrat und Aufruhr in London und Middlesex strafbar sei oder nicht".

Denselben Gedanken kleidet der französische Skeptiker Montaigne (1533 - 1592) in seiner bekannten Devise "Que sais-je?" in fragende Form. Vgl. Essais (1580) II, 12. Anknüpfend an Montaigne schreibt Friedrich der Gr. an d'Alembert am 7. Mai 1771: "Consolons-nous, mon cher d'Alembert, nous ne serons pas les seuls condamnés á ignorer á jamais la nature divine". (Oeuvres XXIV, S. 596 der 4° Ausgabe von Preuß.) Aber schon im siebenjährigen Kriege sagt er 1760 zu seinem Vorleser de Catt: "Cette campagne sera vive, mon cher; elle sera terrible. Quel en sera le résultat? Ignoramus est-ce lá du bon latin?" Vgl. de Catt, Mémoires S. 309 in den Publ. a. d. Preuß. Staatsarchiven , Bd. 22. Siehe auch unten: "Non liquet".

... andererseits sind Maschinen unteilbar nach Art der Lebewesen, da in beiden die Wirkung des Ganzen die der Teile, die Wirkung der Teile die des Ganzen bedingt.

Gerade hierauf basiert das Elementare des Substanzverhältnisses des Seins, daß die Funktionalität eine Eigenständigkeit ist, welche den (Wirkungs-)Einheiten innerhalb des Seins selbst nicht gegeben ist, sondern diese ist, wenn sie dem entspricht. Und gerade darüber zeigt sich auch, wie man es im Grundsatz allgegenwärtig in der Natur des Seins antrifft, über Werden, Sein und Vergehen einher gehend. Die (Wirkungs-)Einheiten, gemäß dem sie sich bilden und derart präsent sind, sind einzig als solche präsent, gemäß der erfüllenden Funktionalität oder nicht (darauf basiert Bestand und Wandel). Der wesentliche Unterschied besteht eben auch aus dem von Wirkungseinheit und -verbund und daß man es mit einem grundsätzlichen, durch das Funktionsprinzip gegebenen grundsätzlichen (kausalen!) Kollektivwirken zu tun hat. Nichts ist aus sich selbst heraus, sondern einzig aufgrund dieses Verbundswesens überhaupt in der Art existent, wie wir es in seiner auftretenden Einheit erfahren, dem gemäß auch hierin der Wandel von Sein und Nicht-Sein dessen sich dem gemäß ergibt. So ist es richtig, daß bei Maschinen Teile als solche auch für sich funktionieren können, insofern sie dazu eingerichtet wurden, indess kann das organische Leben des Menschen einzig in seiner Einheit funktionieren und keines seiner Teile abgetrennt für sich. Gerade darüber stellt sich auch 'das Leben' gemäß seiner darüber erscheinden Eigenständigkeit nicht als ein resutierender Bestandteil des Körpers, sondern es verhält sich hierin umgekehrt, daß nämlich der Körper aus dem Leben heraus resultiert und sein Sein sich darüber bestimmt, inwiefern es der menschlichen Funktionalität, welche darin das Gebilde ist, auch entspricht und entsprechend umsetzt.

Die neben den materiellen Vorgängen im Gehirn einhergehenden geistigen Vorgänge entbehren also für unseren Verstand des zureichenden Grundes. Sie stehen außerhalb des Kausalgesetzes, und schon darum sind sie nicht zu verstehen.

Auch der Geist und seine Bildnisse unterliegen strickweg der Kausalität (dem von 'Bildnissen/Gebilden'!), indess beruhen die reproduzierten Projektionen auf sinneserfahrenen Wahrnehmungen, sodaß in diesem in keiner Weise etwas in Erscheinung treten kann, was nicht auf dieser substanziellen Grundlage beruht (aus Nichts kann nichts werden, gilt auch hierin!). Selbst die Illusion beruht darauf, wobei sich bereits als Illusion stellt, insofern man des Geistes Hervortretungen als eine reale Erscheinung und eben nicht als reproduzierte Bildnisse/Gebilde ersieht. Gleichermaßen stellt es sich auch als Illusion, daß die elektrochemischen Gehirnaktivitäten (was sich physikalisch darüber darlegt) den Geist repräsentieren. Es ist somit gerade die Mißachtung der Kausalität, die man darin pflegt, worauf das Unverständnis beruht, wobei es sich ursächlich um einen Unwillen handelt, es gemäß der kausalen Erscheinungen nachzuvollziehen, da man bedingend den geistigen Inhalt dem Gehirn zuzuschreiben sucht, um es als solches darüber in ihr Repertoire zu etablieren, sodaß der Geist als solches indess die eigentliche Behinderung darstellt, warum man diesen selbst, aber nicht seinen Inhalt, als unerklärlich stellt. Markant ist, daß überhaupt erst darüber der Geist eine derartige substanzielle Aufmerksamkeit für seine substanzielle Präsenz erfuhr, derart es vorher gar nicht existierte, sondern dieser selbst in seiner substanziellen Präsenz ein generell vages Etwas war. Über die ausufernden Ergündungen geistiger Aktivitäten indess, kam überhaupt erst dessen substanzielle Spezifikation 'dessen Eingrenzung' zustande. Darauf basiert hingegen auch der Wandel, welchen man vollzogen hat, daß man dem gegenüber einzig des Geistes Inhalte auf das Gehirn verlagerte und darüber die Beschreibungen vollzieht und den Geist als solches außen vor stellt, zumal man eine Lokalisation dessen im Gehirn auch gar nicht ausfindig machen kann. So besteht aber gerade auch hierin das Mißverhältnis auf der Mißachtung der Kausalität, denn diese besagt, daß der Geist mit seinem Willen einzig das Steuerruder in Händen hält, dieser aber weder Steuerruder, noch überhaupt Ausführendes ist, sodaß sich darüber auch eindeutig klärt, wie es sich mit den Gegebenheiten verhält.

Es ist also das Problem der Sinnesempfindung, bis zu dem die analytische Mechanik reicht.

Und darauf basiert auch der Kern des eigentlichen Mißwesens, worauf die vehement festhaltende Trennung des Äußeren und Inneren besteht und überhaupt erst zustande kam. Man zieht nämlich einzig (noch) die äußeren Sinne als Wahrnehmungsorgane in Betracht, jedoch gleichzeitig den Geist im Innern, welcher diese Bildnisse äußerer Wahrnehmung reprojiziert - im Verbund der ideologischen Vorstellung, daß man angeblich die Kausalität im Auge hat, jedoch gerade den Kernpunkt nicht ersieht, daß die Wahrnehmung des Äußeren nach innen geht (kausale Voraussetzung) und es dort doch zusätzlich einer weiteren - dessen Wahrnehmung darin bedingt. Aristoteles hatte einst zumindest erkannt, daß es zur erfahrenden kombinierten Hervorbringung der diversen Sinne, wie es über die Bewußtwerdung erfahren wird, eines weiteren Organes bedinge, welches dies zustand bringt, auf der Grundlage, daß diese selbst es nicht sein können (das Auge kann nicht hören etc.). Dieser hatte als Einziger, zumindest diese kausale Voraussetzung und Logik erkannt. Indess hat bisher keiner erkannt, daß es sich doch überhaupt um innere Wahrnehmung handelt, worüber die Bewußtwerdung dessen zustande kommt und es (kausal) dessen bedingt, um im Innern überhaupt in Erscheinung zu treten. Eine solche Trennung von Innerem und Äußerem existierte indess bei den alten Griechen nicht, sodaß ihnen der Nachvollzog als solches auch nicht ersichtlich werden konnte. Hingegen wird es jedoch überhaupt erst über die spezifische Trennung von Innerem und Äußerem unübersehbar, daß dem so ist - die Entwicklung brachte es mit sich, aber man ersieht es nach wie vor noch nicht. Wir nehmen nicht 'im Auge' wahr, was sich darüber vermittelt, sondern in dem, was unser Innen(er)leben - unser bewußtwerdende Wahrnehmung ausmacht.

So ist gerade dieser Gegenstand der Aussage von du Bois-Reymond elementar, denn speziell über die Klarheit der Physikalität der wissenschaftlichen Ergründung, klärt sich die Eindeutigkeit äußerer und innerer Wahrnehmung in seiner voneinander scheidenden Abrenzung - dem äußeren/körperlichen und innerem Dasein. Und gerade darauf basiert auch der unumstößliche Beweis und stellt sich als wissenschaftliche Evidenz, denn daß der Mensch über die innere Wahrnehmung verfügt und über das darüber erfahrende Innenerleben, stellt sich von Grund auf gar nicht in Frage, da es jeder Mensch als solches erlebt, sondern einzig, was es damit auf sich hat und wie dies funktioniert, hingegen wiederum auch dies ergründbar ist, da ein jeder Mensch darüber verfügt. Tatsächlich stellt es sich nämlich derart, daß es ein Paradoxum ist, dies überhaupt in Frage zu stellen, jedoch wird es nicht nur in Frage, sondern gar gänzlich außen vor gestellt, als nicht evident, wohingegen dies einzig als möglich erscheint, da man den Menschen nicht dem gemäß überhaupt getrennt voneinander ersichten kann, da es das Eine ohne das Andere nicht gibt. Es ist die Paradoxität, welche dieses Mißwesen ausmacht und gleichzeitig als solches auch unübersehbar darlegt. Und gerade dies klärt sich ebenfalls über die Spezifizierung und damit verbunden Eingrenzung der Wahrnehmung der äußeren Sinne als solche, über deren Funktionalität, worüber sich aufzeigt, inwiefern es darin kein Inneres gibt. Tatsächlich ist dies gar nicht möglich, da zwar nicht jegliche, aber doch sämtliche Wirwesen zumindest letztendlich sich auch nach außen auswirken, dem gegenüber man jedoch nicht die Gegebenheiten, sondern einzig die Theorien betrachtet und sich gerade darüber zeigt, daß sie tatsächlich gar nicht die Sinne benutzen, um zu sehen. Auch hierin klärt es sich wiederum über die (Miß)Achtung der Kausalität.

Hierzu gilt es, darauf aufmerksam zu machen, daß man sich im Bezug auf die englische Bezeichnung 'perception' (Locke und Co.) weiträumig mit dessen konkreter Spezifikation auseinander setzte, man jedoch zu keiner Klarheit darüber gelangte und sich dies generell als bestehendes Unverständnis stellt. Verdeutlicht man sich jedoch, daß es sich um eine Synonymität handelt, was man über die Auseinandersetzung damit auch zwangsläufig erfährt und klärt, was es damit auf sich hat, erfährt es darüber auch seine Erläuterung. Diese Synonymität ist nämlich in seinem Grunde gar nicht zu übersehen, da sie auf dem Sehen und Ersehen beruht - dem zugrunde liegenden Unterschiede dessen - und es sich um zwei Seiten der Gegebenheit handelt, nämlich um eine aufnehmende/weiterleitende und eine aufnehmende/verarbeitende Instanz. So kann man nämlich über das Auge sehend, (gemäß der physikalischen Wahrnehmung) auch nicht wahrnehmen, was dieses sieht, wenn die Aufmerksamkeit davon abgelenkt und abseitig dessen sich befindet. Und auch was man darüber sieht, bestimmt sich nicht nur über das Auge, welches einzig gemäß einer Kamera fungiert, sondern über die bewußte Aufmerksamkeit (was den Film in der Kamera repräsentiert). Hierüber wird auch ersichtlich, daß es im Inneren ein Auge gibt, welches ebenfalls derart funktioniert und überhaupt erst darüber, nämlich die uns bewußt Werdende, als solche die eigentliche Wahrnehmung repräsentiert. Es steckt somit, sowohl in der Inbetrachtziehung der Sache, wie auch der begrifflichen Undifferenziertheit, daß man hierin keine Unterscheidung praktiziert und aufgrund dessen als solches auch nicht ersehen wird. Zwischen der Kamera und dem Film in der Kamera besteht gleichermaßen dieser substanziell gravierende Unterschied, worüber man es auch kennt und sich dem entsprechend unmißverständlich stellt. Speziell über das Sehen der Augen, ergibt sich diese besondere Klarheit, so auch über den Umstand, daß das aufgenommene Bildnis gar nicht reproduzierbar ist, denn es basiert auf der Lichtreflektion, welche zum Auge gelangt und kann aufgrund dessen auch nicht über eine Reproduktion gleich dem, anders als derart in Erscheinung treten. Die Vorstellung, welche man praktiziert, daß dieses Bildnis in 'physikalische Reize' umgewandelt würde und hiernach dann wieder im Geiste gleich dem in Erscheinung treten würde, dafür sind vor allem auch die geistigen Erscheinungen der 'lebendige Beweis', daß dem NICHT so ist, denn dieser kann gar keine Empfindungen wiedergeben, sondern einzig Versinnbildlichungen dessen. Wie man dem entnehmen kann, ist hierin alles Queer geraten und das sich diese Grundlagen auch auf die Erforschungen und Darstellungen der Sexualität überträgt, braucht es eigentlich gar nicht der speziellen Erwähnung. Gerade darin steckt nämlich die Ursache, daß die Klärungen, die man darin schafft, letztendlich alle miteinander einzig in Queer enden, denn Klarheit kann darüber nicht entstehen, sondern darüber entstanden überhaupt erst die Unklarheiten, die alles verklären.

Bewußtsinn

Zur zusätzlichen Verdeutlichung: wenn man seine Aufmerksamkeit auf das Sehen der Augen fokussiert, erscheint hierüber die Wahrnehmung als eine Einheit, jedoch einzig in dem Verhältnis, denn sobald man die Aufmerksamkeit auch nur zusätzlich auf eine andere Wahrnehmung (hören, riechen, fühlen, empfinden ...) richtet, verändert sich dies und wird gar unbewußt, vor allem jedoch auch, wenn man sich in Gedanken verliert. Wenn man sich somit auf eine andere Wahrnehmung spezifisch fokussiert, verschwindet regelrecht die Wahrnehmung des Sehens der Augen und man sieht nichts mehr - es ist gänzlich unbewußt, trotz daß die Augen doch weiterhin ihr Sehen vermitteln. Somit zeigt sich hierüber auch in seiner Klarheit, daß die Bewußtwerdung der Wahrnehmung eine davon differenzierende Eigenständige ist. Das Besondere hierin ist, daß man nicht alles gleichzeitig und gleich klar in Erscheinung bringen kann, sondern jeweils nur in einer bestimmten Relation der Priorität, 'gemäß der funktionalen Kapazität' des Bewußtsinnes, welcher dies hervorbringt und gerade darüber sich auch dessen Funktionsweise darlegt. Und so bildet dies auch den Grundstock des eigentlichen Ersehens des Bewußtsinns selbst, worüber auch dessen Eigenart an Funktionalität in aller Klarheit ersichtlich wird. Tatsächlich verfügen wir gar sprachtechnisch über die erforderliche Unterscheidung, nämlich über das Sehen und Ersehen. Jedoch wird es von Grund auf nicht derart ersichtet, da man dem Geiste das Ersehen zuspricht, was jedoch auf der Reflektion von Gesehenem beruht und sich darüber auch unterscheidet, hingegen ohne dieses Spezifische der Differenzierung und Abseitigkeit dessen, auch daraus nicht ersichtlich ist. Aufgrund dessen, wie auch überhaupt zur Ersichtung der Innerlichkeit, bedingt es 'zu ersichten', daß der Geist gar keine Wahrnehmung hervorbringt, sondern einzig Projektionen aus der Erinnerung, worüber sich die Klarheit dann auch noch einmal spezifisch verdeutlicht - und vor allem auch, den kausalen Gegebenheiten entsprechend, dies erläuternd vor Augen führt.

Was die Entwicklungen zur Erlangung des neuerlichen Statuses der Medizin betrifft, so fußt dies jedoch gerade auf dem Element der Abspaltung und Abgrenzung derer, um sich in ihrer Eigenständigkeit als Naturwissenschaft zu etablieren und somit, gemäß der Physik und Chemie Grundlagen zu schaffen, worüber sich ein solches ergibt. Hingegen suchte man sehr wohl auch die Verbindungen zu verknüpfen, welche den Menschen in seiner Ganzheitlichkeit auch darin bewahren, wie sich u.a. auch eine neu entstandene Anthropologie etablierte, um diese im Verbund mit der Medizin zu gestalten. Jedoch wird aus diesem ursprünglich angebahnten Gesinnungswesen, ebenfalls ein abspaltendes, indem sich im Verlaufe die Anthropologie einzig noch als ein Vergleichswesen entwickelt und darüber nicht das Sein des Selbst, sondern rein das vom anders sein anderer Kulturen darin zum Erfüllungsgegenstand wird, zumal es nämlich seine Integration in der Medizin nicht erlangte. Die später entstehende Psycholgie, die sich aus der Philosophie heraus abspaltet, tritt indess bereits in ein Wesensverhältnis, worin ihr einzig ein außen vor stehen, gegenüber der Medizin, vorausgesetzt ist. Die Medizin ist dem gemäß auch nicht auf den Menschen in seiner Einheit ausgerichet, sondern gemäß den Prinzipien ihrer funktionalen (isolierten/fachtechnischen) Stellung, ihren Teil zum 'wissenschaftlichen' Gesamtwesen beizutragen. Der Mensch wird somit auch nicht nur im Bezug auf die zwei Seiten des Äußeren und Inneren gespalten, sondern in jegliche voneinander sich scheidende Gesinnungswesen der Wissenschaftswesen, dem der Mensch als solches gegenüber steht und sich gar nicht mehr darin wiedererkennen kann, da ein solches Isoliertes in diesem gar nicht existiert.

Darin besteht der Kern der Angelegenheit, denn selbst die Ausgrenzung innerer und äußerer Wahrnehmung ist diesem gar nicht möglich, sondern einzig chematisch sachlich zu fassen, denn eine äußere Wahrnehmung ohne die Innere, wie auch umgekehrt, ist funktional ein Ding der Unmöglichkeit - es existert generell einzig als Einheit(sverbund), was die Wissenschaft fachtechnisch als solches splittet und die Gegebenheiten 'daraus' ergründet. Des Menschen Organismus basiert auf einem vernetzten Kollektivsystem, worin diesem einzelne Bestandteile, wie Arme, Beine und anderes diesem verloren gehen kann und dieser weiterhin aus seiner Grundfunktion heraus besteht, jedoch die Arme und Beine anderes nicht. Und bei anderen Teilen, wie das Herz, geht diesem auch das Leben an sich verloren. So wird der Mensch darüber jedoch auch gänzlich verwirrt und bemerkt gar nicht, welcher Wahnsinn sich da eigentlich darbietet, wenn ein Zoologe, wie Kinsey hin geht und die Vorstellungen des Geistes ergründet, gemäß eines Psychologen und man daraus funktionale Schlüsse zieht, wie es sich mit dem 'körperlichen' Geschlechtswesen bestellt sei, wo dies doch gar nicht der Geist ist, welcher die sexuelle Erregung 'darin' hervorbringt. Oder wie verhält es sich darin? Darin besteht der eigentliche Haken, denn aufgrund der Splittung und Separierung der Einzelbstandteile werden hierüber Aussagen gebildet, die gar nicht als solche existieren können, da es nämlich nicht dem entspricht, wie es funktional eingerichet ist. Und über die völligen Verwirrungen läßt sich dann auch noch letztendlich manifestieren, daß des Geistes Denken doch nur elektronische Signale des Gehirns sind. Was soll man sich auch anderes noch denken, wenn der Geist ja doch letztendlich völlig durcheinander gebracht worden ist, zumal dieser selbst auch gar nicht selbst das Organ ist, welches die Wahrnehmung hervorbringt, komplettiert dies auch die gänzliche Ver(w)irrung. Rien ne va plus - nichts geht mehr - es wird zum Lotteriespiel, was darüber stattfindet und was nicht - ein absolutes Desaster indess, und weiter nichts.

Die derartig stattfindende Zentrierung und Alleinstellung des Geistes macht dies möglich, vor allem, da dieser keine Empfindungen hat - um darüber die Empfindungen und Gefühle zu erfahren, wie sie dem Organismus und seiner Wesensart als solche widerfährt. Ohne differenzierende Erachtung der Hervortretungen der Bewußtwerdung und somit auch der Sinnlichkeit, durch ein anderes (Organ - Bewußtsinn), ergibt sich darüber ein außgen vor geraten dessen. Diese Gegebenheiten geraten darüber auch als gänzliches Unverständnis gegebenüber deren Erscheinungen, die darin gar nicht vorkommen, auch zu einem Verhältnis, zur Abschiebung dessen ins Unbewußtsein und trennt somit auch des Menschen geistige Identität von seinem Selbst - die Einheit des Selbst wird hierüber aufgelöst. Es ist jedoch auch einzig der Geist in seiner derartigen Isolierung, worüber dies überhaupt möglich ist. Man achte hierzu einmal auf die Verwandschaft von 'möglich' und 'mögen', denn hinter all den kulturellen Entwicklungen, oder passender ausgedrückt, den Ausschreitungen, steckt unübersehbar die Leitfigur der Popularität. Einzig das, was sich als populär stellt, erfährt tatsächlich und einzig seine Umsetzung, dem gegenüber alles andere darüber außen vor gerät und verlustigt geht - und einzig noch als Mittel zum Zweck dient. Es beschreibt darüber aber auch das Selbst, welches man dahinter antrifft und gerade der Geschichtsverlauf zeigt, daß dieser Mensch sich so gar nicht will, wie er ist, sondern dieser danach strebt, wie es denn sein soll. Gerade dies zeigt sich auch in unübersehbarer Weise im Bezug auf das Geschlecht und die Sexualität, worin es den Einen darum geht, in Erfahrung zu bringen, wie die Gegebenheiten darin sind und vor allem, sie gemäß der Gegebenheiten zu leben, man jedoch unablässig dem gegenüber hinfort schreitet, einzig zu ermessen, was man als zu Erlangendes dem zuzufügen sucht. Und so wird es als solches auch weitläufig gar nicht ersichtlich, da man die Dinge miteinander 'koppelt', jedoch wird es gerade auch darüber ersichtlich, indem man die Ermessung gemäß dieser Verkuppelung des Verbundes in Betracht zieht.

Zur Entwicklung gilt es zu bedenken, daß die Einheit geistiger Vorstellung und Sein von Grund auf nicht gegeben ist und auch nicht zu erlangen ist, denn beim Geistigen handelt es sich um reproduzierte Bildnisse und nicht um das Sein selbst. Indess liegt die Bestrebung darin, dies miteinander zu vereinen, gemäß dem sich auch die stattfindenden Entwicklungen gestalten, deren Grundlage sich jedoch je nach Warte der Inbetrachtziehung, gemäß der Priorität unterscheidet. So ist auch bei den alten Griechen, gerade dies eben nicht (regulär) eine Einheit, sondern sondiert sich in seinem Bezug auf die Wahrheit - das wahr(e) Sein, wohingegen man in der erneuernden Entwicklung eine andere Sondierung in Betracht zieht, die man nicht als Wahrheit, sondern Realität definiert und handhabt - abseits des Wahrheitswesens, welches gar außen vor gestellt wird, als unreal definiert, wobei gerade dies doch des Geistes Einstellung zum Sein repräsentiert. Dem gemäß nennt man dies auch Naturwissenschaft und 'naturwissenschaftlicher Beweis', worin man das Äußer(liche)nde zur Grundlage der Ermessung werden läßt. Diese Art des Verhältnisses gab es auch bei den alten Griechen, hingegen war der Bezug und Ursache eine andere (was sich als allgemeingültiges Göttliches stellt) und nicht die Sache selbst, der man in der Neuerung den Urgrund zuspricht (gemäß des Atoms, welches die Eigenschaften enthält und den Raum erfüllt). Trennt man indess den Geist und das Sein, was als solches nicht möglich ist, aber doch dessen Bildnisse von den Erscheinung des Seins als solches zu trennen und uns Isodor von Sevilla mustergültig vor Augen führt, wie man darin verfährt, so erkennt man darüber die Natur der Widersprüche, die man in sowohl als auch begründet hat. So wird darüber auch ersichtlich, daß unsere Gegenwärtigkeit der Naturwissenschaften darauf beruht, daß man einerseits das Subjekt gänzlich außen vor stellt, indess das Ganze, und somit auch das Subjekt, rein über die sich davon abgrenzende Objektivität erklärt, gleichzeitig jedoch aus einem Verhältnis heraus, worin es auf dem Atom beruht, dem kleinsten unteilbaren Teilchen, worin es gar keine Unterscheidung dessen gibt. Und dies mit einer Selbstverständlichkeit, die als solche auch nicht zu widerlegen ist, denn tatsächlich basiert dies nämlich auf der (regulären!) Unfaßbarkeit der Gegebenheiten, welche hingegen auch von diesen selbst gar nicht bewiesen sind, sondern es sich um 'überspitzte' Dogmen handelt, die des unwiderlegbaren Beweises gar bedingen, weil dies unerreichbar und somit unwiderlegbar ist.

Man achte hierzu einmal auf das Musterbeispiel des Fortschrittes gegenüber den anatomischen Kenntnissen über das Geschlecht, welche nicht nur regelrecht stehen gelassen wurden, in der Vollständigkeit, zu dem man darin gelangte, sondern gar nicht mehr Ermessensgegenstand ist, sondern über die Gene und Neuronen, gar dem widersprochen wird, was sich darüber abbildet. Überhaupt zeigt sich im Verlauf, daß nicht nur im Bezug auf die Ursprünge der alten Griechen, der Philosophen überhaupt, wie speziell dem Glauben gegenüber, die prinzipelle Grundlage entstand, daß gerade dies darin spezifisch nicht Inhalt sein darf, sondern sich generell auch auf ein jeweiliges Vorheriges, unabhängig davon bezieht und somit auch auf Entwicklungen, welche in der Wissenschaft selbst etabliert waren und gar noch sind, was in der Wissenschaft jeweils als Neuerung heraus als solches dies ins Abseits stellt. In der Gesamtsicht wird dieses Prinzip unübersehbar. Und so stellen sich zwar Fragemente innerhalb der Wissenschaft als 'gemäß des wissenschaftlichen Maßstabes', indess entspricht die Wissenschaft als solche, in keiner Weise den wissenschaftlichen Prinzipien, die man darüber repräsentiert. Es verhält sich hierin nicht anders, wie man es im Glauben antrifft, worin man die Göttlichkeit preist, indess der christliche Glaube auf den Worten der heiligen Schrift beruht und kaum jemand überhaupt dies kenntlich und überhaupt auch nachvollziehbar ist, wie es sich tatsächlich damit verhält. Der gravierende Unterschied ist indess frappierend, denn während man in dem Einen in dem unveränderlichen Fixiertheit auf den Ursprung der geschriebenen Texte sich verwahrt, ist hingegen in Beidem gar nicht mehr nachvollziehbar, welche Gegenwart jeweils der eigentliche Maßstab ist, denn alles Stattgefundene gilt als substanzieller Inhalt und alles, was je an Kenntnissen aufgebracht wurde und doch gilt nur als das Gültige, was sich als Gegenwart darin repräsentiert. So bezeichnet man indess das Eine als Glaube, welche sich als Wahrheit stellt, welche dem Menschen den Weg bereitet und das Andere als Realität, wobei dies doch ein anderes ist, jedoch die Vereinigung von beidem darauf beruht, daß der Mensch in seinem Geiste, in seinem Anfange des Lebens über keinerlei von beidem verfügt und sich die Erfüllung über die Zuwendung ergibt, über die sich des Menschen Inhaltlichkeit erfüllt. Und so stellt sich letztendlich auch das Eine nicht anders als das Andere, wie die Gegenwart einem unmißverständlich vor Augen führt. Und wenn man sich dem gegenüber 'sein' Geschlechts- und Sexualleben in Betracht zieht, wird man darüber erfahren, daß auch hierin es das Eine ohne das Andere nicht gibt - kein Sexualwesen ohne dies stattfindet - des ist längst nicht mehr eine Sache der Empfindungen, sondern ein Ermessensgegenstand der Sachlichkeiten, worin auch das Sexualwesen zu nichts anders verkommen ist, als ein Mittel zum Zweck zu sein, um zu erlangen, was es zu erlangen gilt. Der Vergleich zur 'schwarzen Witwe', dem Spinnenweibchen, welches seinen Begatter frißt, insofern dieser nicht das Weite findet, nach seinem Geschäft, ist keineswegs weit entfernt von dem, was man hierin antrifft, denn ein Sexual- und Geschlechtswesen, als solches isoliert, ist in keiner Weise anzutreffen, sondern es erscheint einzig als Mittel zum Zweck, in jeglichem Verhältnis der Verbindung, daß es in sich trägt. Die Sexualität und das Geschlecht, repräsentieren in ihrer prioritären Stellung, ein eigenes Universum an Verflechtungen unseres Dasein, sodaß dies daraus auch gar nicht ersichtlich ist und somit einzig Fragmente daraus uns ersichtlich werden können, worüber sich jedoch das Gesamtverhältnis darüber darlegt. Es ist somit nicht nur eine Frage der Sichtweise, sondern vor allem auch der Sichtweite, was die präsente Gegebenheit als solche sichtbar werden läßt und in keiner Weise die Sexualität oder das Geschlecht als solches, auch wenn es dieses Universum in sich trägt.

Mir gilt es, an dieser Stelle hervorzuheben, daß es absolut leidlich ist, beständig damit konfrontiert zu sein, in all dem, was einem als Wissenschaftlichkeit entgegen tritt, überhaupt erst einmal herauszufiltern, was ein solches überhaupt repräsentiert und ist. Hierin gehe ich, gemäß der Erfordernis, 'rein sachlich' vor, indem nämlich die Maßregel der Naturwissenschaftlichkeit mir als Maßstab gilt. So gilt es mir in meiner Ausführung zunächst darzulegen, was sich als Geschlechts- und Fortpflanzungswesen in seiner spezifischen Eigenart seiner 'körperlichen Präsenz' (Körperlichkeit & Physis) und somit seiner physikalischen Gegebenheiten des 'Augenersichtlichen' darlegt, in seiner Unterscheidung zur daraufhin erfolgenden Darlegung über das eigentliche Sexualwesen der mentalen sexuellen Veranlagung, welche die 'sexuelle Orientierung' repräsentiert und damit verbunden auch das Innen(er)leben. So setze ich hierin auch die Grenzen von beiden Seiten, gemäß es sich aus dem Jeweiligen aus selbst heraus begrenzt und beiderseits sich die erforderliche Überprüfung dessen ergibt. Jedoch auf das bezogen, was man auch entsprechend überprüfend nachvollziehen kann. Gemäß dem werde ich auch nicht auf das eingehen, was 'regulär' nicht nachvollziehbar ist, wobei an sich auch geklärt ist, daß nicht nur die Gene die Veranlagung der 'sexuellen Orientierung' als solche nicht beinhalten, sondern und auch die Neuronen des Gehirns nicht. Gemäß der philosophischen Handhabe, in welcher ich im Metaphyischen nicht weiter gehe, als das ich die Füße auf dem Boden halten kann, praktiziere ich es auch generell nicht anders. Gerade wie es die Worte von Du Bois-Reymond vermitteln, gibt es eine Grenze des Erlangbaren und einzig wer diese sich wahrt, bewahrt sich davor, den reinen Spekulation und somit auch der Illusionierung zu verfallen. Gerade aufgrund der Gegebenheit, daß man sich allgemeingültig immer weiter hinfort bewegt und unentwegt das Unfaßbare zu erlangen sucht und sich dem Faßbaren darüber entzieht, bildet gerade dies den Gegenpol, um (wieder) ersichtlich werden zu lassen, was ersichtlicherweise die Gegebenheiten sind. Die Natur des Seins nachvollziehend zu verstehen, beginnt im Selbst und nicht anderswo. Und alles weitere begründet sich auf den Urgründen dessen, sodaß es auch im Urgrunde dem Verständnis über das Selbst bedingt und darin besteht meine eigentliche Bewandtnis, gerade dies aus meinen Erfahrungen heraus zu vermitteln. Mir gilt es jedoch damit verbunden auch zu vermitteln, daß der Nachweis der Gegebenheiten tatsächlich auch gegeben ist und es sich in keiner Weise derart verhält, wie man vorgibt, daß dies unmöglich sei - gerade auf die Möglichkeit hin, ist dies nämlich spezfisch auch begrenzt. Dies ergibt sich indess über die Klarheiten, gemäß dem auch das Unbewußte zur klaren Sichtung gelangt, warum dies auch wesentlicher Baustein meiner Ausführung ist. Zumal es Entwicklungen gab, in welchen derartig die Gegebenheiten ihre Handhabe fanden, wie es hierin erforderlich ist, erfahren gerade diese auch ihren Einbezug in meine Darlegungen, soweit sie mir bekannt sind. Sie gilt es zusätzlich mit in Betracht zu ziehen, um sich darüber das erweiternde Verständnis zu verschaffen, vor allem, da es mir darum geht, die Dinge auf den Punkt zu bringen und die Detaillierung doch denen überlasse, die bereits die Grundlagen dafür geschaffen haben. Es ist keineswegs neu, oder gänzlich anders, was ich aufbringe, nur wurde es in dem Zusammenhang und derart bisher noch nicht aufgebracht. Die Bildnisse dazu existieren somit auch derart nicht, jedoch beruhen die Meinigen auf den erlebenden Erfahrungen, worüber sie für jeden Anderen ebenfalls auch im Selbst erfahrend ersichtlich sind. Die Worte sind einzig ein Hinweis darauf, was das Erleben einem aufzeigt und nicht sie sind es, welche die Bildnisse zustandebringen, sondern einzig über das Erleben selbst, erfährt man auch die Bildnisse, die es zu vermitteln gilt. Gerade darauf gilt es im Besonderen zu achten. Es geht somit auch nicht darum, meine Worte zu verstehen, sondern gemäß der Natürlichkeit der Gegebenheit heraus, aus dem Ersehen heraus zu verstehen. Die Sprache der Natur des Seins basiert auf dessen Wirken und somit gilt es, dies in Betracht zu ziehen und darüber das nachvollziehende Verständnis zu vollziehen.


Themen und Dilemmata der Medizin- und Bioethik in Deutschland
Springer Verlag

Der Beginn der medizinischen Anthropologie
im 16. Jahrhundert

Die gehäufte Verwendung des Substantivsuffixes -logia zur Benennung einer wissenschaftlichen Disziplin ist eine sprachliche Innovation des abendländischen Humanismus im frühen 16. Jahrhundert. Termini wie psychologia, philologia, theologia, astrologia oder ontologia entstammen in ihrer heute geläufigen Bedeutung der Zeit nach 1500 und nicht etwa der griechischen Antike. Auch die beiden ersten Nachweise für den Begriff der Anthropologie als der Lehre vom Menschen fallen in den Beginn und das Ende des 16. Jahrhunderts. Antropologium de hominis dignitate, natura et proprietatibus, de elementis, partibus et membris humami corporis. De iuvamentis nocumentis, accidentibus, vitiis, remediis, et physionomia ipsorum [... ] De anima humana et ipsius appendiciis, so lautet der ausführliche programmatische Titel eines 1501 in Leipzig erschienenen Werkes des Philosophen, Arztes und Theologen Magnus Hundt (1449-1519). Der Mensch wurde damit zum Objekt wissenschaftlicher Untersuchung gerade in jenen Eigentümlichkeiten, die ihn aus der übrigen Schöpfung herausheben. Im Zentrum des Interesses stand zunächst die Anatomie des menschlichen Körpers, seine Zusammensetzung aus Elementen und Teilen. Heilmittel und Schadstoffe, Ausscheidungen und Absonderungen, also Physiologie und Pathologie, wurden ebenso berücksichtigt wie die menschliche Seele.

Damit konzipierte Hundt einerseits ein sehr weitgespanntes Fachgebiet, das andererseits durch die prominente Stellung der gerade im Aufblühen befindlichen medizinischen Grundlagendisziplin Anatomie darin bereits ein für spätere Werke dieses Genres konstitutives Merkmal aufwies: Rezeption und Reflexion des jeweils in expansiver Entwicklung befindlichen medizinischen Faches wurden zu Grundpfeilern der medizinischen Anthropologie einer Epoche. Dabei versuchte die sich Anthropologie nennende Disziplin stets, über jene Einzelwissenschaften hinaus Aussagen vom Menschen als einem Ganzen zu machen. Dieses Ziel wurde im Lauf der Geschichte jedoch umso schwerer erreichbar, je spezieller und detaillierter sich die jeweiligen Basisfächer (Anatomie, Physiologie, Immunologie, Hirnforschung, Psychologie, Psychoanalyse und so weiter) bereits inhaltlich ausdifferenziert hatten.

Am Ende des 16. Jahrhunderts, nämlich 1594, verfasste der Astronom, Physiker und Theologe Otho Casmann (1562-1607) eine Psychologia anthropologica sive animae humanae doctrina, die er zwei Jahre später fortsetzte als Secunda pars anthropologiae: hoc est;fabrica humani corporis. Casmann führte damit Psychologie und Anatomie als die beiden Säulen einer Anthropologie für das kommende 17. Jahrhundert ein. Der Autor betonte die zwillingsartige Doppelnatur des Menschen aus geistigem und körperlichem Prinzip: Durch das Eintauchen des göttlichen Geistes in den aus Erde geformten Körper sei der lebendige Mensch entstanden. Eine körperlose Seele oder ein seelenloser Körper verdienten nicht den Namen Mensch.

So gilt es sich jedoch, auch die bestehende Schablonen der Darstellungen über das Sein, als solche in Erfahrung zu bringen und vor allem, auf welchen Grundsätzen sie beruhen. So trifft man hierin auf eine Psychologie, welche man als eine Neuerung repräsentiert, derer sie zuvor nicht existierte. Dem ist tatsächlich so, wiederspricht jedoch gleichzeitig dem tatsächlichen Verhältnis der Gegebenheit, denn an sich war die Philosophie im Grund nichts anderes (als was man die Psychologie gemäß ihres Ausschnittes dessen erachtet, aber doch nicht repräsentiert!), mit dem gravierenden Unterschied, daß man darin vom Selbst ausging und seinem eigenen Erfahren und dieses Substanzverhältnis derart (isoliert) gar nicht existierte. Die Seele begründet darin den Menschen und der Leib die (das Leiden er-)tragende Hülle (das Empfinden wird als Leiden der Seele erachtet). Indess entstand in der deutschen Philosophie im Verlaufe des Einflusses der Ausbreitungen der Naturwissenschaften und dem Hervortreten des 'physischen Körpers', in seinem Verhältnis zum Leib, ein Verhältnis, worin sich dies in Geist, Seele und Körperlichkeit änderte, indess der Kern der Wesensart doch darin bewahrt blieb. Hingegen repräsentiert die Psychologie eine reine Geisteslehre, worüber sie sich dem gegenüber absonderte. Während somit in der Philosophie Geist und Seele zwei verschiedene Gegebenheiten sind, repräsentiert indess in der Psychologie der Geist die Seele. Dem gegenüber gibt es in der Medizin zwar eine geistige Präsenz, jedoch einzig im Verhältnis der Körperlichkeit. Und somit handelt es sich darin auch weder um die Seele und 'den Geist', gemäß dem man dies in der Philosophie und Psychologie, als solches erachtet und beschreibt, indess ist es unabdingbar darin enthalten, denn der entscheidende Punkt in all dem ist, daß es ein und dasselbe ist, was den Betrachtern als 'Mensch' gegenüber steht, denn diesen gibt es einzig in seiner Einheit. Somit ist in der Physis auch, sowohl die Seele und der Geist involviert, indess erfährt es darin einzig eine andere Betrachtung und wird dem gemäß auch anders spezifiziert. Einen menschlichen Körper ohne Seele und Geist gibt es eben auch nicht und DARIN besteht des Wesens Kern. Nachfolgend einmal ein Musterbeispiel der Darlegung, mit zusätzlichen Kommentaren versehen, daß die Medizin gar nicht dazu gelangen kann, ohne die Berücksichtung des Menschen allumfängliche Funktionalität, rein über das Körperliche das Erforderliche umzusetzen. Und dies betrifft in keiner Weise nur die sogenannte Psychosomatik, sondern generell ist bereits der Wille des Menschen etwas, was allumfassend auf den Organismus einwirkt und in seiner zentralen Stellung als bedingend zu erachtendes funktionales Organ sich stellt, wobei dieser ja nicht das Einzige ist, was darüber außen vor steht. Im Bezug auf die Affekte (welches durch das Leiden der Seele bewirkt wird) fand es einst seine begründende Erachtung.

» Henricus Regius - De Affectibus Animi (1650) «
Die Affektlehre des Arztes Henricus Regius (1598-1679)
Dissertation zur Erlangung der Doktorwürde
Dr. Hohn

Eine zenrale Rolle spielt das Urteil, welches Regius für die Entstehung falscher Affekte unter anderem verantwortlich macht. Trotzdem bleibt fraglich, welche Wertmaßstäbe der Mediziner aus Utrecht hier anlegt, welches Urteil richtig und welches falsch sei, da zwar die Stärke des Geistes, nicht aber die Urteilsfähigkeit angeboren ist. In dieser Problematik sieht Regius den Grund, warum verschiedenen Menschen über dieselben Objekte verschieden urteilen.

Nicht die geistige Vorstellung als solche (und somit [physikalisch] isoliert betrachtet) ist maßgeblich, sondern dessen Reaktiva, worauf das Handlungswesen beruht. Wie man zwischenzeitlich richtig erkannt hat, findet die Wesensart des Menschen rein über Reaktionen statt, was jedoch nicht auf dessen eigenen Funktionalität beruht, sondern auf der Funktionalität des Seins an sich und auch irrt man, woraus diese hervorgehen, dem gegenüber man nur ein Teil dessen ersieht. Das Aktio differenziert sich einzig darüber, daß ein jeweiliges Eigenwesens als solches in Erscheinung tritt und darüber es sich auch als solches kenntlich erweist, worüber auch im Selbst ersichtlich wird, was dort am wirken ist. Indess ist jegliches beruhend auf der Reaktio. Maßgeblich gemäß der Ausführung ist jedoch, daß die Erscheinungen im Geiste eine spezifische Reaktio bewirken, hingegen sich auch darlegt, daß es nicht diese sondern, sondern ein dies Beurteilendes, worüber sich das Reaktionswesen ergibt. Geistige Bildnisse und die Beurteilung dessen sind zweierlei.

Außer der Physiologie der Affekte Schmerz und Vergnügen darf vor allem die Bedeutung des Schmerzes für die geistigen Tätigkeiten nicht übersehen werden: indem wir das Unangenehme eines Gegenstandes erfahren, bilden wir ein Urteil über dieses Objekt, das uns zu einer Aversionsbewegung veranlaßt. Er ist also eines der Mittel, um die Urteilsfähigkeit zu erwerben, deren Kongenität Regius ja bestreitet.

Denken und Fühlen sind zwei grundverschiedene Funktionalwesen, dem gegenüber jedoch gar unsere Sprache dies nach wie vor nicht trennt und gar von Descartes einst über den Haufen geworfen wurde, wonach angeblich das Bewußtsein über das Denken stattfinden würde (und somit auch das Empfinden). Diese Gegebenheit wird nach wie vor, bis heute als kongruent angesehen und kann einzig in Anbetracht des Bewußtsinns überhaupt seine erforderliche Differenzierung erfahren. Maßgeblich hierin ist, daß dieses Verhältnis des Urteils nicht aus dem Geiste heraus entsteht, sondern über die Gefühlsregungen und die Erfahrungen daraus sich in der Erinnerung als solche manifestieren und darüber eine Kontinuität erwirken. Auch hierin ist es somit der Geist selbst nicht, woraus die Beurteilung heraus hervorgeht, aber doch aus diesem heraus hervortritt, worin dies 'als solches' gar nicht ersichtlich ist, was maßgeblich ist, denn er ist auch hierin nicht 'das Entscheidende'. Hingegen kann man auch 'geistig urteilen', ohne eine Beurteilung als solche vorzunehmen, was man vor allem im Verhältnis der Beurteilungsunfähigkeit antrifft. Dies ist jedoch auch die einzige Variante, worin die geistige Erscheinung 'als solche' die Entscheidung bewirkt. Man beachte diese spezielle Besonderheit.

Darüber hinaus kann eine Leidenschaft durch einen entgegengesetzten Affekt aufgehoben oder verändert werden. Neue, eventuell sogar entgegengesetzte Leidenschaften können entstehen. Entscheidend ist aber nicht die Qualität der vorherrschenden Gemütsbewegung, sondern letztendlich die Stärke eines Affektes, was Spinoza ebenfalls später in seiner "Ethik" so vortrefflich herausstellte. ... Neben der Korrektur durch die Änderung des Urteils besteht also die Möglichkeit, durch andere Leidenschaften ungewünschte zu unterdrücken.

Ein wesentlicher Aspekt unseres funktionalen Daseins, den man sich über die Magersucht, wie überhaupt über die Ernährung, mustergültig vor Augen führen kann. Insofern dies nämlich nicht, gemäß der funktionalen Erfordernis, seine qualitative Erfüllung erfährt, schlägt dies um in ein Suchtverhältnis anderweitiger Erfüllung und gar in Verbindung mit der Ablehnung dessen selbst. Erkenntlich wird dies vor allem auch über das Verhältnis der Quantität. Was die Leidenschaft betrifft, so basiert diese grundlegend auf der unerfüllten Sehnsucht (Leiden schafft Leidenschaft) und so kehrt sich diese in keinem Fall als solche um, sondern einzig das Verhältniswesen bei Überschreitung einer gewissen Quantität der Unerfülltheit. So erfährt man es auch im sexuell sinnlichen Begehren, daß sich dies umschlägt gar in Haß, einer Person gegenüber, worüber sich eine ins maßlose steigernde Begehrlichkeit, mit der gänzlichen Unerfüllbarkeit konfrontiert wird. Es ist keinesfalls die Leidenschaft als solche, die sich ändert, im Gegenteil. Insofern sie sich einmal ausgebildet hat, bleibt sie derart auch bestehen, in ihrer Wesensart der ausgebildeten Präsenz und sucht fortan in Kontinuität zu erlangen, wonach es strebt. Die Unerfülltheit und die Unterdrückung haben auch nicht die gleichen Auswirkungen, was wesentlich ist, im Erfahren und Umgang damit.

Die Uraffekte werden gesondert in einem eigenen Abschnitt vorgestellt, dann folgt eine Beschreibung des sinnlichen Vergnügens und Schmerzes, bevor die drei Paare der Hauptaffekte, welche Freude und Trauer, Liebe und Haß sowie Eifer und Mißmut darstellen, im einzelnen besprochen werden.

Elementar hierin: die prinzipielle Grundlage des Waageprinzips und somit die spezielle Erachtung des Harmonie- und Disharmoniewesens der Gefühle gegenüber den körperlichen Empfindungen, die einzig Reize hervorbringen. Reine Reize können ein solches eben nicht erwirken. Und gerade darin besteht auch das eigentlich Wesentliche der sich darbietenden Menschlichkeit, daß das damit verbundene Eigenwirken eine Präsenz aufweist, die eben nicht gemäß der rein mathematischen Quantitativ der Einseitigkeit stattfindet, sondern im Verhältnis des relativen Ermessungswesens (gemäß des Ursprunges des Zahlenwesens!), aufgrund des zugrunde liegenden Resonanzwesens. Gerade hierin ist die Physik gänzlich irrig, das elektronische Vermittlung einzig einseitig fungiert, was sich mustergültig über den Blitz und den elektronischen Stromkreis darlegt, worin in Ersterem einen Verbindung stattfindet, obwohl angeblich doch keine besteht und in Zweiterem eine Verbindung (Nulleiter) erforderlich ist, worüber angeblich doch gar nichts fließt. Diese Einseitigkeit der Wesensart von Wirkwesen existiert nicht, im Gegenteil. Und gerade das Sexualwesen führt es uns unmißverständlich vor Augen, daß es die Resonanz ist, welche im Miteinander ihre Wirkung entfaltet und sich darüber auch vermittelt, wie es sich in seiner Natürlichkeit des Seins auch ergibt.

Während die Lebensgeister bei beiden Affekten an den Tränenporen mit verschiedenen Bestimmungen den gleichen Effekt erzielen, Schmerzenstränen seien demnach nicht von Freudentränen zu trennen, ...

Genau das ist auch der bestehende Effekt, den man antrifft, daß man aufgrund verfälschender Annahmen gar Eindeutigkeiten nicht voneinander zu scheiden weiß. Tatsächlich ist nämlich der Tränenfluß doch derselbe, darin unterscheidet es sich nicht, sondern es ist das Erwirkende, worin es sich unterscheidet. Es ist das uralte Leidwesen der Erfordernisse der Unterscheidung von Ursache und Wirkung, dem gegenüber man weitläufig doch einzig (noch) die Symptome ersieht (hingegen ursprünglich weitläufig der Spekulation unterlag). Und warum? Weil man die Innerlichkeit als solche nicht ersieht und die Er(Kenntnisse) darüber nicht kennt.

Wegen der Affektion der geistigen Tätigkeiten durch die beiden Uraffekte entstehen die sechs Hauptaffekte. Sie zeigen in der Abhängigkeit ihrer Ursachen unterschiedliche Affektionsstärken. Von herausragender Stärke erweisen sich die Affekte, die durch die Sinneswahrnehmung (perceptio) entstehen. Gemäß den unterschiedlichen Formen der Wahrnehmung (sinnliche Wahrnehmung, Vorstellung, Erinnerung) entstehen hier wieder verschiedene Leidenschaften, auf die Regius allerdings nicht weiter eingeht, sondern sich in der Erläuterung auf die Erregung der geistigen Tätigkeiten beschränkt, die durch die Sinne, d.h. durch Erregungen an den Sinnesrezeptoren, entstehen. Sie allein werden allgemein mit dem Namen "Schmerz" bezeichnet.

Hierin liegt auch das 'fundierte' Unverständnis und nicht zu erlangende Verständnis aus dem medizinischen Verhältnissen heraus. So bezieht sich nämlich die gesamte Abhandlung auf die 'Affektion der geistigen Tätigkeiten' - was bedeutet das? Im Gegensatz zum Reflex, welcher unbedacht und somit ohne eine geistige Reflektion stattfindet, bezeichnet der Affekt den Vorgang, worin reflektiv eine geistige Entscheidung fällt, woraufhin eine bewußte Handlung stattfindet. Der Unterschied liegt somit primär darin, daß Ersteres, wenn überhaupt, dann erst anschließend bewußt wahrgenommen wird und auch völlig unbewußt stattfindet (reguläres Handlungswesen!), wohingegen bei Letzterem über die bewußte Wahrnehmung dies zunächst in die Erinnerung gelangt und hiernach (Beschreibung siehe » John Locke «) über die geistige Erscheinung zur bewußten Beurteilung und daraus erfolgenden bewußten Handlung führt. Man beachte die Markantz der Unterscheidung. In seinem Detailwesen wird es nämlich einzig ersichtlich, gemäß dem man die Details voneinander sondiert. Und dies ist einzig möglich, indem man die jeweilige Funktionalität des jeweiligen Beteiligten spezifiziert, was jedoch gemäß meiner Darlegung gar nicht existiert. Selbst Lockes Detailwesen - wo findet man dies in Anwendung, wohingegen man doch einzig den Geist ersieht? Maßgeblich an dieser Stelle ist zunächst jedoch das Instinktwesen, welches man über das reflektive und zumeist unbewußte Handlungswesen erfährt und gerade darüber auch das Gefühlsleben hervortritt, über dessen Reflektion der Gegebenheiten. Darüber erfährt man sein Selbst - seine mentalen Veranlagungen - und das damit verbundene Daseinswesen, dem gegenüber der Geist die dem gegenüber stehende geistige Identität repräsentiert.

Im Gegensatz zu Descartes kennt er die "Admiration", die Verwunderung, als Zustand des Fehlens jeglicher Affekte, als Grundaffekt nicht, da der Schritt von der Wahrnehmung zur Erwägung bereits mit einer aktiven Tätigkeit der Lebensgeister einhergeht und Regius zwischen beiden kein Verharren in einem Zwischenzustand annimmt. Der Mediziner ordnet die Verwunderung, in der Übersetzung als Bewunderung zu verstehen, als paarigen Nebenaffekt in die Reihe der zahlreichen urteilsbestimmten Leidenschaften ein. Die Unbeweglichkeit des Körpers bzw. seiner Teile erklärt er paradoxerweise mit einer starken Bestimmung der Geister in diese Körperteile, ohne näher darauf einzugehen. Offenbar war er sich zu diesem Zeitpunkt selbst noch nicht über den Mechanismus dieser Bewegungsstarre im Klaren.

Auch hierin wiederum ein wesentlicher Bestandteil, den man sich jedoch gerade medizinisch rein mechanistisch erklärt, hingegen gerade darauf das I'tüpfelchen beruht, dem Ganzen seine Klarheit zu verschaffen, daß der Mensch kein technisch-mechanisches Instrumentarium ist. Dieser handelt nämlich in keiner Weise derart, selbst reflexiv und affektiv, sondern generell basierend auf seiner individuellen Ausgeprägtheit seiner Persönlichkeit heraus, was diesen auch dem entsprechend als Individuum identifiziert. Indess ist es jedoch speziell das Bewußtsein - das Selbstbewußtsein - was diesem seine spezifische Persönlichkeitsidentität verschafft. Und dies geschieht im Verhältnis dessen, gemäß dem man ihn homo sapiens - einen Verstandesmenschen - nennt, woraus dies hervorgeht. Jedoch gibt es auch den Unverstand, sodaß einzig über dessen Unterscheidung sich herausstellt, wie es sich tatsächlich damit verhält. Alles Dinge somit auch, die in der Medizin selbst gar nicht Bestandteil sind, jedoch das Wesentliche des Menschen Dasein - und somit auch seiner Beurteilung - ausmacht!

Divider


Verlag: Michel Bobin
» «


Ueber die Leidenschaften der Seele
Verlag: L. Heimann
Uebersetzung von


Verlag: Bald & Krüger

Die Leidenschaften der Seele (fr/de - )
Les passions de l'âme
Felix Meiner Verlag

Descartes' letzte Schrift aus dem Jahre 1649 entwickelt eine Affektenlehre, d. h. eine Lehre von der Mäßigung und vernunftgemäßen Leitung der Emotionen. Die aus der Lehre von den zwei Substanzen, Seele und Körper, sich ergebende unterschiedliche Betrachtung der körperlichen und geistigen Vorgänge, die im menschlichen Verhalten zusammenwirken, hat nicht nur für die med. Wissenschaft die Grundlage gegeben, sondern auch für eine Ethik, die die Vernunft selbst als affektive Kraft anerkannte.

Divider


nach dem neuesten Standpunkte
der Wissenschaft und der Gesetzgebung

Verlag: J.H. Heuser

All die diversen Ergründungen über des Menschen Daseinsverhältnis enden letztendlich im Verbund mit der sich umgreifenden französischen Revolution, die den Menschen als solchen ins Zentrum der Belange stellt und gleichzeitig wiederum gänzlich außen vor, wie man nachfolgenden Entwicklungen unzweideutig entnehmen kann. Nicht die Fragen sind fortan von Interesse und nicht das Unverständnis, was es zu klären gilt, sondern die militärische Marschrichtung dessen, was sich als erfolgversprechend stellt und bewegt, fordert und erlangt. Die Frage nach dem Sinn des Lebens wird als Utopie im Schrank des Vergessens abgelegt und gar verb(r)annt, wie all das, was man in all der Zeit ergründete, daß nur noch der Historie dient, gemäß dem in den Universitäten sich die Philosophie im Verlaufe auch zu einem Geschichtsunterricht darüber entwickelt, jedoch mit Philosophie in keiner Weise überhaupt noch etwas im Schilde führt. Es ist nicht praktisch verwertbar, wie Bodenschätze es sind und was nicht einen solchen ermessenswerten Profit darlegen kann, ist zu nichts zu gebrauchen. Das reproduzierbare Wissen, die verwertbaren Kenntnisse, sind das neue Korn der Ausaat, dem gegenüber man die Felder mit Maschinen bestückt, um größtmögliche Ernteeinträge einzufahren. Nicht mehr die Ernährung bildet die Grundlage, sondern der Profit. In dieser Zeit entsteht auch das Ergründungswesen der Sexualität und man mag sich vor Augen führen, wie es sich damit stellt. Hintergrund dessen ist nämlich tatsächlich die neu entstandene Gynokologie, aufgrund dessen nicht mehr die Hebammen, sondern die Gynokologen das Gebähren und gar in den neu entstehenden Krankenhäusern begleiten und darüber sich auch die reine Männlichkeit der Beschäftigung mit dem Sexualwesen begründet. Das eigentliche Fuß-fassen findet jedoch über die Konkurrenz der Psychiater statt, über dessen Verbundsbildung mit dem Sodomie-Gesetz, worüber sie sich den Grundstein ihrer Präsenz verschaffen. Zwar sind es in den Anfängen gar die Homosexuellen selbst, welche die Grundlagen, wie ja auch den Begriff der Homosexualität schaffen, indess sind sie nur Mittel zum Zweck, denn es gilt hierin, die Grundlagen zu schaffen, für die neue wissenschaftliche Ära. Letztendlich stellt sich dies, wie selbst der neuerliche Versuch von Sigusch in den 1970er Jahren, ebenfalls einzig als eine Konkurrenz, deren die Medizin bereits vorausgehend die Jahrhunderte zuvor demonstrierte, daß sie keinerlei Bündnis suchen und auch keine wollen, denn in ihren Händen liegt von je her die Eigenständigkeit der Eigenmächtigkeit ihres Gestaltungswesens. Man betrachte zur Verdeutlichung der damaligen Verhältnisse somit auch die Gegenwart von Medizin, Psychiatrie und Psychologie. Es hat sich darin nichts geändert, außer die manifestierte Choreographie, die von oben herab von der Medizin geleitet, unter ihr die Psychiatrie ihr medikamentös fundierter Handlanger ist und die Psychologie einsam un verlassen, abseits davon vor sich hin vegetiert.


Themen und Dilemmata der Medizin- und Bioethik in Deutschland
Springer Verlag

Die wissenschaftliche Krise der aus der Antike überlieferten Vier-Säfte-Lehre begann im Zeitalter des Barock. Das 17. Jahrhundert war eine Periode des Umbruchs in der Medizin und den Naturwissenschaften. Die Heilkunde fing an, sich aus dem dogmatisch erstarrenden, traditionellen System wie aus einem nicht mehr passenden Korsett zu befreien. Dabei forderte die neue, mechanistische Denkweise von Ärzten, die den menschlichen Körper als eine physikalisch-chemische Maschine betrachteten, mehr und mehr Beachtung. Die von dem französischen Philosophen René Descartes (1596-1650) zur Zeit des Dreißigjährigen Krieges formulierte Trennung des Leibes in Res extensa und Res cogitans wirkte auch auf die Medizin ein, die ihr Interesse jetzt auf die Erforschung des nach physikalischen Gesetzen arbeitenden Körpers konzentrierte. Ein wichtiger Zwischenschritt auf diesem Weg war 1628 die Beschreibung des Blutkreislaufs durch den englischen Arzt William Harvey (1578-1657). Bereits um 1612 hatte der italienische Mediziner Santorio Santorio (1561-1636) in Padua erstmals Fieber mit einem Thermometer gemessen, und in den 1660er Jahren stellte der in Hanau geborene, später aber im niederländischen Leiden wirkende Arzt Francisus Sylvius (1614-1672) eine chemische Theorie der Verdauung auf.

Das praktische Versagen der neuen physikalisch-chemischen Medizintheorie in der ärztlichen Therapie ließ sich jedoch nicht auf Dauer ignorieren. Gegen Ende des 17. Jahrhunderts entstand in Deutschland gleichzeitig eine von Pietisten initiierte Strömung gegen alles, was wie wissenschaftliche Autorität anmutete. Diese Bewegung, die an der 1695 gegründeten Universität Halle ihr Zentrum fand, richtete ihre Angriffe zugleich gegen die herrschende Theologie und Medizin, wobei der aus Ansbach stammende Professor Georg Ernst Stahl (1659-1734) der führende Aktivist im Bereich der Heilkunde war. Sein Reformversuch der Medizin leitete sich von einem auf subjektive Erfahrung gegründeten Wahrheitsanspruch ab; diese Erfahrung war für Stahl die entscheidende Methode, um wahre Erkenntnisse zu ermitteln.

Es existieren historisch betrachtet nur sehr wenige konsequent durchdachte Systeme, in denen die menschliche Seele zur maßgeblichen Ursache von Gesundheit und Krankheit erhoben wurde. Georg Ernst Stahl unterzog sich diesem Wagnis vornehmlich in seinem 1708 in Halle publizierten Hauptwerk Theorie medien vera. Der Körper ist nach Stahls Auffassung kein bloßer Mechanismus, die Materie in ihrer Lebendigkeit vielmehr ein organisches Ganzes. Geist und Materie lebten in ihrer Vereinigung, und dies bedeute Wahrnehmung, Gefühl und Erkenntnis in der körperlichen und seelischen Einheit des Subjekts: "Alle vitalen, animalen und rationalen Vorgänge haben ihren Grund in der schönsten Harmonie und in ihrem unlöslichen Zusammenhang mit einer Kraft. Mit Recht schließt man, dass es die Seele ist, die alle diese Bewegungen unmittelbar bewirkt, seien sie geordnet oder ungeordnet, vitaler oder animaler Art, ob sie zur Erhaltung des Körpers beitragen oder zu seiner Zerstörung.

Um das Jahr 1850 kam es zu einem erneuten und diesmal nachhaltigen Umbruch in der medizinischen Wissenschaft: Spekulationen über die Existenz der Lebenskraft waren jetzt nicht mehr gefragt. Neue Leitwissenschaften der Medizin wurden Physiologie und Pathologische Anatomie, zwei Fächer, deren Protagonisten sich dem physikalischen Denken verpflichtet sahen. So schrieb 1848 der junge Berliner Physiologe Emil Du Bois-Reymond (1818-1896):

"[Es] erscheint die Lehre von der Lebenskraft [...] als ein solches Gewebe der willkürlichsten Behauptungen, sie häuft auf ein Phantasiegebilde solche Summe unmöglicher Attribute und undenkbarer Tätigkeiten, dass es schwer hält, sie ernst zu nehmen, und in ihrer offenkundigen Abgeschmacktheit nicht einfach mit dem verdienten Spotte zu begegnen. [...] Vor unserem Denken, das vor keiner Folgerung zurückscheut, löst sich das Weltganze daher auf in bewegte Materie, deren Wesen zu begreifen wir nicht für möglich halten. Nicht die Ursachen der Bewegungen, ihre Gesetze zu erkennen, erscheint uns als wahre Aufgabe unseres Strebens. Nun kann das Wort Kraft für uns keine andere Bedeutung haben, als die, in welcher es der analytischen Mechanik gute Dienste geleistet hat. Die Kraft ist uns das Maß, nicht die Ursache der Bewegung. Mathematisch ausgedrückt, sie ist die zweite Ableitung des Weges des in veränderlicher Bewegung begriffenen Körperlichen nach der Zeit.

Die Krise der naturwissenschaftlichen Medizin wurde um die Wende vom 19. zum 20. Jahrhundert mehr und mehr empfunden und kam in wissenschaftlichen Abhandlungen zum Ausdruck. So diskutierte man damals die Frage nach der korrekten Gewichtung von Kausalität und Konditionalität, also von Ursachen und Bedingungen. Überwiegend blieben diese Debatten jedoch innerhalb des von der mechanistischen Theorie vorgegebenen Rahmens. So kam noch 1898 der damalige Leiter der Medizinischen Poliklinik in Jena, der Internist Ludolf Krehl (1861-1937), zu dem Schluss, die Beurteilung des Krankheitszustandes habe sich an den Methoden und Grundsätzen der Biologie zu orientieren, "und diese sind ja [. . .] keine anderen als die der exacten Naturwissenschaft; auf deren Boden müssen wir fest stehen." Doch bereits 1906 gab Krehl, mittlerweile Direktor der Medizinischen Klinik in Straßburg, zu bedenken: "Die pathologischen Symptome äussern sich am kranken Menschen als Individuum und durch die Art seiner Persönlichkeit außerordentlich verschieden.

Indess ist zwischenzeitlich auch wieder Veränderung eingetreten, worin die Neurologie die Psychiatrie ersetzen soll. Wie zeitlebens ihrer Geschichte, seit der Renaissance, unterliegt die Medizin dem beständigen Wandel, in welchem morgen nichts mehr ist, wie gestern, sodaß es sich als Episoden der Gegebenheit stellt. Gerade hierüber zeigt sich indess, daß die Medizin gar nicht Herr ihrer Lage ist, sondern ebenfalls einzig Handlanger und im Verlauf der Geschichte sie einzig hin- und her wandert, um der erforderlichen Gefolgschaft zu entsprechen. Und so sind es tatsächlich die Mathematik und die Physikalitäten, welche das Geleitwesen seit jener Zeit begründen und gerade die sind's die sich ändern. Und so bedarf es zur Sichtung des geschichtlichen Verlaufes vor allem Dessen der Sichtung. Und so läßt es sich gar errechnen, was sich daraus ergibt. Grundlage der Erneuerung im 19. Jh. sind, gemäß des Reduktionismus einzig noch die beiden körperlichen Geschlechter, die man entsprechend mathematisch voneinander trennt und zwangsläufigerweise der Geist und gemäß dem des Gehirns, was die Leitfähigkeit (angeblich) bewirkt. Welche Varianten ergeben sich daraus?

Der Verlauf bringt es dem entsprechend hervor, doch tatsächlich ist dies eine einfache Rechnung, die man in aller Kürze erfassen kann, was sich dabei ergibt: ein männliches Geschlecht und ein weibliches Geschlecht und als Irritation deren beiden Varianten, ein Dazwischenstehendes, welches man weg-operiert, bildet die Grundlage des Ganzen. Über die geistigen Varianten indess wird es dann schon umfangreicher, aber auch hierin läßt sich wiederum eine Variante durch OP umwandeln, worüber es der Passform entspricht. Die Variante Transgender indess, hauen sich regelrecht selbst in die Pfanne, indem sie sich überhaupt derart benennen, vor allem verdeutlicht sich jedoch darüber, daß doch einzig der Transfer sich als Passform ergibt. Und was die sexuelle Orientierung betrifft - die geschlechtliche Vereinigung - so wird's indess noch viel einfacher, aufgrund der Grundlage, die man über das Geschlecht selbst geschaffen hat, denn es gibt aufgrund dessen einzig noch Zweie und somit ist die Rechnung dann noch viel einfacher. Gemäß dem gibt es darin auch einzig die Heterosexualität und Homosexualität und ein Dazwischenstehendes, dem gegenüber sich jedoch ein wahrliches Mißverhältnis ergibt, denn da ist nichts auffindbar, worüber man dies wegoperieren könnte. Und so bleibt die mathematische Rechnung jedoch letztendlich doch ungelöst.

Vor allem gibt es da einen klitzekleinen Haken an der Geschicht', denn aus der Sicht der bisexuellen Dritten betrachtet, stimmt die gesamte Rechnung von hinten bis vorne nicht, in seinem reinen Bezug auf das Geschlecht, denn gerade bei dem bisuellen zu-Dritt tritt eine Gegebenheit auf, die dies eindeutig widerlegt, daß es sich 'einzig' über das Geschlecht bestimmt. Hingegen klärt sich über diese vor allem auch, wie es sich in all dem tatsächlich und auch 'mathematisch' verhält. Und so zeigt sich bereits im Einheitswesen deren zu-Dritt, wie es sich darin verhält (FMF/MFM), daß nämlich das Geschlecht in der Beziehung nur ein anteilig Bestimmtes ist, worüber hinaus sich über die Unpässlichkeit gegenüber den Heterosexuellen und Homosexuellen, die nämlich 'mathematisch' monogam sind, zusätzlich noch einmal in aller Deutlichkeit zeigt, daß die Veranlagung das Maßgebliche ist, worüber es sich darin bestimmt, was mit wem eine Verbindung ergibt und worüber es sich voneinander trennt. Somit ergibt sich darin auch nur sekundär der Geschlechtsbezug, basierend jedoch auf dem primären Verhältnis der Veranlagung, worin dies enthalten ist(!), sodaß auch Heterosexuelle einzig mit Hetersosexuellen (und NICHT mit irgend einem entgegengesetzten Geschlecht!) und Homosexuelle einzig mit Homosexuellen (und NICHT mit irgend einem gleichen Geschlechts!) verkehren. Sieht ganz anders aus, dieses Verhältnis, indess klärt sich darüber auch, warum in der angewandten Rechnung alles Queer geworden ist, da wenn einzig das Geschlecht als Ermessungswesen erachtet wird - und somit, was gar nicht des Menschen veranlagt wirkende Ermessung ist - sich über diesen reinen Geschlechtsbezug, eine völlige Willkür ergibt, wie es sich miteinander vereinigt und das veranlagte Bestimmende gänzlich außen vor gerät. Und als Hintergrund dieses erwirkten Widerspruchs ergibt sich, daß man den Instinkt des Menschen außen vor stellt, da dieser angeblich 'rein geistig' handelt, wohingegen sich gerade über die Gegebenheit des Sexualwesens unübersehbar wird, was geschieht, wenn dieser dies tatsächlich tut. Man nennt es: geistige Verirrung!

Der Geist ist am Anfang des Lebens leer (gemäß seiner Erfüllung durch die Erinnerung) und diesem bedingt es somit auch einer Ausbildung und Identitätsbildung (der geistig willensfundierten Identität). Und diese Ausbildung gestaltet sich primär über das Erfahren des eigenen Selbst, worüber sich dieses 'innere Selbst' vermittelt und um als Ganzes zu funktionieren, der Vereinheitlichung dessen bedingt. Die Einheit begründet hierin des Wesens Kern, dem gegenüber jedoch der Geist auch als Diplomat zwischen der Innen- und Außenwelt fungiert. Auch die äußeren Wirkungen sind somit ein wesentlicher Grundstock zur Wesensausbildung dessen Selbst, sodaß sich darüber das entsprechende Kombinieren ergibt. So zeigt sich hierüber auch diese Gegebenheit darüber, inwiefern ein Mensch in sich verschlossener oder auch ein egoistischer ist, gegenüber einer, wie man es nennt, Offenherzigkeit. Bestimmend für die Umsetzung des Selbst ist somit auch vor allem, inwiefern es als solches in Erscheinung tritt und somit aus seinem inneren Selbst heraus hervortritt. Und dem gegenüber gibt es darin den Sachstand der Ausgeprägtheit, worüber es sich aus dem Inneren heraus bestimmt, mit welcher Intension, Intensität und Ausmaß dies überhaupt in Erscheinung tritt. All dem steht das Außenleben gegenüber und wirkt auf das eigene Sein ein. Und somit ergeben sich auch die zwei Welten unseres Daseins, die ebenfalls miteinander im Einklang stehen müssen und sich über diesen Verbund die Umzusetzung ergibt. Und darin besteht auch das eigentliche Tauziehen, was man in all dem antrifft. Es ist nicht einfach nur, sondern es repräsentiert das Leben, das uns zu dem macht und wir werden, wie wir sind. Und somit besteht auch der Lebensgestaltung - der eigentliche Lebenssinn darin, nicht nur zu leben, sondern es gemäß seiner Bedürfnisse, die einem darin leiten, auszugestalten, mit all dem, was uns über das Selbst zur Verfügung steht.

Ich denke, über diesen Abschnitt dürfte es sich vermittelt haben, wie es sich mit dem 'neuen Geschlecht' stellt. Das Wort als solches zu verwenden, macht einzig Sinn, wenn man es metaphorisch sieht, denn das Geschlecht als solches, gibt es nicht. Es gibt nämlich gar keine Isolation dessen, ist selbst gedanklich unmöglich und nicht gegeben, sodaß es als solches auch gar nicht faßbar ist. Das Geschlecht ist nicht das, was den Menschen ausmacht, sondern es ist der Mensch, welcher das Geschlecht ausmacht, welches ein unlösbarer unabtrennbarer funktionaler Teil von ihm ist und gar undenkbar ist, daß es nicht ist, ohne das nämlich vom Menschen nichts mehr übrig bleibt von dem, was diesen ausmacht. Es ist die Natur des Seins, die sich hierüber darlegt und auch wie sie funktioniert. Genau DAS gilt es mir zu vermitteln, denn es steckt in uns selbst und somit ist auch darüber die Natur des Seins zu erfahren, wobei wir einzig in uns selbst auch das Innenleben erfahren und darüber die Gegebenheiten, die im Äußeren gar nicht erfahrbar sind. Betrachtet man sich hierzu das Wesen der 'sexuellen Orientierung', so zeigt sich hierin des Wesens Kern der Natur der Einheitsbildungen von Gemeinsamkeiten (Homosexualität) und Ergänzungen (Heterosexualität), die sich gegenüber Widersprüchen (nicht dem Jeweiligen entsprechend) dessen abgrenzen, gemäß dem wir es als solche Vereinigungen erfahren. So gibt es darin aber auch das Kombinat dieser beiden Varianten und somit die Vereinigung von Gemeinsamkeit und Ergänzung (Bisexualität - FMF/MFM), gemäß dem sich auch daraus wiederum erklärt, wie es sich darin verhält. Es ist keineswegs aus der Hetero- und Homosexualität heraus begründet - ein 'daraus' Entstandenes, sondern basiert auf der Urgrundlage der Vereinigung von Gemeinsamkeit und Ergänzung, dem Synonym, welches wir derart bezeichnen und sich naturgemäß derart zusammensetzt. Indess ist bei all dem auch die sich ausbildende und umsetzende Ausgeprägtheit ein Wesenskern, worüber sich darüber hinaus entsprechende individuelle Varianzen und somit auch die Individualität der Umsetzung ergibt. Es gibt somit auch hierin kein schwarzweiss, sondern vielfältige Nuancen der Mannigfaltigkeit.

Im Grunde folgt der Mensch jedoch auch dem Gemeinsinn. Und gerade dem gegenüber gilt es mir einmal die Pilze zu erwähnen. Was sieht der Mensch? Doch regulär einzig die Frucht, die aus dem Boden heraus wächst und nicht den Pilz selbst. Nicht mehr, ist die tatsächliche Gegebenheit, denn der Pilzkenner und somit auch der Mensch von einst, welcher sich vom Pilze sammeln regulär ernährte, ist sich darüber im Klaren, wie es sich darin verhält und findet somit auch einen Pilz wieder, an der Stelle, wo dieser aus dem Boden heraus wächst. Es ist somit der Fruchtkörper, worüber man als solches darin fündig wird, jedoch bedarf es dessen des Weiteren nicht, um ihn wieder zu finden. Hingegen wächst auch der Pilz einzig in seinem erforderlichen Nährboden und somit nur an ganz bestimmten Stellen, sodaß man auch darüber wiederum, ohne ihn selbst gesehen zu haben, fündig wird. Was es mir darüber zu vermitteln gilt ist, daß die Kultur sich nicht durch den Menschen bestimmt, sondern durch den Nährboden, wie überhaupt die Bodenverhältnisse es sind, auf dem dieser lebt. Darauf basiert auch die Vielfalt der Kulturen, wie man sie auf der Erdkugel antrifft. Gerade diesen Bezug, hat der Mensch der Neuzeit verloren, indem dieser die Ressourcen entnimmt und sie örtlich verlagert. Darüber ändert sich jedoch die Örtlichkeit nicht und somit auch nicht die Kultur, sondern es handelt sich in dem Fall um eine aufgesetzte Kultur. Genau so, wie wir es auch im Bezug auf unser Geschlechts- und Sexualleben - dem Selbst - erfahren, worin es sich nicht anders verhält. Wo auch immer man dies hin örtlich versetzt, es verändert sich nicht, sodern einzig der Nährboden, dem gegenüber gerade dieser es ist, worüber sein wachsen und gedeihen ausgebildet wird. Der Gemeinsinn und somit auch das Gemeinwesen, dies hat man längst erkannt, bilden die Grundlage des Erlebens und Auslebens des eigenen Selbst und aus dem Grund ist gerade darauf auch sein Augenmerk zu richten, wie es sich damit verhält. Man bedenke bezüglich des Selbst den Vergleich mit den Pilzen, denn anders stellt es darin nicht. Man kann es ersehen, wie es sich damit verhält, dazu bedingt es jedoch der erfahrenden Kenntnis und die Ausrichtung des Augenmerkes darauf. Es ist sehr wohl im Äußeren ersichtlich, wie es sich im Innern verhält, denn es kommt aus dem Innern, was nach außen dringt. Es gelangt einzig nur nicht selbst hervor, doch ist es darüber erkenntlich. Und was die 'sexuelle Orientierung' betrifft, so steckt in ihr, wie in jeder Gabe drin, worüber es sich erfüllt. Dies bedingt somit auch 'als solches' nicht der Suche. Die eigentliche Suche ist auch nicht die nach dem Pilz, denn der vermittelt sich über die Sinne, wenn wir diesem gegenüber stehen. Hingegen ist es das vorherrschende Gemeinwesen, welches dies durcheinander bringt, sodaß es hierin (selbst den Heterosexuellen!) bedingt, sich auf die erscheinende Frucht des Pilzes zu beziehen, denn wie sich zeigt, lebt der Mensch in seinem Grundsatz weitläufig nicht sein Selbst, sondern im primären Selbst seines Gemeinwesens, sodaß es darüber diese Art der Erfüllung nicht finden kann. Gerade hierin reguliert es sich jedoch wiederum über die Widersprüche, in welchem diese beiden Arten des Daseinswesens nicht miteinander vereinbar und somit gemäß dieser Trennung zu erachten sind, denn nicht die Sexualität begründet des Menschen Miteinander, sondern seine Persönlichkeit, die sich indess nicht einzig aus dem Sexualwesen heraus fundiert.

» Die neue Generation (1913) «
Deutscher Bund für Mutterschutz
von Dr. Heinrich Koerber

Die Bisexualität als Grundlage der Sexualforschung

Der Begriff Bisexualität (Doppelgeschlechtlichkeit) ist dem Laien unbegreiflich, selbst abstoßend. Den meisten erscheint die volle Ausprägung des von ihnen repräsentierten Geschlechts als eine Ehre und Heldensache. Ein Mann glaubt sein Manntum nicht genug betonen zu können, und umgekehrt ist die Frau stolz auf Besitz und Pflege des Weiblichen in ihr.

Es waren klinische und biologisch Beobachtungen der noch so jungen Wissenschaft der Sexuologie, die den Gedanken einer stets bestehenden Bisexualität auftauchen ließen und diese sogar zur Forderung machten. Es war vor allem Weininger, der, fußend auf Swoboda, Fließ u.a., diesen Begriff seinen prinzipiellen sexuologischen Untersuchungen in seinem Werk 'Geschlecht und Charakter' zugrunde legte; auch Magnus Hirschfeld und andere arbeiteten schon frühzeitig mit dieser Hypothese, und heute ist die Bisexualität für alle ernstzunehmenden Sexuologen eine Grundtatsache.

Zunächst zeigt schon die Embryologie, daß die erste Keimanlage des intrauterinen Menschen bisexuell ist; in den ersten Wochen ist eine bestimmte Geschlechtsangehörigkeit nicht feststellbar, weil eben die morphologischen Grundelemente beider Geschlechter angetroffen werden, d. s. die Wolffschen Gänge und der Müllersche Faden. Erst später entwickelt sich die eine sexuelle Keimanlage unter mehr oder weniger völligem Hinschwinden der anderen zur typisch männlichen oder weiblichen Körpergeschlechtlichkeit. Ein Mißlingen dieses Werdeganges bringt, wie bekannt, das Peudozwittertum zustande. Diese Morphologie der Bisexualität ist eigentlich nicht verwunderlich, da der neue Mensch eine Produktion, eine Addition von Samenfaden und Eikern ist.

Divider


Ein Beitrag zur Sittengeschichte unserer Zeit
M. Lilienthal Verlag
» «

Da man zunächst als feststehend (und wohl auch von keiner Seite bestritten) annehmen darf, dass die Zahl der Bisexuellen, also solcher, deren Trieb auf beide Geschlechter gestimmt ist, eine ungeheuer grosse ist, so erhellt daraus von selbst, dass die Art der Bisexualität in zahllosen Variationen schwankt. Es gibt Bisexuelle, deren Geschlechtstrieb in gleicher Stärke beiden Geschlechtern zuneigt, solche, in denen die Neigung zum eignen Geschlecht stärker hervortritt als zum andern, und solche, die mehr hetero- wie homosexuell empfinden.

Sehr viel hat die Annahme für sich, dass für die bisexuelle Veranlagung die Neigung zu einem bestimmten Typus massgebend ist, bei der das Geschlechtsorgan keine, oder nur eine nebensächliche Rolle spielt. Doch sollte mau das nicht verallgemeinern.

Völlig abzulehnen scheint mir die Auffassung Edwin Babs, der in einer Broschüre "Die geschlechtliche Liebe (Lieblingminne)" (Hugo Schildberger, Berlin 1903) die kühne Behauptung aufstellt, jeder Mensch sei von vornherein bisexuell. Er vergewaltigt die ohen angedeutete "Typen-Theorie" zu diesen Auslassungen: "Dass die angeborne Anlage die Hauptsache (!) ist, kann allerdings nicht geleugnet werden. Nur ist zu bedenken, dass niemand "die Männer" oder "die Weiber" ganz allgemein liebt, sondern nur bestimmte Typen von Männern und Weibern. Dabei scheint mir, reagieren wir auf diesen Typus ursprünglioh ziemlich unbekümmert darum, welchem Geschlechte er angehört. Und erst Einflüsse des Lebens bewirken suggestiv, dass später die meisten Menschen (namentlich die "Masse") nur für die Reize des einen Geschlechts empfänglicher zu sein glaubt. Aus diesen Worten redet nichts als das Bedürfnis aller primitiven Naturen, komplizierte Dinge zu vereinfachen, was am bequemsten mit dem grossen Diagonalestrich geschieht.

Wäre es wahr, dasa erst "Einflüsse während des Lebens" den Geschlechtstrieb regulieren, dann müsste es doch etwas unglaublich leichtes sein,, homosexuelle Gelüste im Keime zu ersticken, eben durch die Autosuggestion, der Bab einen so grossen Anteil hierbei zumisst. Natürlich ist zugegeben, dass in einzelnen - gleichviel ob häufigen oder seltenen Fällen, die Liebe zu einem bestimmten Typ so stark ist, dass die Geschlechtszugehörigkeit des Geliebten für den Liebenden zunächst garnicht in Frage kommt. Gehört aber der geliebte Teil dem gleichen Geschlecht an, und ist die Liebe zu ihm im besonderen Falle so stark, dass ein Ankämpfen dagegen unmöglich ist, so ist eben die Liebe eine homosexuelle, die nicht von den "Einflüssen während des Lebens", sondern von den Schwingungen herrührt, die von einem Individuum zum andern fluten.

Hirschfeld leugnet einmal die Bisexaalität vollkommen und stützt sich dabei darauf, dass ihm, der über 1600 Homosexuelle untersucht habe, unter diesen nicht ein einziger begegnet sei, der gleicherweise sum Weibe wie zum Manne neigt. Das scheint mir sehr erklärlich. Ein Bisexueller in dem die Triebe zu beiden Geschlechtern gleich stark wirksam sind, wird, veranlasst durch das öffentliche Urteil, das die gleichgeschlechtliche Liebe verdammt, die Liebe zum anderen Geschlecht so sehr pflegen, dass es ihm garnicht weiter darum zu tun sein wird, seine andersgearteten Empfindungen durch Beichte und Untersuchung von Dr. Hirschfeld abstempeln zu lassen. Er wird sich in vielen Fällen überhaupt keine Gedanken machen, wenn ein schöner Knabe geschlechtliche Erregungen in ihm auslöst, sondern diese Erregungen einfach bei einer Frau entladen. Das wird ihm um so leichter gelingen, je mehr die heterosexuellen Triebe die homosexuellen an Intensität übertreffen.

Divider

» Prä-homosexuelle Kindheiten (2000) «
Eine empirische Untersuchung über Geschlechtsrollenkonformität
und -nonkonformität bei homosexuellen Männern
in Kindheit, Jugend und Erwachsenenalter
Dissertation von Thomas Grossmann

Wie schwer es offenbar dennoch ist, ein gemeinsames Verständnis über die Begrifflichkeit zu finden ist, läßt sich recht gut am Beispiel von 'Homosexualität' belegen. In der Biologie wird unter Homosexualität bei Tieren ein sexuelles Verhalten verstanden, welches typisch für das jeweils andere Geschlecht sei (Kinsey 1966, S.569). Wenn ein Rattenmännchen die für ein Rattenweibchen typische Lordose-Haltung einnimmt und sich von einem Weibchen bespringen läßt, verhalten sich beide Tiere nach dieser Definition 'homosexuell' oder 'invertiert'. Bei dieser Definition steht also das geschlechtstypische oder untypische Sexualverhalten im Fokus, während das Geschlecht des Sexualpartners unerheblich ist. Bereits eine solche Definition kann zu Mißverständnissen bzw. falschen Schlußfolgerungen führen, wenn etwa Ergebnisse aus der Tierforschung auf den Menschen übertragen werden (etwa bei Dörner 1976).

So gibt es keine allgemein akzeptierte Definition für den Begriff 'Homosexualität' (Friedman 1993). Vielleicht liegt dies auch daran, "daß die Homosexualität nicht eine Form von Verhalten ist. Es bestehen entweder viele Arten oder überhaupt keine"(Ussel 1979, S.147, Hervorh. i.Org.). Aus demselben Grund benannten Bell und seine Kollegen ihre Studie "Homosexualities", und deshalb spricht Stoller (1979) von'Homosexualitäten' und 'Heterosexualitäten'.

Und doch unterscheiden sich Homosexualitäten von Heterosexualitäten im sozialwissenschaftlichen Verständnis zumindest darin, ob das Objekt der Anziehung und des sexuellen Begehrens dem selben oder dem anderen Geschlecht angehört. Unter Homosexualität(en) soll(en) deshalb die ganz unterschiedlich sich entfaltende gefühlsmäßige und sexuelle Anziehung verstanden werden, die sich auf Angehörige des eigenen Geschlechts richtet.

Läßt sich beim sexuellen Tun noch ein gewisses einheitliches Verständnis innerhalb der Sozialwissenschaften finden, gilt dies nicht dafür, ob es neben der Homosexualität, also der "sexuellen Anziehung durch gleichgeschlechtliche Objekte" (Dannecker & Reiche 1974, S.10), auch etwas wie eine homosexuelle oder schwule 'Identität' gibt, ob es den "manifest Homosexuellen" (S.48) überhaupt gibt.

Seit Jahren findet eine Debatte unter dem Titel 'Konstruktivismus vs. Essentialismus' statt, bei der diese Frage im Kern berührt ist: Gibt es Menschen, die sich nicht nur homosexuell betätigen, sondern die eine Art homosexuelle Persönlichkeit bilden, die quasi über-historisch existiert und mehr Gemeinsamkeiten beinhaltet als das bloße sexuelle Verhalten? Ist die 'homosexuelle Persönlichkeit' lediglich eine Erfindung bzw. Konstruktion der Neuzeit, entwickelt von Psychiatern zum Zwecke der Pathologisierung jener Menschen, die gleichgeschlechtlich verkehrten (Foucault 1977), oder bilden Homosexuelle eine spezifische Gruppe mit biologischer Grundlage (Dörner 1976)? Ist Homosexualität "a way of beeing andunderstanding" (Pronger 1990), "a form of existance" (Bech 1997a), oder gibt es ein "genuine gay self" (Savin-Williams 1998)? Sind die Homosexuellen unserer Tage "geschichtliche Erscheinungsformen der Sexualität in der Gegenwart" (Schmidt 1996) oder tief in der Persönlichkeit verankert (Money 1988), etwa aufgrund kollektiver und gesellschaftlich geprägter Erfahrung (Dannecker 1989)?

Divider


Eine Genealogie des Geschlechtsbegriffs
Akademie Verlag


Zur Konstruktion der Kategorie Geschlecht
im Medizinischen Diskurs des 19. Jahrhunderts

Verlag: Beske + Budrich


nach eigenen Erfahrungen
Verlag: August Hirschwald
» «

Biographisches Lexikon
der hervorragenden Aerzte aller Zeiten und Völker
Verlag: Urban & Schwarzenberg


» Zweiter Band (1885) «
» Dritter Band (1886) «
» Vierter Band (1884) «
» Fünfter Band (1887) «
» Sechster Band (1888) «


hervorragender Ärzte des neunzehnten Jahrhunderts
Verlag: Urban & Schwarzenberg
» «

Divider

» Martin Schurig «

» Spermatologia Historico-Medica (1720) «

h.e. seminis humani consideratio physico-medico-legalis, qua ejus natura et usus, insimulque opus generationis et varia de coitu aliaque huc pertinentia, v.g. De Castratione, Herniotomia, Phimosi, Circumcisione, Recutitione, & Infibulation, item de Hermaphroditis & Sexum Mutantibus, Raris & Selectis Observationibus, annexo Indice locupletissimo, traduntur

» Muliebria historico-medica (1729) «

hoc est partium genitalium muliebrium consideratio physico-medico-forensis, pudendi mulibris partes tam extern ae quam internae, scilicet uterus cum ipsi annexis ovaris et tubis fallopianis, nec non varia de clitoride et trinadismo, de hymene et nymphotomia seu feminarum circumcisione et castratione selectis et curiosis observationibus traduntur.

» Parthenologia historico-medica (1729) «

hoc est virginitatis consideratio, qua ad eam pertinentes pubertas et menstruatio, cum ipsarum maturitate, item varia de insolitis mensium viis atque dubiis virginitatis signis, nec non de partium genitalium muliebrium, pro virginitatis custodia, olim instituta consutione et infibulatione variis atque selectis observationibus cum indice locupletissimo traduntur.

» Parthenologia historico-medica (1729) «

hoc est virginitatis consideratio, qua ad eam pertinentes pubertas & menstruatio, cum ipsarum maturitate, item varia de insolitis mensium viis atque dubiis virginitatis signis, nec non de partium genitalium muliebrium, pro virginitatis custodia olim instituta, consutione et infibulatione variis atque selectis observationibus cum indice locupletissimo traduntur.

» Gynaecologia historico-medica (1730) «

hoc est congressus muliebris considerato physico - medico - forensis qua utriusque sexus salacitas et castitas deinde coitus ipse ejusque voluptas et varia circa hunc actum occurrentia nec non coitus ob atreiam seu vaginae uterinae imperforationem et alias causas impeditus et denegatus, item nefandus et sodomiticus raris observationibus et aliquot casibus medico-forensibus exhibentur.

» Syllepsilogia historico-medica (1731) «

hoc est conceptionis muliebris consideratio physico - medico - forensis qua ejusdem locus, organa, materia, modus in atretis seu imperforatis, item signa et impedimenta, deinde didymotokia seu gemellatio superfoetatio et embryotokia et denique varia de graviditate vera, falsa, occulta et diuturna nec non de gravidarum privilegiis animique pathematis et impressione raris et curiosis observationibus traduntur.

» Embryologia historico-medica (1732) «

hoc est infantis humani consideratio physico-medico-forensis, qua ejusdem in utero nutritio, formatio, sanguinis circulatio, vitalitas seu animatio, resoiratio, vagitus et morbi, deinde ipsius ex utero egressus praematurus et serotinus, imprimis partus legitimus et circa eundem occurrentia, verbi gratia partus difficilis, post matris mortem, numerosus et multiplex, tam puellarum, quam uetularum. item per insoitas vias, et plane insoitus porro varia symptomata, e. g. uteri prolapsus ejusque inversio et resectio, denique part vs caesa reus et supposititivs cum puerperarum tortura raris observatio nibus exhibentur.

» Lithologia historico-medica (1744) «

hoc est calculi humani consideratio physico-medico-curiosa, qua non solum ipsius generatio, loci natales, ac viae diversa pariter et copia, color et figura, substantia et superficies, sed etiam in corpore humano effectus morbosi et symptomata, item eiusdem excretio et ex urethra excisio lithotomia et nephrotomia porro calculi ipsius analysis chymica et usus medicus pariter ac usus lithontripticorum et antinephriticorum nec non varia de calculis brutorum in specie lapidis bezoar; raris atque selectis observationibus cum indice locupletissimo popnuntur et exponuntur.

Divider

Substanz und Funktion

Divider

Was die Entwicklungen zum Substanzwesen betrifft, so zeigt sich nicht nur in seinem Detailwesen, des jeweiligen direkt Ersichtlichen, sondern unübersehbar in seinem Elementarwesen des Grundsatzes zum Substanzwesen des Seins, daß hierin systematisch seitens des Institutionswesens, eine Andersartigkeit darin als Wesensart des Daseins seine Präsenz erfährt, als der Mensch es selbst es aus seiner eigenen Erfahrung heraus erlebt. In den Anfängen trifft man hierin auf Mythen, die zwischen beidem stehen, im darauf Folgenden auf einen situierenden Glauben, der das wahre Sein repräsentiert und letztendlich sind es Gesetze, die gar explizit das Sein in seiner Substanz vorschreiben, wie es denn sei. In all dem erklärt man dem Menschen, daß es nicht anders sein könne, um (Mensch) zu sein. Ausgehend von Einzelnen, worüber es sich als solches etabliert, ist es jedoch nicht der Mensch, was es beinhaltet und sich darüber repräsentiert, hingegen man den Anschein erweckt, dies repräsentiere des Menschen Sein, obwohl es für sich doch völlig inhaltlos und leblos ist. Worte es sind, worauf es beruht, was diese besagen - Ideologien sind es, die sich darüber umsetzen. Und so hat der Mensch tatsächlich etwas erfunden, oder besser gesagt gefunden, worin dieser Substanzen schafft, die gar nicht existieren, sondern auf Bildnissen beruhen, die man scheinbar realisiert. Es sind geistige Bildnisse, die jeglicher Substanz entbehren und die Handhabe auf der Suggestion beruht, worüber es sich erfüllt und somit innerhalb der Geistwesen im Miteinander eine regelrechte Mutation erwirken. Indess wirkt dies auf das Handlungswesen des Menschen ein und somit findet darüber auch eine erwirkende substanzielle Erfüllung statt. Warum man dies vorzieht und sich derart auch ausgebreitet hat, wird gerade darüber klar, denn man hat darin einen doppelten Nutzen: zum Einen bedingt es der geistigen Vorstellung keinerlei substanziellen Einsatz, sodaß man darin nichts einsetzt und auch nichts verlieren kann. Und gleichzeitig bringt es einem über das Realwesen Substanzielles ein. Es ist somit kein Wunder, daß die Ideologien eine derartige Ausbreitung gefunden haben, denn wie kann der Mensch in seinem reinen Realbezug, sich überhaupt dem gegenüber behaupten und nicht Gleiches tun? Und so führt hierin auch Eines zum Anderen und ab dem Überschreiten der kritischen Masse, wird es auch zum Allgemeinwesen, worin nichts anderes mehr Raum erhält, um sich zu etablieren. Der entscheidende Punkt ist jedoch, daß es sich hierin verhält, wie mit den Misteln auf dem Baum. Die substanzielle Erfüllung ist unabdingbar und wenn es dazu gelangt, untereinander mit dem Schein handeln, man dabei doch leer ausgeht. Es reguliert sich somit eben auch über das, worüber es sich substanziell erfüllt und so stellt es sich auch mit Ideologien, wie es generell so ist, mit deren Präsenz: es ist 'letztendlich' einzig eine Frage der Realisierung.

Das Substanzwesen

(raumausfüllende) Substanz ↔ Wirkung(ssubstanz) ↔ Funktionalität

Wie man dem Ersichten der drei Substanzen wohl entnehmen wird, hat man im Verlaufe die Funktionalität gar nicht mehr als eine eigenständige substanzielle Gegebenheit erachtet, sondern sich einzig noch auf die beiden Ersteren fixiert, worin der Dualismus immer wieder verfällt und darüber den Monismus gar fördert, da sich über weder noch das Sein als solches darlegt und es kein Nichts sein kann, welches die Natur beschreibt - kein Nichts, weder in der Natur des Seins und somit auch darin existiert. Und so repräsentiert indess der Monismus eine Kontinuität, welche jedoch nichts anderes darlegt, als die Beständigkeit des Zerfalls. Alles miteinander findet jedoch seine Aufklärung darüber, daß man die Funktionalität, gemäß ihrer substanziellen Präsenz, entsprechend in Betracht zieht und die Ersichtung und das Händling darauf einrichtet. Was die raumausfüllende Substanz betrifft, so ist man hierin der Sinnestäuschung verfallen, denn tatsächlich kann über die Wahrnehmung jeglicher Art einzig Wirkung wahrgenommen werden. Und somit ist darüber auch die raumausfüllende Substanz als solche gar nicht (er)faßbar, sondern einzig indirekt erfahrbar. Darauf beruht es auch, daß man die Dinge umgekehrt hat und sich dies gar als funktional erweist, jedoch nur bis zu einem gewissen Grad und Konstanz der stattfindenden Verbundenheit seiner drei substanziellen Bestandteile. Abseits dessen wird es indess unübersehbar, daß dem nicht so ist, wie man darin besagt, wie überhaupt die Prinzipien, die man darin begründet, als solche auch nur dem gemäß bedingt funktionieren, als solches diese Prinzipien jedoch unhaltbar sind, da sie eben auch nicht der Natur des Seins entsprechen - das Generelle dem nicht entspricht. Diese Handhabe beruht indess auch auf der Objektbezogenheit des Menschen, dem gegenüber jedoch wiederum das Objekt, welches man institutionell begründet, gar nicht dem entspricht. Man führe es sich im Bezug auf das Geschlecht vor Augen, welche gravierende Gräben sich darin auftun, gegenüber dem, wie der Mensch es erlebt und erfährt, indess man es regelrecht aus seinem Wirkungsverhältnis herausoperiert und isoliert als ein solches in Betracht zieht - derart existiert es tatsächlich nicht und es ist auch einzig die Wirkung, worüber der Mensch das Objekt erfährt und somit vor allem sein Verbundswesen. An sich verhält es sich somit auch gar nicht um eine Sinnestäuschung, denn der Mensch erfährt es doch gar nicht anders, als es von Natur aus gegeben ist, sondern die eigentliche Sinnestäuschung ist tatsächlich ein Erwirktes, was über die Umkehrung der Darstellung der Verhältnisse überhaupt erst zu dem geworden ist. Es handelt sich jedoch um ein 'aufgesetztes Seiendes', sodaß es sich auch einzig als ein solches stellt. Des Menschen reguläres funktional eingerichtetes Daseinswesen wird darüber in keiner Weise in Mitleidenschaft gezogen, denn auch darin ist die Funktionalität eine Unveränderliche. Die Funktionalität selbst ist in keiner Weise abänderbar, worüber sie auch als eigenständige Substanz des Seins erkenntlich ist!

Man bedenke hierzu des Menschen Werdegang seiner Kultivierung, angefangen von dem Nutzen des Feuers und der Erfindung des Rades. Im Verhältnis dieser Inbetrachtziehung verdeutlich sich, daß dies in seinem Grunde auf nichts anderem beruht, als der Ergründung und Handhabe der Funktionalität und man sich dem gegenüber indess befangen sieht, das nachvollziehende Verständis dafür im erforderlichen Maße (gar rein) geistig zu begründen. Tatsächlich begründet sich dies jedoch nicht geistig, sondern sinnlich, über das Erfahren der Vorgänge in der Natur des Daseins. Somit beruht das Verständnis auch nicht auf dem (rein!) geistigen Begründen, sondern basiert auf dem Ersehen, in seinem Verbund mit der Erinnerung des Erfahrenen, woraus sich das nachvollziehend Verstehen ergibt, gemäß dem wir es auch in unserer Sprache entsprechend über sein Kombinat antreffen (vERStEHEN). Dieses Mißverhältnis beruht jedoch wiederum auf dem des substanziellen Bezuges, indem man den Geist zum alleinigen Objekte macht, sodaß aus diesem scheinbar alles miteinander hervorgeht und somit die erforderliche Differenzierung darüber gar nicht ersichtlich ist (Sinneswahrnehmung ↔ Geistesprojektion). In Anbetracht der Spezifikation seiner eigentlichen Funktion indess, nämlich dem, was man Denken und Vorstellen nennt, ergibt sich die Klarheit bezüglich der Belange, zumal auch nie außer Frage stand, daß da auch anderes ist und nicht nur Geist, was unsere Sprache auch dem gemäß besagt. Hingegen bezieht man sich auch darin wiederum einzig auf Eines und somit die Seele, dem gegenüber sich jedoch über die Funktionalität aufklärt, daß die Vielfalt der sich repräsentierenden Gegebenheiten des Wirkens, gar nicht aus ein und demselben hervorgehen kann. Mein Werdegang zur Ergründung begann mit den mentalen Veranlagungen im Unterbewußtsein, indess spielt es tatsächlich gar keine Rolle, von welcher Warte aus man die Gegebenheiten darin aufklärt, denn jeglicher funktionale Bestandteil darin, wird als solcher unübersehbar, insofern man überhaupt dies als solches in Betracht zieht.

Wie man den Worten entnehmen kann, findet hierin einzig ein Bezug zur Seele statt und nicht zum Gehirn. Dies beruht darauf, daß das Bewußtsein nicht Bestandteil der Physis ist. Über die Präsenz der einzelnen Wirkungseinheiten und den Verläufen 'von wo kommt was' und 'was ist mit was auf direkte Weise verbunden - was nicht' und Weiterem, beschreibt sich das in sich geschlossene Einheitswesen darin. Was man als inneren und äußeren Kreis in seinem Verhältnis von Seele und Physis in Betracht zieht, befindet sich abseits dessen. Maßgeblich für diese Abtrennung ist, daß sowohl das Unterbewußtsein, wie auch das Überbewußtsein, von außen derart nicht erfahrbar ist - darin besteht die Markantz - es ist auf direkte Weise einzig über das Innenerleben erfahrbar. Auch der Geist ist nicht auf direkte Weise von außen physikalisch erfahrbar - auch dazu bedingt es der Voraussetzung körperlich-physischer Auswirkungen. Dem gegenüber ist indess auch das Jeweilige des Bewußtseins über die Auswirkungen nach außen, gleich dem des Geistes erfahrbar, insofern man des jeweiligen funktionale Präsenz entsprechend in Betracht zieht. Sowohl das Instinktive, hingegen nicht das Intuitive, wie auch der Charakter und die Triebe der diversen Gaben, erfährt man sehr wohl im Äußeren, über das nämlich, worüber es sich umsetzt. Hingegen beruht das Unbewußtsein des Selbst, gegenüber den wirkenden Präsenzen, indem es 'als solches' nicht seine Achtung und Inbetrachtziehung erfährt. Hingegen ist es tatsächlich gar nicht derart unbewußt, sondern es wird einzig nicht als das ersichtet, als was es erfahren wird. Die mentalen Organe und Veranlagungen, verfügen über ein jeweiliges autonomes Funktionsprinzip, dem gegenüber man das Über- und Unterbewußtsein einerseits über die differenzierende Örtlichkeit, daß direkte bewußte Bezugsverhältnis im Überbewußtsein, wie auch über den Gegensatz, daß man das Unterbewußtsein einzig über seine daraus hervortretenden Wirkungen erfährt, indess jedoch keinen direkten Einblick nehmen kann, erfährt. Was die Örtlichkeiten betrifft, so befindet sich das Unterbewußtsein im Bereich des Magens und das Überbewußtsein im Bereich des Gehirns. Gerade über die Funktionalität zeigt sich, daß sowohl das Gehirn, wie auch das Überbewußtsein, ein evolutionär zusätzlich Entstandenes ist, hingegen das Unterbewußtsein das eigentlich leitende Prinzip der Lebewesen darstellt, worüber sich das Eigenartswesen überhaupt ergibt (instinktive Steuerung des Selbst, nicht nur reine Reflektion). So sind das Gehirn und das Überbewußtsein ein zusätzliches das Zentrum, worüber sich erweiterte Funktionsweisen ergeben. Es handelt sich um einen Verbund mit dem körperlich-Physischen, hingegen handelt es sich nicht um eine 'physikalische Körperlichkeit'. Auch hier wiederum möge man es sich über die Computersoftware vergleichsweise vermitteln, wie es sich damit verhält. Nachfolgend das Chemata des Organisationskonstrukts. Bezüglich des Physischen habe ich es hierin nicht spezifiziert, indess besteht darin eine gleiche Differenzierung, worin die Organe des Rumpfes, im Verhältnis von Verdauungssystem, Herz, Lunge und Kreislaufsystem, dem des Unterbewußtseins entsprechen, in ihrer Zentralstellung und Autonomie. Instinkt, Bewußtsinn und Gehirn repräsentieren das jeweilige individuelle Leitwesen, dem gegenüber das rein Vegetative einer eigenständigen Inbetrachtziehung bedingt.

Organisationskonstrukt

Die Grundlagen des Substanzwesens, ergibt sich in seiner unübersehbaren Weise über des Menschen Dasein in seiner Innerlichkeit (Wirkungssubstanz [Bewußtsein]) gegenüber der Körperlichkeit (raumausfüllende Substanz & Wirkungssubstanz [Leib und Seele]), in Verbindung mit dem Werden, Sein und Vergehen [Funktionalität]. In den stattgefundenen Ergründungen trifft man jedoch in keiner Weise, weder auf das Funktionswesen einer inneren Wahrnehmung (gemäß eines Organs, welche im Inneren die bewußtwerdende Wahrnehmung indess hat man gerade daraus ein Debakel konstruierte, worüber sich eine völlige Unverständlichkeit gegenüber dem Nachvollzug einstellte und gar immer unverständlicher wird. Betrachtet man sich das Substanzwesen im Verhältnis des Seelenwesens, so verdeutlich sich gerade hierüber, daß nicht nur da Was die Funktionalität betrifft, so steht indess diese auch gar nicht in Frage, hingegen wird sie einzig nicht in ihrer Konstanz und Eigenständigkeit als Substanz in Betracht gezogen, in Verbindung der beiden Anderen. Wobei doch Werden, Sein und Vergehen unmißverständlich vor Augen führt, daß die dahinter steckende Funktionalität als solches gar nicht weicht und verlustigt geht, sondern dies darauf beruht, inwiefern die Funktionalität ihr Erfüllungswesen erfährt und sich darüber ihre generelle Präsenz - die Kontinuität aufweist - wie auch das darüber stattfindende, in seiner Kontinuität sich fortpflanzende Leben. In den weitreichenden Ergründungen der Geschichte, die ich vollzog, ist die Erwägung der Funktionalität als Substanz in keiner Weise anzutreffen, hingegen findet aber auch der Substanzbezug von Wirkung nicht als solches, statt, sondern man pflegt ganz andere Sichtweisen. Man bedenke diesen gravierenden Unterschied, welchen es ausmacht und ersehe, daß es doch in jeglichem Händling Inhalt ist und als solches sich auch aufweist. Als Urgrund indess erweist sich die Gegebenheit, daß man nie die Wahrnehmung 'für sich' ergründete, sondern einzig im Bezug auf die äußere Sinneswahrnehmung, hingegen im Inneren im Bezug der Wahrnehmung der Sinne, sich überhaupt erst diese Eigenart der Generalität als solches aufweist. Es verhält sich darin tatsächlich als ein Unbewußtsein gegenüber dieser Gegebenheit, welches sich genau so stellt, wie des Menschen Bewußtsein, welches ich erläutere und in allem Inhalt ist und doch, entweder als Unbewußtes einher geht, oder gar von Grund auf verleugnet wird, obwohl es doch in jedem Menschen in seiner vollen Funktionsfähigkeit und Ausmaßen an Wirken präsent ist. Durch alle Zeit hindurch, bis zurück zu den alten Griechen, erfährt mein darlegendes Substanzwesen des Bewußtseins, in keiner Weise eine derartige Erachtung. Zwar ergab sich mir überhaupt erst über die Inbetrachtziehung der Funktionalität das erlangte klare Ersichten, jedoch stand die Präsenz als solches, wie auch die Unterscheidungen des jeweiligen Hervorbringenden, mir nie in Frage, sondern meine Ergründung bezog sich einzig auf das detaillierte Spezifizieren. (Bewußt und unbewußt) wahrnehmen, denken, Erinnerung, Instinktives, Charakterwesen, Sexualwesen und die Gaben überhaupt, sind seit meiner Jugend nie anders gesehen worden, als man es doch auch mit Worten benennt und handhabt. Hingegen war das Substanzwesen der Funktionalität im Verlaufe der spezifischen Ergründung, mir zum Zentrum der Inbetrachtziehung geworden, indem nämlich einzig darüber sich diese erlangte Klarheit der Details überhaupt erst darüber ergab. Und so zeigt sich darüber auch, daß hierin Eines mit dem Anderen zusammenhängt und man sowohl als auch einzig verdrängte, um als solches nicht in Erscheinung treten zu lassen, um anderem Substanz zu verschaffen, worüber es gar nicht verfügt. Offenkundig ist es indess im Bezug auf den Instinkt, wie auch der Gegebenheit, daß die Bewußtwerdung eben nicht über das Denken hervortritt, sondern abseits davon, indess erfährt all dies hingegen bewußt seine außen-vor-Stellung.

(Entsprechung der) FUNKTIONALITÄT SEIN  
/   \
Werden   Vergehen

Bezüglich des 'Verhältnisses' der Substanz gilt es zu bedenken, daß es ein isoliertes Atom, wie man sich anmaßt, in Betracht zu ziehen, nicht existiert. Gerade 'das Verhältnis' des kleinsten unteilbaren Teilchens legt gar dar, daß ein Sein ohne Einheit gar nicht existiert, da es nämlich (selbst gedanklich - nur irrigerweise) nicht isolierbar ist, in der gänzlichen Erfülltheit des Raumes. Somit ist zwar 'das kleinste unteilbare Teilchen' als solches, jedoch nicht als solches isoliert existent, worin die besondere Markantz dessen beruht, sodaß es wiederum gar nicht derart sein kann, wie es für sich selbst ist. Darauf beruht auch das besondere Handikap bezüglich jeglichem Selbst, es als solches in Erfahrung zu bringen, welches nämlich einzig in dem Verhältnis ersichtlich wird, inwiefern das darauf Einwirkende gleichermaßen ersichtlich wird. Gerade dies ist der elementare Grundsatz, worauf das Sein beruht, denn tatsächlich ist jegliches Sein, so wie auch das des Atoms, einzig gemäß seines kausalen Verhältnisses über das Verbundwesen präsent. Es existiert nichts für sich isoliert, sondern einzig differenziert. Somit ist auch einzig die kleinstmögliche Einheit, welche sich als solches von anderem abgrenzt, das Entsprechende, doch gibt es keinen Beginn einer Entstehung des Seins an sich, was uns vor Augen geführt wird darüber, daß es 'darin' kein Nichts gibt und die Substanz als solches eine Beständigkeit ist. Und wie uns der Blick ins Universum darbietet, so kann man einmal darüber spekulieren, was sich darin als die größte Einheit erweist und man gar Sternennebel und Galaxien als solche erachtet, jedoch verdeutlich uns doch das ersichtliche Dasein, daß das Ausmaß an Größe doch einem gewissen Höchstmaße unterliegt, sodaß sich darüber darlegt, daß es sich im Mikrokosmos nicht anders verhält, daß die Ebene, worin die Einheiten sich nicht weiter differenzieren, nur bis zu einer gewissenen Ebene gleichermaßen einzig anzutreffen ist. Gerade das Erfahren von Werden, Sein und Vergehen, führt uns vor Augen, daß die Einheiten 'als solche' einzig bis zu einem gewissen Grade verfallen, es sich jedoch primär um den Verfall von Einheitsverbünden handelt und die jeweiligen Einheiten eine entsprechende Ebene an Verbundswesen repräsentieren. Das Prinzip der Einheiten und Einheitsverbünden beruht auf der Vereinigung von Gemeinsamkeiten und Ergänzungen, worüber es sich gegenüber Widersprüchen (nicht dem Entsprechenden) abrenzt. Gerade dieses Prinzip ist ebenfalls wiederum über die Menschlichkeit klar ersichtlich, worin es sich spezifisch derart gestaltet. Hierin steckt gleichermaßen auch das Prinzip der Waage, welches wir im Verbund einhergehend als Reflektionen der Gefühle erfahren und in der Natur des Seins sich über die Ausgewogenheit repräsentiert. Dies ergibt sich als zugrundeliegende funktionale Bedingung der Einheitswesen des Seins, was sich (er)klärt über das Verhältniswesen der Einheit, welche in jeglichem Bezug ein Dazwischenstehendes ist und das Sein sich über die Ausgewogenheit der Kräfteverhältnisse von Sein und Nicht-Sein ergibt. Auch hierzu gibt es ein Musterbeispiel aus dem Leben, denn die einstigen Dinosaurier konnten einzig derart und so lange existieren, bis die Atmosphäre sich änderte und die darüber enstehende Gewichtigkeit ihrer Körper nicht mehr weiter auf dem Lande lebensfähig war, indess der Wal ins Wasser wanderte und uns heute noch mit seiner Gewichtigkeit in Erstaunen versetzt. In Anbetracht der drei Substanzen ergibt sich die Erklärung dafür, wie ganz von selbst.

So ist es auch nicht das Sein, sondern die Veränderungen im Sein - die Vorgänge - worüber sich die tatsächliche Ersichtung ergibt und über die Kontraste bestimmen sich die Klarheiten. Man wendet dem gegenüber ein mathematisches Substanzverhältnis an, welches ebenfalls derart nicht existiert, sondern einzig sich als ein Chemata von Relativitäten repräsentiert und somit einzig einen Sinn ergibt, insofern man es einzig derart handhabt. So ergibt ein Apfel mehr zwar der Entsprechung der Zahl, doch entspricht die Substanz des Apfels keinem Zahlenwert, denn die Beständigkeit einer Einheit jeglicher Art, außer dem Naturganzen als solche, ist innerhalb dessen, bedingt durch das Grundwesen der Einheit, einzig relativ der Gegebenheit des kausalen Momentes, welcher in seiner Verbundenheit mit der Zeit sich unentwegt fortsetzt und verändert. Während sich jedoch die Zeit zwar ebenfalls als Substanz stellt, geht diese indess im Verbund mit der Substanz der Wirkung untrennbar einher, wie überhaupt sie darüber auch einzig als solche in Erscheinung tritt, deren Eigenständigkeit sich als solche sich somit auch nicht ergibt. Zwar geht keine der Substanzen für sich isoliert einher, sondern sie alle Dreie erfüllen den gesamten Raum, hingegen besteht bei diesen ein jeweiliges Eigenes, von dem Anderen substanziell getrennt einher Gehendes, dem gegenüber es sich mit der Zeit und der Wirkung anders verhält und wir auch das Sein einzig über das Wirken erfahren. Und so erfahren wir nicht nur die raumausfüllende Substanz einzig indirekt, sondern auch die Funktionalität, jedoch zeigt uns die Erfahrung darin, daß gerade diese beiden Bestandteile nicht mit dem Wirken, wie die Zeit, bedingend in einem derartigen Verbunde einher gehen, sondern es das Werden, Sein und Vergehen von Einheiten betrifft und wir die Präsenz von Einheitswesen in dessen Verbunde erfahren. Dem gemäß ist die Faßbarkeit dessen auch einzig relativ möglich und auch einzig bis zu einem gewissen Grade. Als wesentlich stellt sich hierin jedoch, daß die Natur des Seins nichts anderes darbietet, als wie sie ist und uns das Erleben über die Sinne genau dies vor Augen führt, ohne daß der Mensch Gelegenheit 'darin' erfährt, es 'nicht' derart zu erfahren. Dem gegenüber gibt es jedoch Menschen, die sich darüber dem zu entziehen suchen, indem sie sich in ihrer Vergeistigung begraben und sich darin eine Weltsicht erschaffen, welche sich jedoch ebenfalls dem nicht entziehen kann, da der Mensch nicht rein geistig existieren kann. In allem was ist und auch zuwider ist, reguliert es sich eben auch über die Realisierung. Nachfolgende einmal die Varianz der Betitulierung dieses Buches, gemäß seiner dem entsprechenden Gegenüberstellung, worüber sich das jeweilige Funktionsprinzip und dessen Erwirken verdeutlicht.

Das Sein, Sinneswahrnehmung
und geistige Vorstellung koordinieren


V E R S U S

Das Sein und die Sinneswahrnehmung
über die geistige Vorstellung koordinieren

Zur Anwendung von Wirkung gilt es hervorzuheben, daß die 'Bewegung', welche man dem gegenüber in Betracht zieht, oder besser gesagt zog, substanziell Bewegtes beinhaltet. Und so gelangte man darüber auch im Verhältnis von Materie und Energie, wo man noch ein relatives reguläres Verhältnis der erforderlichen Unterscheidung pflegte (gemäß dem Bezugsverhältnis), letztendlich zu einer gänzlichen Verfangenheit an Zirkelschlüssen, was dann sogar zur Auflösung dieser Unterscheidung führte. Man vergleiche es mit dem Verlauf der Inbetrachtziehung der beiden Geschlechter und man erfährt darin Gleiches, daß sich ebenfalls über die Zirkelschlüsse die Unterscheidung auflöst. Bei spezifischer Betrachtung zeigt sich auch, worüber es sich ergibt, nämlich im Bezug auf die Grenzbereiche, in welchem nämlich die Ermessung gar nicht möglich ist, es als das Eine oder Andere zu ermessen. Wie bereits zuvor darauf hingewiesen, basiert dies auf der Mißachtung dessen, was die eigentliche Substanz ausmacht, dem gegenüber sich gerade über die Grenzbereiche darlegt, daß es gar nicht das Eine ist, ohne das Andere, was man darin zu ermessen sucht. So ist nämlich die sogenannte Materie überhaupt erst über die Wirkung erfahrbar und je nachdem, um was es sich dabei handelt, nicht eines und dasselbe ist, was die Zusammensetzung der Substanzen betrifft. Und die Energie, die man physikalisch ermißt, geht fast ausschließlich mit sogenanntem Materiellen einher, wie umgekehrt genauso, sodaß sich im Bereich der Grenzen es sich gänzlich vermischt. Und was das Geschlecht betrifft, handelt es sich um eine 'Ausprägung', dies bedeutet, daß es sich regelrecht von der Mitte (der ungeformten Materie!) heraus in die beiden Richtungen entwickelt. Das ist auch, was es besagt und gemäß dem es (er)kenntlich ist, indess basiert der Verfall der Klarheit an dem uralten Streit um das prägenetische oder epigenetische Daseinsverhältnis, was tatsächlich unerheblich ist, wo doch das entstehende Resultat zeigt, wie es sich damit verhält. Und auch kann die Materie gar nicht vorgeformt sein, sonst wäre sie in der Entwicklung der Entstehung nicht ungeformt in Präsenz. Hingegen befindet man sich tatsächlich in der richtigen Richtung, indem man erkannt hat, daß es die Information ist, die vererbt wird und die stattfindende Prägung darauf beruht. Indess vermischt man hierin noch die Information mit dem Materiellen, obwohl es diese, gemäß der Verlustigung des Atoms, doch gar nicht mehr gibt. In Anbetracht dessen, was darin seine Erachtung erfährt, nämlich Nukleinsäuren, so ergibt sich auch daraus die Erklärung, daß es sich um Auswirkungen darauf bezieht und nicht auf die Substanz selbst, worin das Kernwesen dessen beruht. Und das in einer Zeit, wo immer mehr Inhaltlichkeiten unseres kulturellen Daseins, einzig noch auf der substanziellen Gegebenheit von Information beruht.

Die Substanz der Information - Bestandteil der Wirkung

Man betrachte sich das Sein, vorzugsweise seines inneren Selbst und erachte die stattfindenden Wirkungen. Was erfährt man darüber? Das eine Wirkung gleichzeitig auch Informationen liefert über das wirkende Stattfinden. Das ist es auch, gemäß dem wir es bewußt verarbeiten. Nehmen wir die Dinge hingegen unbewußt wahr, erweist es sich regelrecht als ein vorbeiziehendes Wirken, denn um es informell zu nutzen, bedingt es einer ganz spezifischen Reflektion. Und so auch gegenüber dem Wirken von Handlungen, die im Gegenüber stattfinden und dieses Wirken Informelles beinhaltet, worüber wir auch kommunizieren. Hingegen, wer nicht darauf achtet - es nicht reflektierend betrachtet, die informellen Mitteilungen auch nicht wahrnimmt. Wirkung und Information sind regelrecht Eines, untrennbar miteinander verknüpft, gemäß einer Legierung - es steckt darin, man muß es einzig sichten, um es zu erfahren. Egal was wir an Wirkungen erfahren, es liefert uns Information und wenn es auch nur die ist, daß eine Wirkung stattgefunden hat. Maßgeblich hierin ist, wie die Körpersprache verdeutlicht, daß man die Information auch als solche in Betracht zieht und verarbeitet. Sie basiert auf der resonierenden Wahrnehmung. Indess findet dies auch funktional beim Übergang von der bewußten Wahrnehmung in die Erinnerung statt, was man in aller Deutlichkeit daran erkennt, daß Empfindungen und Gefühle (das Reizwesen) in keiner Weise im Geiste in Erscheinung treten, worüber es sich auch in aller Klarheit verdeutlicht, daß hierin eine Versinnbildlichung stattfindet - eine Übertragung - beim Übergang in die Erinnerung und nicht die Wirkungen selbst dort hinein gelangen. Es ist vielmehr eine Information darüber, gemäß dem Bildnis einer Person, doch wer sich das Bildnis im Geiste genauer betrachtet, mit geschlossenen Augen, wird erkennen, daß es doch nur ein chemenhaftes ist und gemäß der Zeit, die vergeht, auch die Klarheit darüber schwindet, es letzendlich nur noch abstrakte Fragmente sind, die man sichtet. Locke nannte es Idee, was in unserem Geiste erscheint, indess nutzte dieser die Bezeichnung aufgrund seines Kontrapunktes gegenüber Plato(n)'s idéa, wohingegen dies doch mehr schon eine Spekulation bezeichnet, um was es sich denn handle, worum es sich sogar bei Plato(n) drehte. In der unüberdachten Weise hingegen, die Locke dabei auch in Betracht zieht, wird man leicht über den Vergleich gegenüber dem Wahrgenommenen über die Sinne erkennen, daß es sich rein um eine abstrakte Information handelt, die teils auch als Bildnisse erscheinen und über Sprache, indess die geistige Vorstellung sich gar nicht wirklich spezifizieren läßt, in den vielfältigen Varietäten der informellen Erscheinungsarten darin. Hingegen ist jedoch der Grundsatz allgemein auch so angesehen, daß im Geiste informelles stattfindet, wobei man indess dies mißlicherweise nicht gemäß seiner Funktionalität und somit meiner Beschreibung, in seiner funktionalen Eigenständigkeit ersieht, sodaß man darüber auch diese Klarheit nicht erkennt. Darum ist es auch derart wesentlich, die Unterscheidung der Wahrnehmung der Sinne und was im Geiste in Erscheinung tritt, denn überhaupt erst darüber zeigt sich mit aller Klarheit, daß man es sowohl in der Erinnerung, wie auch im Geiste, einzig mit Informationen zu tun hat und nicht mit den Wirkungen selbst, welche außerhalb dessen stattfinden. Maßgeblich ist, daß es sich jedoch ebenfalls um Wirkungen handelt bei den Erscheinungen der Bildnisse, hingegen diese Wirkungsart speziell als Information in Erscheinung tritt und somit aufgrund ihrer Art, sich jedoch grundlegend davon unterscheidet. Die Erklärung dazu beschreibt sich über die Software des Computers, worin man regelrecht auf Gleiches antrifft. Auch darin dringen die Wirkungen nur bis zu einem gewissen Teil über die Peripherie ein, werden weitergeleitet und schließlich in Computerdaten (reine Information) umgewandelt, worüber das Auslesen und die Weiterverarbeitung stattfindet. Auch darin basiert das Softwaremäßige rein auf Wirkungen, jedoch auf anderen, wie sie außerhalb stattfinden. Hierin wird regelrecht die Information, welche das Wirken liefert, regelrecht aus dem Wirken herausgefiltert.

from https://www.mentalfirst.com/konzentrierter-lifestyle-6-einfache-uebungen-fuer-mehr-widerstandskraft-und-leistung/gehirn-nervenzellen-und-synapsen/

Auch die geistige Entwicklung zeigt es auf, daß diese nicht nur auf der Befüllung der Erinnerung beruht, sondern des Funktionswesens der Verarbeitung. Indess findet diese auch wiederum nicht im Geiste statt, sondern in der Erinnerung. An sich besagt es bereits die Logik, denn insofern der Geist Projektor ist, findet es auch nicht darin statt, zumal in der Erinnerung doch die Inhalte sind, die man verarbeitet. Und auch hierin basiert es wiederum aufgrund der fehlenden erforderlichen funktionalen Unterscheidung, obwohl es doch gerade hierin unzweideutig stellt, wie es sich damit verhält. Tatsächlich benennt es sich nämlich als Entwicklung der Erinnerung, jedoch stellt es sich hierin regelrecht, wie mit dem Gras, das nach wie vor grün ist und so hoffe ich, daß man dies berücksichtigt, wie auch ich und die Benennung und Sache auseinander hält. Zum Einen erfahren wir hierin, daß die selbstbewußte Wahrnehmung überhaupt erst nach einigen Lebensjahren überhaupt einsetzt, was einerseits mit dem Befüllen der Erinnerung zusammenhängt, wie vor allem auch dessen Vernetzung, dessen Grundlage sich erst einmal ausbilden muß, damit sich hineingelangendes auch regulär damit verknüpfen kann - es der verküpfenden Vernetzung bedingt, um als Bestand darin zu sein. So ist nämlich die bewußte Wahrnehmung als solche eines, jedoch daß man seine bewußte Wahrnehmung auch als solche wahrnimmt, bedingt der Reflektion und somit der geistigen Reflektierung dessen (siehe Descartes), sodaß es ohne dies auch zunächst noch nicht stattfinden kann. Das Kleinkind nimmt zwar bewußt wahr, was stattfindet, jedoch kann es sich nur bedingt der Ausbildung der Erinnerung überhaupt daran wieder erinnern. Damit eine Erinnerung zu einer bleibenden wird, bedingt es nämlich der anknüpfenden Vernetzung mit dem, was besteht. Und wenn etwas noch nicht besteht, oder sich Neues darin ausbilden soll, bedingt es einer entsprechenden Fundierung dessen. Es hängt somit auch alles mit dem zusammen, was dort hinein gelangt und mit was und inwieweit es sich vernetzt. So findet jedoch gerade in diesem Netzwerk ein beständiges Wirken statt und nicht nur in dem Bezug der Wahrnehmungen, welche dort hinein gelangen, sondern auch innerhalb derer selbst, was wir vor allem erfahren, wenn unsere wahnehmenden Sinne schlafen und unsere Träume es uns vor Augen führen. Indess stammen diese nicht aus der Erinnerung unseres Überbewußtseins, sondern aus der Erinnerung des Unterbewußtsein. Wir verfügen darin über Zweie, welche zwar gleich funktionieren, doch eine jeweilige andere Inhaltlichkeit sozusagen verwalten. Auch hier wiederum ergibt sich der Vergleich zum Computer, denn bei der Erinnerung im Überbewußtsein, welche in direktem Bezug mit dem Bewußtsinn und dem Geist einher geht, handelt es sich regelrecht um den Ramspeicher, worin Informationen präsent gehalten werden, mit denen wir uns in einem gewissen Zeitrahmen der Gegenwart beschäftigen. Hingegen entspricht die Erinnerung im Unterbewußtsein regelrecht der Festplatte, worin die Langzeiterinnerung seine Raum findet, indess existiert darin keine Starre, sondern auch dort findet eine beständige Verarbeitung statt, nämlich ebenfalls nicht nur über die Eingänge. Wir erfahren all dies über die Anwendung von Erinnerung, über die Art und Weise der Verfügbarkeit und Verfügbarkeitsmachung der Inhalte. Dem gegenüber findet jedoch das, was man als das eigentliches Denken, oder konkreter Nachdenken bezeichnet, über den Kreislauf der Projektion von Erinnerung im Geiste statt, welche bewußt wahrgenommen und wieder in die Erinnerung gelangt statt. Der Vorgang der bewußten Wahrnehmung dessen ist es, was folglich in der Erinnerung eine dem Erscheinungsbilde hinzufügenden Markantz verschafft, sodaß sich darüber auch eine Veränderung des Vorherigen Verhältnisses von Erinnerung ergibt. Es ist somit schon eine 'geistige Betätigung', indess bildet der Geist auch darin einzig nur ab, was diesem aus der Erinnerung zugeführt wird, was man ersehen kann, wenn man es spezfisch derart in Augenschein nimmt.

Wie man wohl bemerkt hat, so sind wir gänzlich vom eigentlichen Thema abgekommen, was mir jedoch wesentlich ist, um zu vermitteln, daß Sexualität und Geschlecht jeweils etwas ganz Bestimmtes sind und vor allem der Geist in keiner Weise, auch nur anteilsmäßig, in irgend einer Art dies repräsentiert. Dieser repräsentiert einzig Bildnisse aus der Erinnerung und diese enthalten nicht die Wirkungen, welche von dem Sexual- und Geschlechtswesen ausgehen. Gerade dies ist elementar zum Nachvollzug. Um die Gegebenheiten 'als solches' zu erfahren, erfordert es der Inbetrachtziehung des bewußten Erlebens der Sinne. Es ist das sinnliche Erfahren, worüber es in Erscheinung tritt und über die Sinne erfahren wird, dem gegenüber der Geist kein Sinnesorgan ist - dieser empfindet nichts. Es ist abseits dessen der Bewußtsinn, worüber dies bewußt erfahren wird und darüber erfährt es auch seine Klarheit über die Gegebenheiten, denn wie beschrieben, enthalten die Wirkungen auch Informationen, die wir über die Gefühle noch in besonderer Weise vermittelt bekommen, indem darin nämlich die Reflektierungen des Jeweiligen hervortritt, welches mit der Wirkung jeweils konfrontiert wird. Und dem gemäß erfährt mustergültig somit auch ein Heterosexueller, daß er kein Homosexueller ist, da es ihm über die Wirkungen informell vermittelt wird. Es steckt somit in einem drin, wie es sich verhält, jedoch befinden sich die mentalen Veranlagungen im Unterbewußtsein, dessen Wirkungen von Trieben, wie auch die Reflektionen zwar gleichermaßen, gemäß der Intensität des Auftretens, auch zum Überbewußtsein gelangen, jedoch sich die bewußte Wahrnehmung dessen darüber bestimmt, inwiefern man seine Aufmerksamkeit daraufhin einrichtet. So erweist sich jedoch auch vor allem aus dem Umstand heraus, daß man es gar nicht derart in Betracht zieht, gar den Geist dabei fokkussiert, daß es gar nicht derart wahrgenommen wird, wie es sich einem in aller Deutlichkeit repräsentiert, sondern es bleibt gemäß der Unachtsamkeit unbewußt - und doch findet es statt. Gerade die Fokussierung mit dem Geiste wirkt indess, wie dem den Rücken zukehren. Den jeweiligen Wirkungen entgegenkommen und diese bewußt über die Aufmerksamkeit reflektieren, ist hierin das Erforderliche, worüber sich das Ideal der Wahrnehmung und der Kommunikation darin einstellt. Es ist hierin tatsächlich nicht anders, wie mit der Kommunikation mit einem Gegenüber, denn Über- und Unterbewußtsein gehen zwar im Verbund miteinander einher, jedoch sind sie, wie der jeweilige funktionale Verbund in seiner Unterscheidung aufzeigt, mit unterschiedlichem ausgestattet und somit bedingt des funktionsgebdingt, des umgangsmäßigen Vereinigens dessen, ansonsten man in Zwiespalt gerät mit seinem eigenen Selbst. Darauf beruht auch das eigentliche Unbewußtsein gegenüber seinem Unterbewußtsein, hingegen finden trotz dem regulär die Wirkungen statt und werden in dem Bezug in keiner Weise gehemmt. Indess findet die Hemmung über die Unterdrückung des Handlungswesens statt, insofern es sich in seinen Auswirkungen nicht umsetzen kann, zumal, wenn es kontinuierlich eingerichtet ist. Je nach Grad der Intensität der Ausgeprägtheit ist es hierin jedoch entsprechend unterschiedlich, wie sich das Jeweilige auswirkt.

Sinnlichkeit ↔ Sachlichkeit

Darauf basiert auch die Unterscheidung, daß die mentale sexuelle Konstitution das ist, was sich als angeborene Verlagung in seiner Prägung im Unterbewußtsein, gemäß seines instinktiven und intuitiven reflektiven Auftretens, als solches aufweist. Dem gegenüber handelt es sich bei der geistigen sexuellen Identität um das, was sich aus der erlebenden sinnlichen Erfahrung im Verbund mit der Erinnerung heraus ausbildet. Darüber verdeutlicht sich auch das Wesentliche der Markantz und die Unterscheidung, daß die geistige Identität dem gegenüber keine veranlagte Gegebenheit ist und sich über das begründet, worüber es seine Ausbildung erfährt. Dies ist somit auch in keiner Weise derart fixiert, sondern bestimmt sich über dessen ausbildenden Erfüllung an Bewußtsein darüber. Und somit auch, worüber es sich ergibt. Zur Einheitsbildung mit dem veranlagten Selbst bedingt es somit auch der ermessenden bewußten Inbetrachtziehung dessen. Und dies sind die Erfahrungen, welche sich über das Erleben des Sinnlichen ergeben. Insofern indess dies nicht den Grundstock der Ausbildung begründet, hingegen eine Mißachtung erfährt, kann es sich darüber auch nicht ausbilden. Maßgeblich hierin ist, daß das Wirken, wie wir es über die Sinne erfahren, nicht dem gemäß - nicht selbst in die Erinnerung gelangt, sondern in informelle Versinnbildlichungen übertragen werden, sodaß darüber das Sinnliche selbst gar nicht im Geiste in Erscheinung tritt. Und da die bewußte Wahrnehmung grundsätzlich eine fließende ist und einzig über die Erinnerung sich eine Beständigkeit ergibt, kann sich sowohl das Selbstbewußtsein über die Sinnenpräsenz, wie auch die geistige Identität, jeweils gar nicht aus sich selbst heraus begründen, sondern beides bedingt des anderen Reflektion, um zu seiner Ausbildung - erforderlichen Passform - zu gelangen. Gerade die Gegebenheit, daß im Geiste nicht die Sinnlichkeit präsent ist und auch die Sprache keine Sinnlichkeit ist und beides es einzig assoziieren können, darauf beruht auch der Umstand, daß sich darüber das Sinnliche auch weder darstellen läßt, noch vermitteln, sondern einzig darauf hinweisen kann. Für einen Außenstehenden ist das Selbst somit auch nicht einsehbar, sondern einzig über den Verbund der Sinne, worauf es auch beruht, daß einzig die sich Liebenden als solche erfahren, hingegen anderen dies verschlossen bleibt, wenn diesen über die sinnliche Resonanz kein Zugang dazu gegeben ist. So erklärt es sich auch, warum die körperliche Vereinigung jeglicher Art eine derartige Sonderstellung darin einnimmt, da nämlich hierin die Sinne in direkten Kontakt miteinander gelangen, während es sich in Distanz dazu als Verlangen stellt und wie zwei Magnete wirkt in seiner Anziehung. Die Suggestion ist in jeglicher Weise auch ein Bindglied, ohne daß die Dinge auch nur bedingt stattfinden. Dem gegenüber wird darüber auch ersichtlich, wie es sich mit der Resonanz der Liebe stellt, welche hingegen in ihrer Grundlage nicht auf der Sexualität oder dem Geschlechtswesen beruht, sondern auf der Harmonie an Sinnlichkeit und sich darüber das reguläre Gemeinschaftswesen begründet. Auch wird ersichtlich, was dem auch immer wieder, vor allem im Einbezug von Sexualität und Geschlechtsleben, gegenüber tritt in seiner sinnlichen Gegegenheit: die reine Sachlichkeit der Vergeistigung. Die ist ein unveränderlicher Umstand und auch darin bedingt es somit auch der Ausbildung, die sich über die Passform ergibt.

Ich bin mir bewußt, daß ich denke, also bin ich.

Das Mißwesen, welchem man darin begegnet, wird uns über Descartes demonstrativ dargelegt, denn was man in seinem Verhältnis des "ich denke, also bin ich" gar als Allgemeinwesen in Anwendung antrifft, nämlich daß über das Denken die Wahrnehmung hervortrete, beruht auf dem philosophischen Verhältnis, worin es im Innenleben einzig die Seele als (unteilbare) Einheit gibt, welche über den Geist hervortritt - es einzig diese beiden Bestandteile gibt. Tatsächlich verhält es sich indess derart, insofern man die Inbetrachtziehung von außen und einzig über die Sprache vor nimmt (keine Sinne selbst involviert sind!). Es ist jedoch auch die einzige Variante, worüber es sich derart ergibt, denn Sprache, wie auch Geistiges sind nicht das Einzige, was nach außen dringt, was wiederum sich-Liebende am eindringlichsten erfahren, über ihre sinnliche Vereinigung. Indess wurde gerade dies zum kulturellen Ermessungswesen und so gerät gerade darin auch all das ins Abseits, was das eigentliche Ermessungswesen überhaupt ausmacht - nämlich das Sinneswesen. Das Selbst kann hierüber überhaupt nicht in Erscheinung treten, sondern einzig die geistige Identität. Aus dem Grund trifft man auch allseits einzig dies als Ermessungsgrundlage, wobei es sich hierin bezüglich der körperlichen sexuellen Identität und der sexuellen Orientierung zum Sexualparten darin unterscheidet, daß die Inbetrachtziehung des Körperlichen des Geschlechts von außen erlangt werden kann und man somit in beidem dies als Ermessung anwendet, dem gegenüber wiederum dies jedoch gar nicht die sexuelle und geschlechtliche Identität repräsentiert. Wie man darüber erfährt, ist somit hierin auch tatsächlich alles einzig Queer. Und das ist auch das Resultat der Gegenwart, womit man darin konfrontiert ist, es sich indess über das Erkennen des Selbst klärt, wie es sich dem gegenüber tatsächlich verhält. Die Selbstfindung erweist sich hingegen ebenfalls tatsächlich als gar nicht gegeben, denn es bedarf in der Gegebenheit keiner Suche für das, was prinzipiell als solches im Selbst gegeben ist, sondern vielmehr ergibt sich hieraus ein Suchen im Draußen, worin es sich gleich dem Selbst repräsentiert. Genau dies ist daraus auch geworden, doch auch hierin gilt im Besonderen, daß es nicht im und über den Geist zu finden ist, sondern über das sinnliche (V)Erlangen. Vielmehr bedingt es, gerade aufgrund der Umstände, welche die Gegebenheiten mit sich bringen, des außen vor stellens des Geistigen, worüber es sich regulär über die Sinne sich findet, was miteinander in seiner Vereinigung die Erfüllung vollzieht.

Was es mir aufzuzeigen gilt, ist die substanzielle Gegebenheit der mentalen sexuellen Veranlagung und das Verhältnis seiner Präsenz, gemäß meiner Darlegung. Wie man dem entnehmen kann, findet dies keinerlei Beachtung, obwohl es das Kernwesen des sexuellen Wirkwesens ausmacht und im Selbst auch gar nicht unbemerkt vonstatten gehen kann, ohne daß es als solches wahrgenommen wird. Dem gegenüber ist es jedoch von außen gar nicht wahrnehmbar und auch einem Außenstehenden gar nicht vermittelbar. Des weiteren gilt es zu vermitteln, daß es in keiner Weise derart ist, daß das Geschlechtswesen und somit das körperlich-Physische das Zentrum ausmacht, vor allem jedoch nicht das Einzig ist. Vielmehr repräsentiert das Geschlechtswesen einzig eine sekundäre Wirkungsgrundlage, nicht nur in der Partnerwahl, sondern grundsätzlich im Bezug auf das Sexualleben, wie sich in aller Klarheit über die Widrigkeit hervorhebend aufgezeigt. In all dem bestimmen sich zwar die Abläufe primär über die Wirkungen, sowohl des Geschlechts-, wie auch das Sexualwesen, jedoch findet die Regulierung des Vorganges grundsätzlich und einzig in Verbindung mit der Reflektion statt - in keiner Weise ohne dies. So findet zwar, wie man es auch beschreibt, über das Gehirn Reflektionen der physischen Sinnesreize statt, indess verfügt das Gehirn nicht über die Präsenz der mentalen Veranlagung, worauf es auch basiert, daß im Falle des Deliriums, bzw. Schlaf oder anderer Bewußtlosigkeit, Erregungen der Geschlechtsteile stattfinden können, indem nämlich die reflektive Beurteilung darin nicht stattfindet. Über den Vergleich des bewußten Stattfindens zeigt sich hingegen in aller Klarheit diese Unterscheidung. Die Geschlechtsorgane gehören zum Körperlichen und gemäß dem begründet sich darüber auch die Unterscheidung, indem diese für sich auf die rein körperlich-physische Präsenz beschränkt sind. Das Sexualwesen indess ist die Substanz, welches das Zentrum ist, worüber das reflektive Wirken stattfindet. Man möge es sich in aller Deutlichkeit über die Resonanz der Liebe vor Augen führen, in welcher dies seine reguläre Klarheit erfährt, indem darin das Geschlechtliche prinzipiell einzig eine sekundäre Bedeutung überhaupt erfährt. Im Verhältnis von Sex hingegen stellt es sich indess umgekehrt, jedoch dreht es sich hierin auch nicht um Sexualität, sondern um Geschlechtsverkehr. Ich denke, die substanzielle Wesensart und die Unterscheidung, wie auch die Deklarationen erfahren hierüber ihre entsprechende Klarheit. Gerade das ist es nämlich auch, was man gar als wissenschaftliche Ergründung des Sexuallebens ausgibt, worin es sich jedoch einzig um den Geschlechtsverkehr dreht.

... und gar die Bewegung der Materie Materie sei. Tatsächlich hat man sich letzendlich darin darüber dem unausweichlichen Zirkelschluß zu entziehen gesucht, gar die Bewegung zu materialisieren. Da stellt es sich gar als Wunder, daß man sich 'im Anhänglichen' der Medizin, nicht gleichermaßen entwickelte und somit zumindest die Unterscheidung von Körper und Physis bewahrt blieb, vielmehr sogar darin sich Erkenntnisse ergaben, die gar der Philosophie noch viel näher stehen als der Physik. Wobei es sich hierin eben auch auf Bewegendes und Bewegtes bezieht, sich darüber aber auch von der eigentlichen Wesensart von Wirkung unterscheidet. Gerade dies macht nämlich gerade den Unterschied aus, den man im Bewußtsein erfährt, denn hierin findet keine Bewegung statt in dem Sinne, denn es wird gar nichts, vor allem nichts Körperliches bewegt. Es ist zwar derart, daß Wirkungen von Bewegtem dort hinein gelangen und Wirkung nach außen dringen und Bewegung erwirken, jedoch hat das Wirken des Innenlebens nichts mit dieser Art von Bewegung einer Körperlichkeit zu tun. Das die Sinne sich regen ist eine reine Wirkung und die Erregtheit ergibt sich über die Intensität und doch kann man es in keiner Weise als eine Bewegung erfahren. Wirkung ist eben auch nicht Bewegung, sondern eine Eigenständigkeit, welche sich nicht nur im Innern derart äußert, was uns die Vielfalt der Substantive unserer Sprache vor Augen führt, worin gar ein Großteil darin sich auf Gegebenheiten bezieht, die jeglicher räumlichen Präsenz entbehren. Und darin besteht auch das Wesentliche hierin und beschreibt sich auch die Andersartigkeit, welche man hierin antrifft, dem gegenüber sich die anderen Verhältnisse, welche man als Seele in Betracht zog, sich mit dem Erscheinungsbild der Physis vereint auftritt. Hierin ist jedoch ein solches nicht gegeben und die Substanz erweist sich als die von Wirkungseinheiten, mit einer jeweiligen funktionalen Einrichtung, sodaß gerade darüber auch ein direkter Bezug zwischen dem Inneren

Tatsächlich werden wir zwischenzeitlich kulturell gar mit der Beständigkeit der Erfordernis von Aufklärung konfrontiert - jeglicher kultureller Umsturz beruht darauf - warum ich es auch derart in seinem Gegensatz darlege. Es dreht sich nämlich mittlerweile (seit wann ist mir noch unklar) gar nicht mehr um das Ergründen des Seins, sondern einzig noch um das Aufklären entstandener Wirren, die des Menschen Geiste im Verlaufe beständig weiter entwickelt. So wird darüber auch deutlich, warum die Beschäftigung mit dem Geiste auch derartige Ausmaße genommen hat, jedoch führt gerade dies zu diesem Dilemma, denn wie es mir aufzuzeigen gilt, ist aus diesem Verhältnis heraus, der Sichtung des (reinen) Geistes, in keiner Weise überhaupt anderes ersichtlich, außer diesem selbst (Bumerangeffekt). Man bedenke hierzu Descartes' Manifestierung, daß das Bewußtsein über das Denken und somit aus dem Geiste heraus hervortreten würde und stelle dem gegenüber, daß dieser 'funktional' einzig ein Projektor der Erinnerung ist und auch gar nichts anderes sein kann, indem er diese Funktion vollführt. Tatsächlich werden hierin nämlich einzig die geistigen Reflektionen in Betracht gezogen und nicht der Vorgang der bewußtwerdenden Wahrnehmung selbst (Bewußtwerdung &garr; Bewußtsein). Man besagt, daß das Denken die bewußte Wahrnehmung repräsentiere und gleichzeitig damit auch, daß einzig über das Denken die Wahrnehmung stattfinde! Wird es deutlich? Ein Mensch, welcher die Natürlichkeit des Daseins erlebt, erfährt und danach lebt und darüber hinaus noch über die Gabe der Vernunft verfügt, wird sich gar nicht damit beschäftigen, außer seinem Verhältnis der Verwirrung darüber. Und darauf basiert es indess, daß gerade Derartiges auch solche substanzielle Ausmaße erfährt, wie es sich darin ergibt - nämlich gerade aus dem Grunde heraus. Wie sich darüber verdeutlicht, so repräsentieren somit auch geistige Bildnisse eine Substanz, jedoch besteht darin die Bewandtnis, daß es sich einzig im Bezug auf das Bildnis und nicht dessen Darstellung um eine Substanz handelt, denn die Darstellung selbst existiert als solche nicht. Wie das Bildnis einer Person, so ist dies doch substanziell einzig ein Bildnis und der Bezug zur Person fundiert sich tatsächlich über die Suggestion, worin man besagt, es handle sich dabei um diese Person (das ist Franz). Wie man daraus ersehen kann, handelt es sich hierbei auch um ein sogenanntes 'Menscheln', indem der Mensch in seiner Naivität auch entsprechend handelt. Was dieser mit seinen Worten zum Ausdruck bringt, verdeutlicht jedoch, daß er dies so gar nicht meint, wie er es in Worte ausdrückt, denn diesem ist sehr wohl bewußt, daß es sich nicht um die Person selbst handelt, sondern einzig ein Abbild dessen. Und gerade dies ist jedoch auch die andere substanzielle Gegebenheit, worüber so vieles durcheinander gerät. Wie sich darüber verdeutlicht, wird der Mensch immer mehr mit Subsanzlosigkeit erfüllt, die es gar nicht gibt und es sich auch immer mehr ausbreitet, es derart zu sehen und sich darum streitet. Wie lautet doch das Sinngemäße bezüglich des Rechts, daß man dieses doch hat und im Falle des Falles erfährt, daß es dazu doch erst einmal des Erlangens bedingt, um dessen Rechtlichkeit zu erfahren.

Drei substanzielle Gegebenheiten sind es, worüber sich mir im Verlaufe die Gegebenheiten aufklärten: daß über die Wahrnehmung einzig Wirkungen wahrnehmbar sind; daß die Funktionalität eine eigenständige Substanz ist und die funktionale Spezifikation des Bewußtsinns, worüber die bewußtwerdende Wahrnehmung hervortritt. Alles in allem klärte es sich jedoch von Grund auf über die Gegebenheit, daß es in der Natur des Seins keine Widersprüche gibt. Und somit über den Verstand und dessen Funktionalität, welche darauf beruht, Wahrnehmung und Vorstellung gegeneinander abzuwägen, inwiefern sich darüber Widersprüche aufweisen. Beim Verstand handelt es sich indess um eine mentale Veranlagung, welche allesamt ein anderes Funktionswesen repräsentieren, wie man es gegenüber dem Geistes, der Erinnerung, des Bewußtsinns und dem Instinkt antrifft. Diese basieren hingegen auf einer Prägung, die sich einzig umsetzt, gemäß der sich begründenden veranlagten Prägung und dessen damit einhergehenden Intensität der Wirkungen deren Triebe, sowie dessen Erfüllung. Somit handelt sich darin auch primär um den Grad der Ausgeprägtheit und gleichzeitig handelt es sich auch nicht um das Umsetzende darin, sondern, wie man es besagt, einzig um sich vollziehende und sich erfüllende Triebe. So ist es auch nicht der Verstand, welcher die Abwägung der Widersprüche vollzieht, sondern einzig diese Handhabe initiiert und sich dies über die Inbetrachtziehung der Gegenüberstellung von Wahrnehmung und Vorstellung vollzieht - man vollzieht einen Vergleich beider Bildnisse, worüber sich zeigt, inwiefern sich darüber Widersprüche aufweisen. Betrachtet man sich die diversen mentalen Veranlagungen, so erfährt man es derart bei allen gleich dem, in seiner jeweiligen Funktionalität. Darauf basiert auch die Unterscheidung von mentalen Organen und den mentalen Veranlagungen. Der Verstand ist somit auch das Herausragende, was dafür Sorge trägt, daß der Mensch sich nicht in den geistigen Verirrungen verliert und gleichzeitig uns vor Augen führt, daß es keine Widersprüche in der Natur gibt, worüber sich das eigentliche Regulat ergibt. So ist der substanzielle Unterschied zu den Tieren auch gerade darin begründet, dem gegenüber diese aufgrund dessen das Überbewußtsein auch gar nicht derart anwenden, sondern rein über den Instinkt die Gegebenheiten händeln. Man beachte somit auch das Gravierende, daß der Mensch sich nämlich in seiner evolutionären Phase befindet, in welcher dieser 'über sein Bewußtsein' zu seiner gegebenen Präsenz dessen gelangte und es sich darin grundlegend derart stellt, wie man es in den mentalen Veranlagungen antrifft: es bedingt dessen überhaupt erst einmal der Umsetzung und Ausbildung dessen. Und somit auch des bewußten Umganges damit, denn es handelt sich hierbei um das Überbewußtsein, worüber es sich 'neuerdings' umsetzt. Ohne es als solches zu erfahren und anzuwenden, ist der Mensch nicht anders als ein Tier, mit einem erfüllten Geist. Man sagt dazu auch unmenschlich, denn auch ein Tier ist es gleichermaßen nicht.

Gerade dieser substanzielle Vergleich steht allseits außen vor und findet einzig fragmentarisch statt, dem gegenüber jedoch die elementare Bewandtnis nicht nur darin besteht, sondern daß man darüber gleichzeitig auch die Gesamtheit des Bewußtseins außen vor stellt, außer den Geist und die Erinnerung. Dem gilt es mir somit auch entschieden entgegen zu halten, inwiefern DAS den Mensch repräsentiert! Und so gilt es mir vor allem auch, mit aller Klarheit dem gegenüber zu treten, um darüber zu demonstrieren, was man darüber alles außen vor stellt und sich gar nicht darüber im Klaren ist, daß es sich gar nicht außen vor stellen läßt. Man kann die Triebe einzig unterdrücken und auch die Organe einzig verwirren, jedoch ändert dies in keiner Weise etwas an deren Funktionalität, die nämlich gerade darin in keiner Weise veränderbar sind. Gerade darin besteht auch der elementare Unterschied gegenüber dem Körperlichen. Wir erfahren dies nicht nur im Altern, daß die mentalen Präsenzen nicht dem Körperlichen und somit auch nicht einem derartigen Gebrechen unterliegen, sondern einzig in seinem Verhältnis des Lebens gegenüber dem Tod. Hingegen bedingt es beidem der Ausbildung der jeweiligen Prägung und dessen Umsetzung, worüber es sich in seiner Ausfüllung gestaltet. Das Sexualwesen zeigt es uns unübersehbar und gar demonstrativ vor Augen, wie all dies funktioniert und stattfindet, wohingegen es in der Vielfalt der Gaben hingegen nicht derart in seiner Klarheit aufzeigbar ist, sodaß ich es gerade hierüber auch entsprechend mustergültig darlege, um die Sache und Prinzipien darüber zu vermitteln. Sachstand hierin ist, daß erst über die Gegenwart die Wiederherstellung des Regulären der gegebenen Funktionalität, über das entstandene Extrem der Gegenüberstellung der äußeren Sichtung, in Verbindung mit dem außen vor Stellen der Innerlichkeit, sich überhaupt diese Klarheit darüber erst ergibt. Hierüber entwickelte sich nämlich ein Kontrastreichtum, was es zuvor gar nicht gab und gerade dies verschafft einem überhaupt erst diese Klarheit darüber, wie es sich spezifisch im Bewußtsein verhält. Die Funktionalität und das koordinierte Einheitswirken sind es in sowohl als auch, worüber es sich gleichermaßen darlegt, zumal es das Wirkwesen ist, welches hierin das Wesentliche ist, worüber sich überhaupt die Funktionalität als solches repräsentiert, sodaß es sich somit auch als Parallele stellt, es im Nebeneinander gar zwangsläufig in Betracht zu ziehen, denn des einen Funktionalität kann sich gar nicht umsetzen, ohne des anderen funktionalen Präsenz. Das Organ(isations)konstrukt des Menschen ist ein Kollektiv.

Und so ist es auch die Sexualität, worüber es sich in aller Klarheit verdeutlicht, wie es sich damit in seinem dem entsprechend Umfangswesen verhält, worüber nämlich der gesamte Organismus involviert ist. So ist darin jedoch noch nicht einmal die gebildete Sprache das eigentliche Problem, sondern daß es gar keine Klarheit darüber gibt, was das Jeweilige überhaupt bezeichnet und sein soll. Gerade aus diesem Verhältnis heraus, bedingt es somit auch, zunächst einmal die Verhältnisse als solche zu fassen, welche sich als klare Gegebenheit erweisen. Und dies trifft man an, gemäß dem ich es über andere darlege, im Bezug auf die anatomischen Bildnisse der Geschlechtsorgane. Und damit meine ich die Bildnisse und dessen Beschreibungen, abseits der Festlegungen darüber, was es sei/repräsentiere. Das Sein zu (er)fassen bedingt primär, es gemäß seiner Erscheinung zu erfahren. Gemäß dieser Bildnisse zeigt sich, daß es sich bei den körperlichen Geschlechtsorganen um Gepräge handelt, welche aus der Einheit des Einen heraus hervorgehen, in der Ausbildung ihrer Differenziertheit männlicher und weiblicher Geschlechtsorgane. Man erfährt des weiteren darüber, daß sich 'regulär' eine Gesamtordnung von entweder oder ausbildet, indess es auch anders vorkommt, worin es sich auch regelrecht vermischt, inwiefern sich das Jeweilige als männliches oder weibliches Geschlechtsteilesorgan (der einzelnen Bestandteile darin) entwickelt. Jedoch gibt es hierin, gemäß des allgemeinen Verhältnisses der Prägung, diverse Varianzen an Ausgeprägtheit und Ausbildung, sodaß letztendlich auch kein Geschlechtsorgan tatsächlich dem einer anderen Person gleicht. Gleich vorweg somit auch das Wesentliche hierin, was im Anschluß auch seine Verbildlichung erfährt, in den beiden Bildnissen der Great Wall of Vagina und der Vagina von Sophia Wallace: um etwas 'als solches' zu spezifizieren und eine gewisse Klarheit darüber zu erlangen, bedingt es des Einen und klaren Bezuges, dem gegenüber gerade dieser jedoch nicht das Sein als solches darstellt, sondern sein Prinzip. Wie sich über dieses Bildnis wohl auch allgemein verdeutlicht, so gibt es die Gestalt der Vagina von Wallace tatsächlich in Natura nicht. Hingegen existierte jedoch auch ursprünglich gar kein derartiges klares Chemata, warum man es im geschichtlichen Verlauf der Ergründung auch derart antrifft, wie es sich darüber darlegt.

greatwallofvagina
» Great Wall of Vagina «
Sophia_Wallace.jpg
» Vagina Art by Sophia Wallace «

Mit dem bildlichen Erscheinen 'des Körperlichen' stellt es sich indess gleichermaßen, wie mit dem des Funktionswesen. Auch dies hat man in Erfahrung gebracht, nämlich über die physiologischen Gegebenheiten, worin nicht das Körperliche als solches (der Anatomen und Leichen), sondern das Wirkwesen die maßgebliche Inbetrachtziehung ist. Man achte auf diese gravierende substanzielle Unterscheidung. Das Erscheinungsbildnis des körperlichen Geschlechts (das Körperliche) ist eine Gegebenheit, hingegen das Hervortretende des Wirkens eine andere (das Physische), was jedoch im Verbund miteinander einher geht. Und nicht nur in der Differenzierung von Leben und Tod zeigt sich, daß es eine derartige unterschiedliche substanzielle Gegebenheit darin Inhalt sind, sondern auch das Leben führt es uns vor Augen. Denn ohne Wirkung findet nichts statt, indess wirkt der Mensch ohne Wirkungserscheinung leblos (Scheintote). Und das ist es auch, was sich somit hierin zunächst einmal unterscheidet, daß es hierin die Geschlechtsorgane 'als solches' gibt und ein Wirken der Geschlechtsorgane. Das es indess nicht die Geschlechtsorgane selbst sind, welche deren sexuellen Regung und Erregung erwirken, sondern darauf Einwirkendes, auch darüber hat sich die entsprechende Klarheit begründet. Indess erweist sich das WAS noch als völlig queer, was es mir zu verdeutlichen gilt, über die Gegebenheit des Extremfalles des Gegensatzes. Im Falle eines häßlichen und übelriechenden Homosexuellen, welcher einen stockgeraden Heterosexuellen geschlechtlich berührt, würde niemals eine positve sexuelle Reaktion seiner Geschlechtsorgane daraufhin erfolgen. Ich denke, dieses Muster legt es in seinem Kernwesen dar. Eine Berührung 'kann' das Geschlechtsorgan 'als solches' erregen, jedoch gibt es regulär gar nicht ein solches Isoliertes, sondern im Selbst und Gegenüber handelt es sich grundsätzlich um einen ganzen Menschen und gemäß dem findet auch generell eine Gesamtwirkung statt, in welchem das Geschlechtsorgan anteilig beteiligt ist, jedoch nicht das Initiierende. Darauf beruht auch die Unterscheidung, welche man dem gemäß erfährt, indem nämlich das Geschlechtswesen der Geschlechtsorgane für sich ein Eigenes und ein Eigenwirken ist, jedoch das sexuelle Wirken sich nicht daraus erwirkt, sondern aufgrund von Einwirkungen darauf und sich somit separiert. Somit gibt es auch keinen Geschlechtsakt, sondern es handelt sich dabei tatsächlich um einen Sexualakt, welcher auf der Geschlechtsvereinigung beruht. Diese Vereinigung kann nämlich auch gar nicht ohne die Involvierung der sexuellen Sinnlichkeit einher gehen (auch hier wiederum verdeutliche man es sich über den Gegensatz). Das zugrundeliegende Mißverhältnis basiert somit auch gerade darauf, daß man den Geschlechtsorganen die Sinnlichkeit zuschreibt, obwohl diese doch einzig Mittler sind und sich das Sinnliche tatsächlich über das Sexualwesen stattfindet, worin es seine entsprechende hinzukommende Reflektierung erfährt.

Ein wesentliches ist der Verlauf der Wirkungen. Man verdeutliche es sich über einen Reiz im Bein - zur Hervorhebung: ein Mückenstich. Man reagiert instinktiv darauf und erst hiernach setzt das Bewußtsein darüber ein, es als solches wahrzunehmen und bewußt darauf zu reagieren. Gerade der Reflex zeigt es, daß der Reiz der körperlichen Sinne zunächst zum Gehirn gelangt, hiernach zum Instinkt und erst dann gelangt es zum Bewußtsinn. Dies gilt für sämtliche Empfindungsreize, welche über die körperlichen Sinne stattfinden. Aufgrund dessen erfährt man auch grundsätzlich damit verbunden die Reflektionen, die kein reiner Reiz sind, sondern Gefühle im Verhältnis von Harmonie und Disharmonie. Verbunden ist dies mit dem (Er)Kennen des jeweiligen und dem reflektiven Beurteilen, gemäß dem es auf das Selbst wirkt. So bestimmt sich darüber aber auch das Erregungsverhältnis der Geschlechtsorgane, deren Reize zwar in diesen selbst erwirkt werden, der Vorgang jedoch darauf beruht, daß sie weitergeleitet und reflektiert werden. Der Reiz ist somit auch darin kein solcher, der isoliert darin stattfindet, sondern einzig im Bezugsverhältnis seines Verbundswesens. Im Gegensatz dazu, kann man indess auch eine sinnliche Reizung selbst erwirken, wie man weiß, über Gedankenspiele, wie überhaupt es gar nicht des körperlichen Kontaktes bedingt (auch nicht des eigenen), um ein solches Wirken stattfinden zu lassen. Lassen ist hierin indess das Wesentliche, denn der Geist bringt selbst keine Sinnlichkeit, Empfinden oder Gefühle hervor, da diese nämlich als solche gar nicht in die Erinnerung gelangen, sondern einzig Versinnbildlichungen dessen. Es ist somit auch die geistige Suggestion, welche solche Sinnesspiele erwirken. In dem Fall wirkt es nämlich umgekehrt, daß die daraus entstehenden reflektiven Reize zu den Geschlechtsorganen gelangen, worüber es sich entsprechend umsetzt. Diesbezüglich besteht ebenfalls ein Mißverhältnis, da man von einer Einseitigkeit der Leitung ausgeht, indess verdeutliche man sich über den Nulleiter des Stromkreises und den Blitz, der ohne Leitung sich vollzieht, wie es sich damit verhält. Wie soll auch anderes die Erregung der Geschlechtsorgane sich darin vollziehen, denn Gedankenübertragung gibt es hierin nicht. So wird darüber auch ersichtlich, daß es sich generell derart verhält, daß hierin nicht nur die Empfindungswahrnehmung reflektiert wird, sondern dies effektiv als Resonanz stattfindet, worüber sich nämlich auch die subsumierende Steigerung ergibt, indem nämlich das jeweils Reflektierende dem Bestehenden hinzugelangt. Vor allem die reine Suggestion verdeutlicht es.

Geschlechtsidentität ↔ sexuelle Identität (sexuelle Orientierung?)

In dem Bezug hat man bisher jedoch einzig den geistigen Bezug in Betracht gezogen, oder konkreter ausgedrückt, das Ermessungswesen auf diesen und das Geschlecht reduziert, was jedoch sämtliches Verhältniswesen einzig verwirrt. Hierbei handelt es sich nämlich um das Identitätsbewußtsein, welches Teil des Selbstbewußtseins ist, über das eigene Geschlechtswesen und dem Erfüllenden des Sexualwesens - inwiefern man dessen Präsenz und Wirken bewußt wahrnimmt und als was man dies bewußt und somit sein Selbst identifiziert. Zwar entstehen darüber auch geistige Bildnisse und Reflektionen daraus hervorgehend, jedoch wie generell, ist der Geist nicht das Begründende, sondern einzig das Projizierende. Was sich somit daraus ergibt, ist somit auch nachvollziehbar, denn eine Klarheit kann sich daraus in keiner Weise ergeben, sondern vielmehr verklärt dies Jegliches in das generelle Verhältniswesen der Infragestellung, worüber hinaus man darüber auch nicht gelangt. Kernpunkt dessen ist indess die mentale sexuelle Veranlagung und deren Wirkwesen im Bezug auf das eigene und vereinigende Geschlecht. Und darüber wird dann wiederum ersichtlich, daß es sich beim Eigenen zwar um das Geschlecht handelt, was der Bezug ist, jedoch nicht das Geschlecht es ist, woraus sich dies ergibt, hingegen jedoch beim Vereinenden es gar nicht primär das Geschlecht ist, sondern einzig sekundär. Es sind die sinnlichen Erfahrungen, welche dies vermitteln, indem das Jeweilige von der Veranlagung als solches reflektiert wird und daraus reflektiert hervortritt, wie es sich darin verhält. Genau so, wie beim Heterosexuellen gegenüber dem Homosexellen, stellt es sich generell, ob zum eigenen Geschlecht oder dem gegenüber nämlich dem Sexualwesen des Vereinenden. Tatsächlich hat nämlich das Verwirrwesen Jegliches durcheinander gebracht, vor allem nämlich den Sachstand, daß gar nicht das Geschlecht des Gegenüber das Ermessende darin ist, sondern das Gesinnungswesen! Gerade dies klärt sich wiederum über die Funktionalität und zwar in der Gegenüberstellung, indem nämlich weder eine heterosexuelle Frau mit einer homosexuellen Frau einen Verbund und auch die Umkehr gleiches darlegt, da es nämlich einander wiederspricht. Indess trifft man in den Inbetrachtziehungen einzig auf der einen Seite auf eine Deklaration und den Bezug einer Person, indess auf der anderen Seite einzig auf ein Geschlecht und darauf beruhen auch jegliche Händlingswesen darin. Das ein solches einzig Verwirrung und Unklarheiten schafft, erklärt sich indess von selbst.

Gemeinsamkeiten & Ergänzungen ↔ Widersprüche

Dies basiert jedoch auch auf der Markantz der mentalen sexuellen Veranlagung, die nämlich eine unserer Gaben sind, derer es der entsprechenden Ausbildung bedingt, sich die Markantz der Präsenz über die Ausprägung bestimmt, indess jedoch auch die Erfüllung darin steckt, obwohl als solches einzig der Trieb dazu das Wirkende ist. Genau dies ist jedoch auch der Ermessungsgegenstand, welche die Reflektionen der Gefühle erwirkt, worüber sich gerade diese Ermessung daraus ergibt. Und somit ergibt sich nämlich auch daraus der Sachstand, daß der Heterosexuelle den Homosexuellen ablehnt, da diese Erfüllungsbildnis bei diesem nicht besteht und sich somit bei diesem einen Widerspruchsverhältnis einstellt, worüber es sich reguliert. Ergibt sich indess ein positives Wirken, ergibt sich primär die Wahrscheinlichkeit der Passform, indess ist dieses Gefühl nicht das Einzige, welches in einem wirkt, sodaß es mit anderem auch gemeinsam einher geht und darüber ein Abwägen dessen stattfindet. Hingegen findet gerade dies einzig instinktiv, dies bedeutet, über den Instinkt und somit auch das Handlungswesen direkt geleitet statt. Das bewußte Verhältnis ist indess ein davon differenzierendes und findet funktional separiert im Überbewußtsein statt.

Widersprüche gibt es einzig in darstellenden Bildnissen, jedoch nicht in der Natur des Seins. Gerade darüber gelangt man auch zur eigentlichen Klärung jeglichem Daseinsverhältnis, denn gemäß der naturgegebenen Grundlage, worin es kein solches gibt, ergibt sich darüber auch die Substanz des Richten. Unser Instinktwesen ist dem gemäß eingerichtet und wie es sich damit verhält, erfahren wir über die Resonanzen der Gefühle. Gerade sie sind es auch, worüber sich die substanzielle Präsenz unserer mentalen Veranlagungen darlegen - darüber werden sie klar und offen, gemäß der Intensität ihrer Ausprägung ersichtlich. Jegliches Sinnliche, wird darüber reflektiert und gelangt hiernach auch zur Bewußtwerdung. Und insofern man diesem seine Aufmerksamkeit widmet, wird es darüber auch ersichtlich. Auch im Verbundswesen des Miteinander erfahren wir den Grundsatz dieser Funktionalität, gemäß dem sich darüber nicht nur unser Gemeinschaftwesen begründet und ausbildet, sondern jegliches Einheitswesen in der Natur des Seins. Gerade im Bezug auf die sexuelle Orientierung bildet dies somit auch den elementaren Grundstock, um die involvierten Gegebenheiten darin in aller Klarheit ersichtlich und in ihrem umsetzenden Werden sein zu lassen. Gerade dem gegenüber erweist sich in der Prägnanz der kulturellen Gegebenheit, tatsächlich jedoch als ein bedingendes loslassen, denn wie wir darüber prädestinierend erfahren, sind die sexuellen Belange nicht die Einzigen, deren Wirken man als solche erfährt, hingegen andere Belange sich dem gar entgegenstellen, die es diesen weitläufig gar von Grund auf verwehren, sich in dem umzusetzen, gemäß dem die Triebe es einem vermitteln, ihr Gestaltwesen zu verwirklichen. Und gerade hierin zeigt sich wiederum in aller Klarheit, daß es sich um Substanzwesen handelt, die aus dem Inneren des Körperlichen heraus hervorgehen, sodaß sich die Anwendung von Körperlichkeit tatsächlich auch als relativ stellt, rein aufgrund der Art der Inbetrachtziehung sich dies gebährt, hingegen man im Bezug auf das Gesamtwirken dies seine eigentliche substanzielle Präsenz erfährt. Jegliches reflektives Wirken entstammt voraussetzend einer Wirksubstanz, ohne das es nicht sein kann, wie überhaupt auch kein Wirken bestehen kann, ohne daß es aus einem Erwirkenden heraus hervor geht. Wie die Substanzwesen als solche darlegen, so erklärt sich darüber auch die Markantz der Unterscheidung des Naturganzen und dessen ausfüllende Inhaltlichkeit, in welcher diese das Vorausgehende ist und nicht das inhaltlich Resultierende, welches tatsächlich daraus hervor geht. Auch dies erfahren wir über unsere mentalen Veranlagungen, in welchen das Jeweilige sich als reguläre Präsenz zeigt und in der jeweiligen Gabe auch die Erfüllung dessen mit enthalten ist, ohne jedoch als solches zu sein. So ist auch die Inbetrachtziehung, wie man sie erfährt und ein Einzelnes 'als solches' in Betracht gezogen wird, in keiner Weise damit behaftet, aufzuzeigen, wie die Gegebenheiten sind, wie der Mensch sie erfährt.

Man achte hierzu einmal auf die Grundlagen der Chemie, worin dies ursprünglich noch die Ermessung war, um das Jeweilige zu identifizieren. Der Kern der Wesensart der präsenten Einheiten und dessen Wirkwesen hat man darin in aller Deutlichkeit erfahren. Indess hat man sich einzig auf die chemischen Bestandteile im Menschen bezogen, nicht auf die Natürlichkeit des Wirkwesens und den Grundsatz erkannt, welcher für jegliches Einheitswesen gilt, nicht nur dem Chemischen. Diese hat man indess durch die Physik ersetzt, da sie als solche angeblich der erforderlichen Ansprüche nicht genüge, sodaß ich selbst mich auch rein auf die klassische Chemie beziehe. Dies gilt auch für die Physik, worin in seinem Entstehen noch wahre Grundlagen geschaffen wurden, indess deren darüber hinausgehendes Erstreben dazu geführt hat, daß sie einzig noch aus Widersprüchlichkeiten besteht, zumal dieser die substanzielle Grundlage gar verlustigt gegangen ist, stellt sich dies als absolutes Relativa, worüber sie letztendlich jedoch auch die Natur des Seins repräsentiert, ohne jedoch das dazugehörige Verständnis. Die Philosophie indess bezeugt über ihr Präsentationswesen in aller Deutlichkeit, daß sie die Seele in ihrem Gesamtwesen tatsächlich gar nicht im Sinn haben, denn wie kann es sein, daß das Bewußtsein, welches ich aufzeige, bei diesen nur von einigen Wenigen und auch nur in Ansätzen überhaupt seine Erachtung findet. Es handelt sich hierbei um den Teil, den man auf direkte Weise über sein Innenleben erfährt und ist darin nicht grundlegender Sachstand der Erörterung? Es ergibt sich mir aus dem Verhältnis auch tatsächlich keinerlei Sinn, dies zu erörtern. Vielmehr berücksichtige ich Diejenigen, welchen es ihr Bemühen wert war, sich damit zu beschäftigen und Elementares darüber zutage brachten. Gerade hierüber wird nämlich auch deutlich, daß die Menschlichkeit einzig durch die Menschlichkeit selbst überhaupt zur Sichtung erlangt und gerade dies ist mir auch das Wesentliche, denn nur der Mensch, der menschlich handelt und menschlich ist, kann es tatsächlich auch erfahren, wie es ist. Man könnte hierin zwar mutmaßen, daß die Philosophen sich nicht generell damit beschäftigt haben, da sie sich nicht mit Krankheiten beschäftigen, wie der Arzt und Mediziner, jedoch muß ich gerade dies aus eigener Erfahrung wiederlegen, denn mein Ursprung basierte zwar auf dem Sachverhalt der Verwirrung und die Fragestellung einer (psychischen) Krankheit/Befallenheit hätte mir dabei in den Sinn kommen müssen, jedoch ergab sich dies erst gar nicht, da ich von Grund auf durchweg die Funktionalität der Menschlichkeit und somit auch die Gesundheit im Sinn habe und in dem Verhältnis ergründe, wie die Dinge und somit auch ich selbst funktioniere. Die Krankheit und der Mißstand sind auch in keiner Weise die Grundlage sinnhafter Beschäftigung, dem gegenüber man jedoch Derartiges erzeugt, um sich darüber zu nähren, in seiner geistigen Beschäftigung. So haben sich die Philosophen dem entsprechend, im Grund auch tatsächlich auch einzig mit dem Geiste beschäftigt, dem gegenüber sich alles andere einzig als Erfüllungsgegenstand ergab. Man übersetzt dessen Benennung schließlich auch nicht umsonst, als 'die Weisheit Suchende'.

Man kann eine Frage nur stellen, wenn man die Antwort kennt

Im Bezug auf das Substanzwesen, hat man erkannt, daß aus Nichts nichts werden kann und kein Nichts existiert, indess das, was man als Einheiten antrifft, auf dem Wandel beruht und weiter nichts. Die Grundlage dazu hatte ich über die Infragestellung erfahren, worin es zwar der 10 Jahre bedingte, um es daraus zu ersehen, es sich jedoch darin nicht anders verhält, denn darüber zeigt sich das substanzielle Grundlagenverhältnis. Die Erfahrung hatte mich gelehrt, daß ich mich darin einzig im Kreise drehe, indess auch im Verhältnis zum Erlangen reiner Ansätze einzelner Antworten, in der Zwischenzeit und gerade darüber, eine Vielzahl weiterer Fragen sich mir ergaben. Und so wendete ich mich auch striktweg davon ab, indess erkannte ich dabei jedoch auch, daß der Großteil meiner Kenntnisse gar nicht auf meinen eigenen Erfahrungen beruht und gerade diese es sind, welche mich in die Situation der Verwirrung überhaupt gebracht hatten. Tatsächlich führen die reinen Fragen nämlich auch zur reinen Vergeistigung, worüber gerade die Fragestellungen erwirkt werden, die es gar nicht gibt. Und somit repräsentiert auch gerade dies nicht die Realität, worüber man indess gänzlich davon abkommt, diese als solche zu ersehen, da darin keine realisieren Verhältnisse bestehen. Es steckt so vieles gar in unserer Sprache drin, wie auch das zugrunde liegenden Bildungswesen von ersehen ↔ verstehen, was mir folglich auch zum Grundsatz wurde, einzig noch darüber meine Ergründung des Seins fortzusetzen und alles außen vor zu stellen und zu separieren, was dem nicht entspricht. Wie sich zwischenzeitlich zeigt, liegt gerade auch darin die Schwierigkeit der Vermittlung dessen an andere, da man es nämlich gar nicht mehr derart anwendet, sondern einzig noch gemäß vorgegebener Bildnisse von anderen überhaupt das Dasein in Betracht zieht. Dies betrifft nicht nur den Menschen als Person, sondern vor allem sämtliche Fachschaften, die es gibt. Und gerade darin zeigt sich, daß man dort auch gar nicht hinein gelangt, ohne es derart zu handhaben. Im Gegenteil, man steht, insofern man sein eigenes Sichten nicht ablegt, dem gegenüber gar bereits vom Grundsatz heraus außen vor. So gilt es mir an dieser Stelle auch einmal hervorzuheben, daß mein Substanzwesen gänzlich auf meinem Selbst sich begründet und es mir vor allem darüber zu demonstrieren gilt, daß die Substanz des Selbst in keiner Weise von dem Erbe abhängig ist, was man von anderen erhält, sondern im Gegenteil sogar, man über ein eigenes Erbe verfügt, welches sich man nämlich einzig in seiner Grundlage, jedoch nicht in seiner Prägung erhält, sodaß sich darüber jedoch die Grundlage ergibt, von dem erhaltenden Erbe 'in dem Bezug' gänzlich unabhängig zu sein. Wie sich über das Sexualwesen demonstrativ darlegt, bedingt es gar weitläuf der bedingenden Abkehr von dem erhaltenden Erbe, nämlich darin, da es in seinem Substanzwesen als solches gar nicht gegeben ist, dem zu entsprechen, was man darin ideologisierenderweise erwartet. Im Gegenteil sogar, führt gerade dies weiträumig zur Behinderung, wenn man bedenkt, wie über wie viele Arten von Gaben man verfügt, die allesamt dem entsprechen, wie man es bezüglich der Ausgestaltung der Prägung der Männlichen und Weiblichen, wie auch der sexuellen Orientierungen antrifft. Nicht umsonst finden somit auch kulturell beständige Umstürze statt, die auf nichts anderes beruhen, als auf dem Wandel der Gegebenheiten darin, dem gegenüber man vehement daran festhält, seine substanziellen Umsetzung zu verwahren. Das man somit auch den Instinkt des Menschen systematisch außen vor stellt, hängt somit nicht daran, daß es 'das Tier' repräsentiert, sondern dessen veranlagungsgegenen Geprägen der Triebe, die man jedoch in ihrer Substanz weder entfernen, noch operieren kann, sondern einzig unterdrücken. Inwiefern sie sich indess tatsächlich unterdrücken kann, erfährt ein Jeder an sich selbst.

Die Sprache ist dafür nicht eingerichtet, die Dinge im erforderlichen Maße und eindeutig klar zu deklarieren und außer dem Bewußtsinn, worin ich keinerlei Bezüge dazu fand (das Verhältnis des Inneren Sinns von Aristoteles wurde mir erst später bekannt) und ich aus dem Grund auch eine eigene Bezeichnung dafür geschaffen habe, wie auch für die Spezifikation der bisexuellen Dritten und die Pondants, bewahre ich bisher ganz bewußt noch die Bezeichnungen, die als Gegebenheit vorhanden sind. Und da sich doch gerade die substanziellen Wesensarten, gemäß der Erinnerung, einzig über ihr inhaltliches Hervortreten als solches erfahrbar und faßbar sind, ergibt sich mir die sachliche Bezeichnung des Jeweiligen auch aus dem heraus als entsprechende Passform und passende Anwendung. Da man das Substanzwesen hierin derart bisher auch noch gar nicht derart, in diesem Zusammenhang spezifiziert hat, ergibt sich jedoch auch aus dem Verhältnis heraus an sich keine sonderliche Problematik. Hingegen findet es tatsächlich jedoch auch seine Anwendung derart, woher die Bezeichnung ja auch stammen, ohne es jedoch als solches zu handhaben, wie ich es gar dem entsprechend darlege. Was das Körperwesen im Bezug auf das Geschlecht betrifft, so hat man hierin gar eine herausragendes Deklarationswesen geschaffen, welches ich dem gemäß auch anwende. Tatsächlich kompliziert wird es indess in den Verhältniswesen des Substanz- und Funktionswesen des Geistes, der Seele und dem Gehirn, dem gegenüber sich nämlich ganz andere Grundlagenwesen darlegen, als man darin auch nur im Ansatz findet, hingegen jedoch diesen alles möglich zuordnet, was gar nicht dem zugehörig ist. Gerade darüber vermischt sich nämlich all das Substanzwesen, welches in seiner Eigenständigkeit präsent ist und somit auch sich einzig sachlich darlegen läßt, denn es liegt mir in keiner Weise im Sinne, diese Deklarationen zu ändern, denn darauf basieren nicht die Verfälschungen, sondern was man dem Jeweiligen zuordnet zu sein. So ist der Geist tatsächlich einzig das Organ, worin die Projektionen aus der Erinnerung in Erscheinung treten und darin besteht auch seine einzige Funktionalität. Das ich mich in meinen Beschreibung teilweise auch auf 'geistige Entscheidungen' beziehe, findet einzig statt, im Verhältnis zu dem Bezug, in dem ich dies aufbringe. Tatsächlich findet indess doch gar keine Entscheidung im Geiste statt, sondern das Wirkwesen dessen beruht auf der bewußten Wahrnehmung der Erscheinungen darin. Und auch gelangt gerade dies eben nicht zur Umsetzung, sondern repräsentiert einzig den sogenannten geistigen Willen, dem gegenüber es das instinktive (V)Erlangen ist, worüber die Umsetzungen stattfinden oder nicht. In den Bezügen von Geist, Seele und Gehirn, ist einfach alles durcheinander, sodaß es mir auch nicht im Sinne liegt, dieses Durcheinander als solches aufzuklären, sondern dem gegenüber die Funktionalitäten der diversen mentalen Organe erläutere, worüber es sich als solches klärt, wie es sich damit verhält. Und an sich ist auch klar und stellt sich auch an sich nirgends in Frage, daß ein jeweiliges Aufbringen auch mit seinem Gesamtwesen zusammenhängt, sodaß somit auch die stattfindende Anwendung der sexuellen Identität, Geschlechtsidentität und sexuelle Orientierung sich auch als eindeutig stellt, daß gerade darin die mentale Veranlagung als solche gar nicht beinhaltet ist, sondern aus dem Wissenschaftsverhältnis als rein geistige Orientierung stellt - und zwar sowohl beim Selbst, wie auch beim Gegenüber. Wesentlich hierin ist somit auch vielmehr, inwiefern das Substanzwesen des Bewußtseins überhaupt seine Erachtung findet, denn darüber findet sich überhaupt einzig die Klarheit, die sich darüber darbietet und die Widersprüchlichkeiten, sowohl bezüglich dessen, wie auch des Abseitigen dessen klärt.

Zum Entwicklungswesen gibt es jedoch ebenfalls das Substanzwesen zu (er)klären. Gerade was den kulturellen Werdegang betrifft, so gilt es hierin zu bedenken, daß das Substanzwesen, mit dem wir uns gemäß meiner Ausführung in seiner Einbindung, Bezugnahme und Gegenüberstellung beschäftigen, sich als ein rein Philosophisches, Theosophisches und Wissenschaftliches stellt. Des Menschen persönlichen (Er)Kenntnisse erfahren gerade darin ein gänzliches außen vor stellen, worüber auch speziell dieses Mißwesen entstand. Da gerade die rein persönlichen (Er)Kenntnisse der Menschen als solche, jedoch nur indirekt darstellbar sind, findet das Meinige auch regelrecht als eine Gegendarstellung statt, über welche es zu verdeutlichen gilt, daß es des Substanzwesen 'als solches' gar nicht des Verständnisses bedingt, sondern einzig des Verhältnisses, aus dem Ersehen zu Verstehen und vielmehr die Grundlagen des Verständnisses, welches man dem gegenüber aufbringt, tatsächlich einerseits auf Ausschnitten an Übernahmen aus dem Personellen beruhen, andererseits jedoch regelrecht auf dem Nichts, welches man darin zu erfüllen sucht. Dies repräsentiert in keiner Weise des Menschen evolutionäre Präsenz und dessen zugrundeliegenden Erfahrungen und (Er)Kenntnisse, vielmehr gehen diese ihm dadurch verloren, wie es mir über die gegebene Thematik, gemäß des gravierenden Stattfindens, entsprechend zu vermitteln gilt. Aus dem Grund trifft man auch auf eine unendliche Zahl an darstellenden Berichten, welche im Grunde nichts anderes darstellen, als die Suche und das Ersuchen nach Erfüllung darin, sodaß tatsächlich nur ein geringer Bruchteil überhaupt es wert ist, ermessen zu werden und zwar gemäß seiner Präsenz gegenüber des Menschen evolutionärer und kultureller Substanz darin. Wer die diversen 'Entwicklungstendenzen' ersichtet hat, wird gerade darüber erfahren, daß man nicht nur in der Medizin, von heute auf morgen völlig anderes antrifft, worüber man das Dasein beschreibt, was gar noch viel gravierender ist, da es das jeweilige bestandende Substanzverhältnis gänzlich auf den Kopf stellt und somit bei den Menschen nicht nur noch mehr Verwirrung stiftet, als daß gerade dies zur Aufklärung förderlich ist, sondern gar vernichtet, was Gegebenheit ist. So ist mein Blick auch tatsächlich gar nicht darauf gerichtet, sondern auf des Menschen evolutionären und kulturellen Substanz an Präsenz, worin mein Aufbringen nämlich gerade das hervorbringt, was diesem über dieses Mißverhältnis verloren gegangen ist. Nicht der Geist ist es, den es mir zu be- und erfüllen gilt, sondern das Sinneswesen, welches den Menschen zu dem macht und erfüllt, was er ist. Der Geist ist funktional einzig ein zusätzliches Instrument, dem gemäß es als solches zu nutzen gilt - und zwar nur als solches. Zwar kann man über die Schriftsprache die Sinne nicht direkt ansprechen, jedoch ist mein Ansprechpartner auch nicht der Geist, sondern das Bewußtsein, was jedem klar wird, der die Unterscheidung kennt und handhabt und sich darüber mit dem Meinigen beschäftigt. Und somit ergibt sich darüber auch die Hinleitung zu den Sinneswesen. Maßgeblich ist hierin vor allem auch, was man gar über die Ermessung des (tierischen!) Instinktes an Kenntnis geschaffen hat, daß nämlich das Instintive und Triebhafte und somit das, was ich als mentale Veranlagung beschreibe, in seinem Ursprunge, auf den erlebten Erfahrungen beruht und sich daraus begründete. Man möge sich gerade dieses Substanzverhältnis vor Augen führen, um sich klar zu werden darüber, was es bedeutet, dies außen vor zu stellen und gar beseitigen zu wollen. Dies ist zwar ein Ding der Unmöglichkeit und man kann es einzig unterdrücken und nicht mehr beseitigen, jedoch Sachstand des stattfindenden Ermessungswesens. Dies erweist sich gar als Kernfrage menschlichem Daseins und zwar nicht rein aus der Gegenwart heraus, sondern in einem sich immer weiter ausbreitenden Maße, dessen Ursprung hierin auch gar nicht mehr als wesentlich erscheint, sondern einzig der Gegenstand der substanziellen Präsenz dessen.

So gilt es vor allem jedoch auch, die jeweilige Strukturwesen zum Substanzverhältnis zu achten. Während sich in den Wissenschaften rein fragmentarische Ausschnittswesen des Daseinswesens begründeteten, worin gar die einen Fachbereiche mit den Anderen zu kommunizieren, überhaupt nicht mehr in der Lage sind, so bilden sich in jeglichem Verhältnis gar derartig gravierende Differenzen substanzieller Wesensarten, worin das Eine in keiner Weise mehr mit dem Anderen überhaupt noch etwas zu tun hat. Zumal es sich darüber hinaus gehend, nicht nur auch der Wissenschaft gegenüber der Philosophie sich derart verhält, sondern besonders gravierend zwischen Wissenschaft und Glauben. Eine derartige sustanzielle Differenzierung ist wahrlich schon in seinem Grundsatz unabdingbar, jedoch gibt es keinen Menschen ohne Glauben. Hierin beruht die beiderseitige Ausgrenzung jedoch auf den Menschen, welche dies erfüllen und darüber sich die Trennung ergibt. vor allem ist das Kirchenwesen nicht der Glaube, sondern diese repräsentieren diesen zumal das Kirchenwesen Grundlagen geschaffen hat, die man doch gar nicht außen vor stellen kann, da dies vor allem auch die ethischen Grundlagen betrifft. die Anderen zu ermahnen wissen, wie man es zwischenzeitlich auch bezüglich des Sexualwesens über die Sozialwissenschaft gegenüber dem Medizinwesen erfährt, indess gerade diese systematische Abgrenzungen ein gravierendes Mißwesen erwirken . Gravierender ist jedoch überhaupt der jeweilige Ausschluß geworden, herausragend auch das Verhältnis gegenüber dem Glaubenswesen, welches darin einzig zu Studien erscheinen, jedoch als solches in dem Grundlagenwesen gar ebenfalls ins Abseits gestellt wird. Gerade der Glaube ist gleichermaßen nichts anderes als eine natürliche Gegebenheit menschlichem Daseins, welche man gemäß der Veranlagungen gar nicht außen vor stellen kann. Darauf beruht es auch, daß im Verlaufe das Selbstbewußtsein des Menschen tatsächlich eine positive Veränderung erfahren hat, da nämlich trotz dessen man sein Selbst doch außen vor zu stellen sucht, überhaupt über die stattfindende Aktiva es gerade auch angesprochen wird und dies einzig unbewußt stattfindet, jedoch das Bewußtsein fördert.

Bolten.jpg


Verlag: Carl Hermann Hemmerde
» «

Man müßte die Natur des Menschen wenig kennen, wenn man nicht wissen sollte, wie genau die Kranckheiten der Seele mit denen Kranckheiten des Körpers verbunden sind, und umgekehrt. Eine Krankheit des Körpers curieren, ohne zugleich der Seele zu Hülfe zu kommen, ist eben so eine vergebliche Bemühung, als das Ebenbild eines häßlichen Gesichtes in einem aufrichtigen Spiegel verbessern wollen, ohne sich zu bemühen, das Urbild schöner zu machen. Ich klage, wie mir deucht, mit Grunde darüber, daß weder die Prediger noch Aerzte, wenn sie denen Krancken beistehen sollen, diesen Betrachtungen gemäs sich aufführen. Ich rede von dem größten Theile beider Partheien. Wie selten denckt ein Arzt daran, daß seine Kunst etwas mehr erfordere, als was ein guter Uhrmacher wissen mus. Wie selten läßt ersich sich einfallen, der Seele zu Hülfe zu kommen, die öfters einer Cur mehr benöthiget ist, als der Körper. Ja, wie oft wundert er sich, wenn in manchen Fällen seine Arzneien, wie es ihm scheint, ganz zufälliger Weise die Seele von einer Kranckheit befreien, welche von der Kranckheit des Körpers herrühret. Ein freundlicher Zuspruch, eine mit untergemischte Moral, und die regelmäßige Hervorbringung gewisser Leidenschaften sollte ohne Zweifel in tausend Fällen eben so erwünschte Würckungen thun, als die kostbarsten Arzneien kaum vermögen, wenn sich nur ein Arzt des menschlichen Herzens anzunehmen beliebte, und die Kunst lernen wollte, so wol Sturm als Stille in ihm hervorzubringen. Die meisten Aerzte, besonders diejenigen, welche im Ruf stehen, durch vieler Jahre Erfarung besonders geschickt zu seyn, gewöhnen sich so finstre Gesichter an, daß ihnen ihre Minen zum Feldzeichen dienen können, daran man ihre Handthierung erkennen kan. Ein Patient, der einen solchen hocherfarnen Mann das erste Mahl siehet, müste sehr gesezt seyn, wenn ihm nicht die magischen Bilder eines Bleigiessers und Blasenstechers in die Gedancken kommen solten. Die Prediger, welche die Kunst am besten verstehen solten, die Seelen derer Krancken zu heilen, und deren Beruf es eigentlich erfordert, diese Verrichtung über sich zu nehmen, sind fast gröstentheils ungeschickt, dieselbe gehörig auszuüben. Jeder einzelner Mensch erfordert eine besondere Ausführung, und ohne vorher den Zustand seines Gemüthes erforscht zu haben, ist es nur ein blindes Glück, wenn die Besuche gute Würckungen thun. Die mehresten Geistlichen gewöhnen sich gewisse Formeln an, die sie bei allen Kranckenbetten hersagen, ohne eine andere Krafft der Seele dabei zu gebrauchen, als das Gedächtnis. Mit leichter Mühe könnten sie, eben so wie der Arzneigelehrte thun mus, durch wenige Fragen, den Gemüthszustand des Patienten entdecken, und einige Fertigkeit, die ästherischen Regeln anzuwenden, die Gemüther in Bewegung sezzen, nebst einer gesunden und christlichen Moral würden hinreichend seyn, ihnen das Verfahren an die Hand zu geben, so sie bei ihren Patienten zu beobachten hätten. Allein, eine Wissenschaft, wie die Aesthetick ist, daraus man eben so wol lernen kan, eine Anakreontische Ode zu machen, als Gemüthskranckheiten zu curieren, würde vielleicht manchen Geistlichen viel zu fleischlich und zu weltlich scheinen, als daß er sie nur in seiner Bibliothek leiden solte, vielweniger sich zu bemühen in Ausübung derselben eine Ferigkeit zu erhalten. Gleichwol ist nichts gewisser, als daß alle diese Sachen nothwendig erfordert werden, wenn man auf eine vernünftige Art psychologisch curieren will. Die allermeisten Arzneigelehrte und Geistliche sehen diese Nothwendigkeit ganz und gar nicht ein, wenige gestehen zu, daß die Aesthetick, die Logick, die philosophische Pathologie und Moral in manchen Fällen nützlich, und als Galanterien mitzunehmen wären. Ich habe geglaubet, diesen Leuten einen Dienst zu erweisen, wenn ich ihnen theils die Nützlichkeit und Nothwendigkeit derer psychologischen Curen auch bei solchen Patienten zeigte, die Kranckheiten des Körpers haben, und ihnen Anleitung gäbe, wie sie sich durch Erlernung solcher Curen dem menschlichen Geschlechte nüzzlich machen könten. Dieses ist die Absicht, die ich zu erreichen wünsche, und meine Leser mögen beurtheilen, ob diese Schrift geschickt sey, diesen Nutzen zu würcken.
Geschrieben auf der Friedrichsuniversität den 9. July 1750.

§ 8 - Die Metaphysik lehret uns, daß zwischen der Seele und ihrem Körper die allergenaueste Harmonie obwalte. Vermöge dieser Harmonie wird dargethan, daß der hinreichende Grund einer Veränderung, welche in dem Körper vorgehet, so wol in dem Körper selbst, als auch in der in ihm wohnenden Seele müsse gesuchet werden, und so auch umgekehrt. Eine Kranckheit der Seele mus also auch ihren hinreichenden Grund in ihrem Körper haben. Da nun aber der Gesundheitszustand nimmermehr der Grund einer Kranckheit seyn kan; so wird bei einer Gemüthskranckheit der Körper der Körper kranck seyn müssen, und so auch umgekehrt. So viel ist indessen doch gewis, daß entweder in der Seele oder in dem Körper der erste Ursprung einer Kranckheit werde gesuchet werden müssen. Diese beiden Fälle sind also nur bei der Seele möglich. Entweder sie ist kranck, weil der Körper ungesund ist, oder in ihr lieget der erste Grund ihrer Kranckheit. Hieraus mag man ersehen, wie vielerlei Arten der Seelencuren möglich sind. Es ist offenbar, daß wenn die erste Ursache der Kranckheit in dem Körper ihren Sizz hat, die hiermit leidende Seele durch die Wiedergenesung des Körpers, wieder hergestellet werde. Solchergestalt ist klar, wie man die Seele durch Arnzeimittel curieren könne.

Divider


Von der Geschichte der geistigen Seelenkur zur psychologischen Kur
Verlag: Wilhelm Fink
Hrsg.: Wolgang Findte und Matthias John

Zur Geschichte welcher Wissenschaft gehört denn überhaupt die Geschichte der psychotherapeutischen Behandlungsvorstellungen? Wohl nicht ganz zur Psychologiegeschichte, auch nicht vollständig zur in die Medizingeschichte fallenden Psychiatriegeschichte. Und die doch immerhin einigermaßen populäre Geschichte der Psychoanalyse fokussiert naturgemäß die Psychoanalyse und die zu Vorläufern erklärten mesmeristischen und hypnotherapeutischen Konzepte.

André Knote hat es in seiner Studie entsprechend seiner These, daß der Begriff der "Psychologischen Kur" (Bolten, Halle 1752) von der "Geistlichen Seelenkur" inspiriert sei zunächst vor allem mit der protestantischen und pietistischen Theologie zu tun, die zu jener Zeit an diesem Ort vorwaltete und man könnte das Kapitel zwei und drei seiner Arbeit, das die Zuständigkeiten für das Seelenheil und die Entwicklung der protestantischen Seelsorge von Luther bis zum Streit der Pietisten mit Thomasius umreißt und materialreich exemplifiziert mit Recht als eine theologiehistorische Abhandlung ansehen, eine Spezialuntersuchung zur Geschichte der Seelsorge mit dem Ergebnis, daß es hier eine Entwicklung von der cura animarum hin zur cura animae und also hin zur Sorge um die einzelne Seele gegeben hat. Dies ist zugleich ein Stück Pietismusforschung und differenziert die in der Literatur manchmal etwas pauschal geäußerte These, daß der Pietismus durch die Individualisierung und Selbstbefragung die Psychologie der Aufklärung, insbesondere deren angewandte Seite präformiert hätte.


Verlag: Breitkopf und Härtel
» «

In einer Zeit, wo die Städte Deutschlands den Repräsentanten der Naturwissenschaft alljährlich wetteifernd die Thore öffnen, wo Hohe und Niedere den öffentlichen Versammlungen der Naturforscher zuströmen und die neu erworbenen Schätze mit Enthusiasmus begrüßen, in einer solchen Zeit muß man sich wundern, wie die Physiologie, beinah die wichtigste aller Naturwissenschaften, dem gebildeten Theile unsers Volkes fremd bleiben konnte. Die Kenntniß der Mineralien, der Pflanzen und der Thiere, selbst der unendlich entfernten Himmelskörper, beschränkt sich nicht mehr auf den kleinen Kreis gelehrter Forscher, sondern gebildete Männer aller Stände schließen sich jenen mit rühmlichem Eifer an; nur die Bekanntschaft mit dem Organismus des Menschen ist noch das Eigenthum einer Kaste. Es scheint also die Ansicht zu herrschen, daß die Anatomie und Physiologie jene Elemente entbehren, welche noch außerhalb des Kreises der Fachgelehrten von Interesse und Bedeutung sind. Und doch ist leicht nachzuweisen, daß die Lehre vom menschlichen Organismus vorzugsweise geeignet ist, die Ansprüche zu befriedigen, mit welhem ein gebildeter Geist das Studium der Natur aufnimmt. Der Mensch ist der Mikrokosmos; sein Leib ist nicht bloß menschlicher Leib, sondern Thierleib und Pflanzenleib, er ist Erde, Wasser und Luft zugleich, alle Erscheinungen der Welt im Großen kehren in ihm wieder, alle Gesetze, welche die Natur regieren, finden in ihm ihre Anwendung. Die Naturlehre des Menschen bietet das im Ganzen, was jeder andre Zweig der Naturwissenschaft als abgerissenen Theil bietet. Wer also im Drange nach Universalität das Buch der Natur aufschlägt, der wird die Zeichen, welche das menschliche Leben schildern, vor allen zu betrachten haben.


Die Lehre von dem Baue und dem Leben des menschlichen Leibes
Verlag: Johann Leonhard Schrag
» «

§ 1 - Das Selbstbewußtseyn als Grund aller Wissenschaft

Der Grund jeder Wissenschaft kann und darf nur aus der Erfahrung und innigsten Überzeugung des Einzelnen und aller, sich ihrer selbst wahrhaft bewußten, Menschen, also aus dem Bewußtseyn der Menschheit überhaupt hergenommen werden.

Die erste und ubestreitbarste aller Erfahrungen ist die des Selbstbewußtseyns im Menschen oder des Wissens um das Seyn unserer selbst, ausgedrückt in dem Grundsatze:
1) Ich weiß, daß ich bin.
Doch der Mensch steht nicht nicht allein: das Selbstbewußtsein schließt zugleich das Bewußtseyn des Menschen von ihm gegenüberstehenden und von ihm unterschiedenen Dingen ein. An diesen Grundsatz schließt sich daher unmittelbar und nothwendig ein anderer Grundsatz:
2) Ich weiß, daß außer mir noch andere Dinge sind.
Das Selbstbewußtseyn ist innigst an das Bewußtseyn anderer Dinge geknüpft. Nur dadurch, daß wir die anderen Dinge als seyend wissen, wissen wir um unser eigenes Seyn, und in dem Gegensatze beyder Seyn als im Ich sich abspielend ist die Unterscheidung des Seyns gesetzt. Sobald wir uns der andern Dinge nicht mehr bewußt sind, hört auch unser Selbstbewußtseyn auf, wie im Schlafe, in der Ohnmacht eg.

§ 2 - Körper und Geist

Das an das Selbstbewußtseyn sich anschließende Bewußtsein des Seyns von Dingen außer uns und im Gegensatze mit uns schließt selbst wiederum das Bewußtseyn eines Gegensatzes dieser Dinge unter sich und gegen uns in sich, wodurch wir uns eines unmittelbaren Unterschieds derselben bewußt sind: das Bewußtseyn der Körperwelt, und das der Geisteswelt, so daß in obigem zweyten Grundsatze die zwey Folgesätze enthalten sind:
a) Ich weiß, daß außer mir Dinge sind, die wir Körper nennen.
b) Ich weiß, daß außer mir Dinge sind, die wir Geister nennen.
Anmerkung: Welt ist der Inbegriff aller Dinge ohne Unterschied. Nach dem bezeichneten Gegensatze der Dinge außer uns unterscheiden wir eine Körperwelt und Geisteswelt.

Selbst der Mensch kann nach dieser Unterscheidung in doppelter Hinsicht betrachtet werde, wie wir in der Folge zeigen werden. Die Gegenstände, welche wir in der Folge zeigen werden. Die Gegenstände, welche wir mit unseren äußeren leiblichen Sinnen wahrnehmen nennen wir Körper, und den Inbegriff derselben Körperwelt. die Gegenstände, welche der Mensch mit seinen leiblichen Sinnen nicht empfindet, aberdoch durch eine innere Kraft wahrnimmt, nennt er geistige Wesen, ihren Inbegriff Geisteswelt. In sofern die Körper als stets außerhalb unseres eigenen Seyns mit den leidlichen Sinnen, die wir auch äußere nennen, wahrgenommen werden, hat man die Körperwelt auch Außenwelt genannt. Im Gegensatz mit letzterer nennt man die Geisteswelt daher Innenwelt. Da man ferner die Körperwelt als in steter Unruhe und Verwandlung begriffen, die Geisteswelt aber als beharrlich und unwandelbar erkannt hat, so legte der Mesch letzterer einen höheren Werth bey, und ertheilte ihr die Benennung höhere Welt; der Körperwelt dagegen den Namen der niedern Welt.


seit dem Ende des siebzehnten Jahrhunderts - Teil 2
Verlag: Wilhelm Engelmann
» «

Homologien und Analogien

Die Botaniker erfanden für die Ähnlichkeiten der Pflanzenorgane den Namen Metamorphose, die Zoologen nannten sie Homologien und Analogien. Der Vorgänger Cuviers, der französische Anatom F. Vicq d'Azyr (1748 - 1794) machte bereits auf die Ähnlichkeiten, einmal unter den Organen verschiedener Tiere (z. B. zwischen der menschlichen Hand und dem Pferdefuß) und dann unter verschiedenen Teilen eines und desselben Tieres (z. B. zwischen der menschlichen Hand und dem menschlichen Fuß) aufmerksam. G. Cuvier erweiterte diesen Gedanken durch eine neue Lehre: der Bau einzelner Organe hängt von der Lebensweise des Tieres ab, der Bau anderer jedoch von der inneren Organisation; so hängen die scharfen Zähne und Klauen und das leichte Skelett eines Raubtieres offenbar mit seiner Lebensweise zusammen, während die Zweihufigkeit der Wiederkäuer nicht aus der Art, wie sie die Nahrung aufnehmen, erklärt werden kann - es müssen irgendwelche innere Verhältnisse im Bau des Tieres die Anzahl seiner Zehen bestimmen. Cuvier blieb bei dem Hinweis auf diesen Unterschied, ohne ihn weiter zu analysieren.

Eine gründlichere Analyse der Analogien geht den Physiologen an; da jedoch die Zeit, als Owen wirkte, physiologischen Untersuchungen nicht günstig war, blieb Owen bei der allgemeinen Bestimmung des Begriffes der Analogie, und da die spätere Zeit überhaupt den Sinn für solche begriffliche Analysen verlor, ist bis auf den heutigen Tag der Begriff der Analogie nicht gründlicher analysiert worden, obwohl es gewiß der Mühe wert wäre, die tierischen Analogien zu klassifizieren und nach dieser Seite hin unsere Kenntnisse vom Leben zu vertiefen.

Owen untersuchte jedoch näher den Begriff der Homologie und unterschied innerhalb desselben: spezielle Homologie, welche in einer Ähnlichkeit der Teile verschiedener Tiere besteht (der Fuß des Pferdes und des Vogels); ferner allgemeine Homologie, welche die Beziehung eines Teiles zu einem allgemeinen Typus bedeutet (so ist z. B. die menschliche Hand die vordere Extremität der Säugetiere). Endlich unterschied er Homotypien: Teile, welche denselben Plan auf demselben Individuum wiederholen (z. B. die Segmente der Ringelwürmer, die vordere und hintere Extremität der Wirbeltiere).

Owens Klassifikation der strukturellen Ähnlichkeiten wurde auch von den Darwinisten angenommen; E. Haeckkl und C. Gegenbaur nahmen sie nur mit kleinen Änderungen in ihre genetische Morphologie auf, obwohl sie den Grundunterschied zwischen den Homologien und Analogien zu verwischen versuchten. E. Hakckel') teilt die Homotypien noch in Homodynamien (Homologien der Segmente längs der Körperachse) und Homonomien (Homologien der Teile, welche senkrecht zur Körperachse liegen, wie Schenkel, Schienbein usw.).

Agassiz unterschied folgende Ähnlichkeiten:

1. Embryonale Typen deuten einen Gedanken an, welcher sich in der Zukunft vollkommener entwickeln wird; die ausgestorbenen mehrzehigen Pferde sind ein Beispiel.

2. Hypembryonale Typen sind solche, bei welchen sich im Übermaß Eigenschaften entwickeln, welche anderswo nur angedeutet vorkommen; die Haut des Fledermausflügels gehört hierher, welche nur eine monströs entwickelte Haut darstellt, die in rudimentärem Zustande auch zwischen den Fingern der übrigen Säuger vorkommt. Die embryonalen und hypembryonalen Typen Agassiz' entsprechen den Homologien Owens.

3. Prophetische Typen sind Owens Analogien: Ichthyosaurier prophezeien z. B, unsere Delphine, fleischfressende Saurier unsere Raubtiere usf.

Diese Philosophie Agassiz' blieb ohne Wirkung auf die Nachwelt; es würde wohl der Mühe wert gewesen sein, zu untersuchen, welche Tiere und worin sie prophetisch, embryonal, hypembryonal sind, allein Agassiz selbst führte seine Gedanken nur im allgemeinen aus, unter Anführung nur einiger Beispiele; auch erschienen seine Ansichten zu einer Zeit, als die Morphologie bereits ihren Zenith überschritten hatte; einige Monate nach seinem Essay erschien das Werk Darwins, welches wohl ganz andere Anschauungen brachte als diejenige war, daß die ausgestorbenen Tiere eine Vorahnung der heutigen seien. Es ist leider auch für die absehbare Zukunft keine Hoffnung, daß jemand den Spuren Agassiz' folgen sollte.

Seit dem Altertum, seit Plato und Aristoteles, erhält sich die Annahme, daß man die Natur als eine ununterbrochene Reihe von aufsteigenden Wesenheiten aufzufassen habe; von Leibniz wurde sie erneuert und wieder belebt, und später wurde sie zur Grundlage der Klassifikationen der organischen Natur erkoren. Da nun die von uns eben geschilderte Zeit überzeugt war, daß das Wesen des Organismus in seiner Form Hege, war sie bemüht, in der Natur jene Reihe von vollkommeneren und vollkommeneren Formen aufzufinden. Seitdem erhält sich auch die Überzeugung, daß die Klassifikation den Höhepunkt der Erkenntnis bildet, da sie am bündigsten und logischesten die Natur begreift. Linné, der zuerst ein großes System der Natur darbot, faßte es zwar nicht besonders tief auf; mehr, als um ein philosophisches Begreifen der Natur, handelte es sich ihm um eine praktische Zusammenstellung der Pflanzen nach ihren Merkmalen, zum Zwecke leichterer Wiedererkennung, sozusagen um einen Bädeker im Reiche der Pflanzen. Nichtsdestoweniger war es ein konsequent und in großem Maßstabe durchgeführter Versuch.

Nicht so harmonisch (wie das der Pflanzen) entwickelten sich die Anschauungen über das System der Tiere. Auch dieses System wurde zuerst im großen von Linné begründet, und wie seine botanischen Ansichten, wirkte auch sein zoologisches System insbesondere in Deutschland, während es in Frankreich durch Cuvier vertieft wurde. Cuvier unterschied vier Tierreihen (embranchements), welche untereinander durch keinen Übergang verbunden sind; in jeder einzelnen Reihe lassen sich jedoch die Tiere in eine Hierarchie zusammenstellen, welche mit den einfachsten Formen anfängt und mit den zusammengesetztesten schließt.

Als man neue und neue Typen annahm, verwarf man zwar nicht gänzlich die Überzeugung von ihrer Bedeutung als isolierter, ohne Übergänge dastehender Tiergruppen, aber eben deshalb, daß die Anschauungen über deren Anzahl auseinandergingen und schwankten, nahm die ursprüngliche Bestimmtheit des Typusbegriffes ab, und es verschwand der absolute Unterschied, welchen Cuvier zwischen den Typen und den niederen Gruppen aufstellte. Trotzdem blieb der Gedanke von der Abgeschlossenheit der einzelnen Typen aufrecht, um so mehr, als ihn C. E. V. Baer durch seine entwicklungsgeschichtlichen Untersuchungen unterstützte; vier Jahre vor der Erscheinung der Darwinschen Schrift verteidigte noch H. Milne-Edwards die vier ursprünglich von Cuvier aufgestellten Typen.

Diese Richtung hielt die Systematik seit Linné bis auf die letzten Jahre ein; alle bisher erwähnten Forscher suchten nach einem natürlichen System der tierischen Formen, indem sie wissentlich unwissentlich die Lebenserscheinungen nur für eine Folge der Körperstruktur hielten. Es erschienen jedoch auch Versuche anderer als anatomischer Systeme. In Frankreich führte Lamarck eine Klassifikation der Tiere nach ihren psychischen Eigenschaften ein; da ihm jedoch diese ungenügend bekannt waren, hatte sein bereits angeführter Versuch keinen Erfolg. In Deutschland wieder versuchte Oken das System auf Physiologie zu gründen.

Wenn irgend jemand seit dem Verfall der Naturphilosophie auf dieses Okensche System zu sprechen kam, begann seine Erwähnung kaum anders als mit risum teneatis; und doch, ein wie tiefer Gedanke liegt ihm zugrunde! Noch heute gibt es viele, und es sind die modernsten, welche behaupten, daß Funktion wesentlicher sei als Struktur; wenn dem so ist, hatte Oken nicht recht, die Tiere nach ihren Funktionen zu ordnen? Ist die Gruppe der Tracheentiere nicht natürlich? Ein unbebautes Gebiet hat da Oken berührt, jedoch kein Verständnis gefunden; ein unbekanntes Gebiet, voll von schönen Tatsachen - doch wird es noch lange dauern, bevor es jemand wagt, in diesem unbekannten Lande nach neuen Entdeckungen zu suchen.

Theorien über das Wesen der Kategorien
in der Klassifikation der Tiere

Die Frage, von woher die Arten, Gattungen usw. kamen, schuf erst das 19. Jahrhundert; im 18. herrschte kein Streit darüber, ob die Arten entstanden oder erschaffen wurden, sondern, ob es Arten gibt oder nicht gibt - ein altes scholastisches Problem, welches durch die Biologen des 18. Jahrhunderts erneuert wurde. Wir wollen zusehen, wie man damals die Frage formulierte. Nach Maupertuis, dem bekannten »docteur Akakia«, wurden die Organismen als eine ununterbrochene Reihe von Formen geschaffen, viele Übergangsformen starben aber aus (ont été détruites); deshalb sei die Hierarchie der Wesen unserer Erkenntnis entrückt worden. Robinet, ein französischer, von Leibniz abhängiger Philosoph, polemisiert gegen diese Ansicht Maupertuis' und schreibt im Jahre 1761:

"Die klarsten Köpfe weisen nach, daß alle Wesen von demselben Range sind, und daß es keine wesentlichen Unterschiede unter ihnen gibt, daß es niemals mehr als ein Prototyp für alle Wesen gab, dessen bewunderungswürdig zahlreiche und auf alle möglichen Arten differenzierte Variationen sie darstellen."

Es waren also beide, Maupertuis wie ROBINET, der Überzeugung, daß die Organismen eine ununterbrochene Hierarchie bilden; nur darin waren sie uneins, ob diese Hierarchie in ihrer Lückenlosigkeit durch den Menschen zu erkennen ist oder nicht.

Lamarck huldigte einer ähnlichen Ansicht; nur darin war er einer anderen Meinung, daß er die Organismen in mehrere aus einem Punkt sich verzweigende Reihen zusammenstellte. Andere sachlichere Forscher dagegen, an ihrer Spitze Linné, wußten aus ihrer Praxis, daß es Arten und Gattungen gibt und daß die Arten scharf umgrenzt zu sein pflegen; sie glaubten auch an die Kontinuität in der Natur, stellten sich aber anstatt einer linearen Stetigkeit eine flächenhafte vor und behaupteten, daß man von einem Individuum, von einer Art, von einer Gattung Übergänge nicht nur nach vorne und hinten (zu einer höheren und einer niederen Form) antreffe, sondern nach allen Seiten, zu vielen anderen Formen ; daß man sich also die Individuen und Arten als Städte, Kreise, Länder auf einer Karte vorstellen könne, welche nach vielen Richtungen zusammenhängen. So lehrten auch Pallas, Decandolle u. a.

Das Artproblem kann noch anders aufgefaßt werden. Es gibt ohne Zweifel in der Natur Arten, sonst wäre keine Anleitung möglich, die Arten zu bestimmen, es wäre nicht möglch, von den Arten zu sprechen; das Problem beginnt erst, wenn es zu sagen gilt, was sie bedeuten. Ist vielleicht die organische Substanz in ihrem Wesen bereits so beschaffen, daß sie besondere Individual-, Varietät-, Art-, Gattungs- usw. Eigenschaften haben muß, etwa so, wie ein jeder Gegenstand Eigenschaften des Punktes, der Linie, der Fläche und des Raumes hat? Dies würde bedeuten, daß ein jeder Organismus besondere Individual-, Art-, Gattungseigenschaften besitzen müsse und diese Gruppen würden etwas Absolutes sein; es müßte in der gesamten lebendigen Natur ein und derselbe Maßstab für die Art vorhanden sein, ein anderer, wieder aber durchgängig derselbe für die Gattung usw.

Oder: die lebendige Substanz hat die Beschaffenheit von Individuen, welche einander mehr oder weniger ähnlich sind: die ähnlichsten stellen wir zu einer Art zusammen, wobei jedoch der Ähnlichkeitsgrad bei verschiedenen Arten verschieden sein kann ; während eine Art (der Hund z. B.) einander sehr unnähnliche Formen enthält, schließt eine andere (z. B. der Hase) Individuen ein, welche einander fast gleich sind. In diesem Falle kann keine allgemeine Definition der Art gegeben werden; man muß jedoch auch hier wieder zwei Möglichkeiten unterscheiden. Entweder liegen die Art charakterisierenden Merkmale im Wesen der Art selbst, wie wenn wir Ellipse, Hyperbel und Parabel unterscheiden, welche wir durch ihre Konstruktionsregel bestimmen; oder die die Art bestimmenden Merkmale sind durch die Außenwelt gegeben, wie z. B. die Umrisse der Inseln, welche durch Meeresbrandung, durch Flußmündung usw. formiert werden. In diesem Falle hat es wohl keinen Sinn, Regeln zu suchen, nach welchen die Art gebildet ist, sondern man wird nur deren Ursachen erforschen. Man merke wohl, daß im ersten Falle zwei Arten, die Ellipse und der Kreis z. B. durch Übergänge verknüpft werden und doch wesentlich verschieden sein können ; die Stetigkeit der Übergänge ist also kein Beweis gegen das Vorhandensein der Arten.

In der schematischen Form, wie wir die Frage nach dem Wesen der Art jetzt erklärt haben, erschien sie niemals in der Geschichte der Biologie; allein, diesen Sinn hat der Streit um den Begriff der Art gehabt.

Linné unterschied Varietäten, Arten, Gattungen, Ordnungen und faßte das Verhältnis dieser Gruppen so auf: außerhalb des Systems stehen die Varietäten, welche nur künstlich oder zufällig entstehen, und welche, auf sich selbst angewiesen, zur ursprünglichen Form zurückkehren. Die einfachste, systematische Einheit soll die Art sein, z. B. der Birnbaum, der Apfelbaum; die Arten derselben Gattung haben einige Eigenschaften gemeinsam (der Birn- und der Apfelbaum, zu derselben Gattung gehörend, besitzen beide in jedem der Fruchtfächer 2 Samen) und diese gemeinsamen Eigenschaften bilden die Merkmale der Gattung; die übrigen Eigenschaften, wie die Farbe der Kronenblätter, der Staubfäden, der Habitus des Baumes usw. können zwar auch Gattungsmerkmale sein, aber sind verschiedentlich unter anderen Gattungen verteilt; die in eine und dieselbe Ordnung gehörigen Gattungen haben wieder gemeinsame (Ordnungs-) Merkmale, während ihre übrigen Merkmale in anderen Ordnungen vorkommen ; die allen Ordnungen gemeinsamen Eigenschaften charakterisieren die Pflanze im allgemeinen.

Die eben erklärte Ansicht von dem Verhältnis der Eigenschaften zu den systematischen Gruppen drückte Linné in einer eigentümlichen Form aus. Gott soll, so schreibt er, dem Idealtypus der Pflanze, welcher die Pistillnatur hat, verschiedene Staubfädeneigenschaften verliehen haben und auf diese Art so viele, in der Anzahl ihrer Staubfäden verschiedene Individuen geschaffen haben, als es Ordnungen gibt (es ist bekannt, daß Linné die Pflanzenordnungen nach der Anzahl der Staubfäden unterschied). Die Eigenschaften jener Individuen hat Gott untereinander gemischt und soviele Individuen gebildet, als es Gattungen gibt. Die Gattungseigenschaften sollen sich in der Natur durch Kreuzung der Gattungsindividuen vermehrt haben und so sind die Arten entstanden. Der Zufall hat die Arten gemischt, woraus die Varietäten entsprungen sind.

Der Sinn dieser Hypothese, welche später von den Darwinisten oft angeführt und in genetischem Sinne gedeutet wurde, ist, daß die Art-, Gattungs- und Ordnungsgruppen absolut sind und daß es besondere Art-, Gattungs- und Ordnungsmerkmale gibt. Heute dünkt diese Auffassung der organischen Formen den meisten Forschern unmöglich; und doch wurde sie wieder und wieder von den Philosophen aufgegriffen und in der letzten Zeit kehren wieder einige zu derselben zurück; nicht lange vor dem Auftreten Darwins hat sich derselben sehr warm Louis Agassiz angenommen, derselbe, von welchem bereits oben gesprochen wurde. Das System und seine Kategorien, behauptete er, sind nicht nur eine Erfindung des Menschen, sie liegen in der Natur, der sie Gott eingehaucht hatte. Ein jedes Tier hat gewisse Art-, andere Gattungs-Merkmale usw., so daß, wenn man von den Krustentieren z. B. kein anderes Tier als den Krebs kennen würde, man doch an demselben die Artmerkmale von den Gattungs-, Familien- und Ordnungsmerkmalen unterscheiden könnte. Die Theorie der allmählichen Umwandlungen der Tiere durch Einwirkungen der Umgebung bestreitet Agassiz ; viele Seiten seiner Schrift hindurch bekämpft er Lamarck, der dieses lehrt und führt gegen ihm insbesondere folgende Gründe ins Feld:

Die verschiedensten Tiere leben unter denselben Bedingungen der Umgebung; wie mannigfaltig ist z. B. das Leben in einem Wassertropfen! Doch auch umgekehrt treffen wir unter den verschiedensten Umständen dieselben Tiertypen an: der Mensch, der Wolf leben von den Polargegenden bis zu den heißesten Zonen der Erde und dies wäre nicht möglich, wenn die Umgebung auf die Tiere von Einfluß sein würde. Wenn auch die Tiere noch so verschieden sind und verschieden leben, bewahren sie eine Einheit des Planes : vom Pol bis zum Äquator sind alle Vögel wesentlich ähnlich gebaut, und die Homologien lassen sich bis in solche Einzelheiten, wie die zwischen der Vogelfeder und der Fischschuppe verfolgen. Folglich glaubt Agassiz, daß alle vier Typen Cuviers vom ersten Aufkommen des Lebens auf Erden an da waren; seit jener Zeit kamen zwar neue Formen auf, jedoch nicht absolut neue, sondern die späteren drückten nur klarer und klarer denjenigen Plan aus, der von allem Anfang da war. Der Mensch bildet den Höhepunkt und Schlußstein der Entwicklung; höher wird die Natur nicht vordringen, die Zukunft wird nur einen Fortschritt des menschlichen Verstandes sehen.

In einer Hinsicht stand Agassiz hoch über seiner Zeit, welche nur für die Morphologie Sinn hatte: er begriff, daß die anatomische Anschauung vom Lebewesen derart einseitig ist, daß das auf die Morphologie begründete System nicht das natürlichste ist, daß man auch auf die Embryologie, Paläontologie, Physiologie, die geographische Verbreitung Rücksicht nehmen müsse - ein beachtenswerter Gedanke, der niemals zuvor mit einer solchen Klarheit ausgesprochen wurde, und der sich leider in der darwinistischen Flut unbeachtet verlor.

Das Auftreten Schleidens

Es ist nicht abzusehen, welchen Weg die Entwicklung der Zellentheorie weiter genommen hätte, wenn nicht Schleiden aufgetreten wäre; die damalige Zeit scheint die Entdeckung vorbereitet zu haben, daß alle Pflanzenteile aus wesentlich gleichen Elementen, den Zellen, bestehen ; daß Pflanzengefäße, Siebröhren und andere Elemente des Pflanzenkörpers nur als Metamorphose eines und desselben Elementes zu betrachten sind, welches als ein polyedrisches Körperchen den Baustein des Parenchyms, als ein einfaches Kügelchen den Körper der einzelligen Alge bildet.

Schleiden gab nicht nur der Zellentheorie eine andere Richtung, sondern er führte überhaupt in die Biologie eine neue Methode ein, durch welche er die Geister für die Aufnahme der Darwinschen Philosophie vorbereitete. Alle bisher angeführten Biologen waren Rationalisten, die an Pläne, Ideen, Vernunft in der Natur glaubten; jetzt aber sollte der Glaube an eine objektive Vernunft sein Ende finden.

Doch hatte Schleiden ein positives Ziel vor Augen; das Ziel, aus der Pflanzenkunde eine wahre, exakte Wissenschaft zu bilden; darum legte er Nachdruck auf den Titel seiner Schrift »Die Botanik als induktive Wissenschaft«. In der Darstellung seiner positiven Ansichten bekundete er gleichfalls eine frische Lebhaftigkeit; rasch verfolgte er seinen Gedanken, ohne auf Einzelheiten aufzupassen, übersah deshalb manchmal einen Fehler, einen Trugschluß, und ist folglich oft unklar, stets aber entschieden in seiner Behauptung. Man muß auf Kant zurückgehen, behauptete er, und zwar auf dem von Fries angedeuteten Wege (Fries wurde von Schleiden überhaupt sehr geschätzt), und es muß vorzüglich die englische sensualistischc Philosophie und Baco studiert werden, von den Botanikern insbesondere der Engländer Rob. Brown. Das Nachdenken über das Wesen der Dinge ist zu verwerfen; mechanische Erklärung der Natur aus Kombinationen von Grundkräften, durch welche die Formen hervorgebracht werden, ist anzustreben. Wie der Kristallograph aus der Anziehung und Abstoßung der Moleküle die anorganischen Strukturen zu erklären versucht, so soll der Morphologe aus denselben Kräften die organischen Formen verständlich machen; es gibt keinen wesentlichen Unterschied zwischen Kristallen und Organismen. Die Erfahrung sei die Losung des Botanikers, nicht das Verstehen; das Ziel der Wissenschaft sei eine in die Einzelheiten gehende Beschreibung des Geschehens:

»Die ganze Reihe aller Übergänge muß durch die Sinne ergriffen werden und es darf keine unbemerkte Lücke in der Entwicklung bleiben«, so behauptet er und drückt dadurch einen jener Grundsätze aus, die für die moderne Wissenschaft am bezeichnendsten sind.

Das Ideal einer induktiven Wissenschaft führte ihn direkt auf die genetische Philosophie. Wie man bei der Induktion vom einzelnen zum allgemeinen, vom einfachen zum zusammengesetzten fortschreitet, so sollen wir die Lebensvorgänge nur durch Verfolgung ihrer Entwicklung richtig auffassen, welche ebenfalls vom einfachen zum zusammengesetzten sich erhebt. Der Bau der Pflanzen diente ihm als Beispiel: das entwickelte Pflanzengewebe besteht aus verschiedenen Gebilden: Zellen, Gefäßen, Siebröhren, Milchröhren; erst indem man ihrer Entwicklung folgt, erkennt man ihren Zusammenhang, d. h. die Entwicklung aller aus ähnlichen Anfängen. Deshalb empfiehlt Schleiden immer wieder die genetische (embryologische) Betrachtung; deshalb verwirft er die idealistische Morphologie, die Lehre von der Einheit des Planes, von der Metamorphose, von den Homologien.

Die Bestimmtheit, mit welcher Schleiden seine Ansichten über die Entstehung der Zellen vortrug, überzeugte viele Histologen und brachte das Zellenproblem in den Mittelpunkt der Forschung; deshalb fand man bald seinen Irrtum heraus, wonach neue Zellen in den alten, aus der in ihnen eingeschlossenen embryonalen Substanz kristallisieren sollen. 1839 beschrieb H. v. Mohl die Entstehung der Sporen durch Vierteilung einer Mutterzelle und 1841 richtete F. Unger direkt gegen Schleiden seine Entdeckung, daß am Vegetationspunkt der Pflanze neue Zellen durch Teilung der alten entstehen; diese Beobachtungen wurden dann durch Nägeli und H. V. Mühl weiter verfolgt.

Theodor Schwann

Der gute Kern der Schleidenschen Theorie ging aber nicht verloren ; noch ehe seine Hypothese von der Entstehung der Zellen zum Falle gebracht wurde, wurde seine Lehre von der Entwicklung der Gewebe aus Zellen von Theodor Schwann (1840 - 1882) auch auf die Tiere angewendet. Es fehlte früher keineswegs an Versuchen, den Tierkörper in lebendige Elemente zu analysieren; der Theorien Leibnizen's und Buffon's ist Erwähnung getan; am Ausgang des 18. Jahrhunderts behauptete Erasmus Darwin (Alb. Haller war bereits früher einer ähnlichen Ansicht) und andere, daß der Tierkörper aus Elementarfibrillen zusammengesetzt ist und H. Milne-Edwards lehrte, daß die lebendigen Elemente des Tierkörpers äußerst kleine Kügelchen seien. Mehrere Forscher wurden bereits der tierischen Zellen gewahr, ja einige verglichen sie schon mit den Pflanzenzellen; es waren dies in Frankreich Dutrochet, Turpin, DUumortier; auch Purkinje beobachtete insbesondere in tierischen Drüsen Zellen und analogisierte diese »tierischen Körnchen« mit den Pflanzenzellen. Der Gedanke, daß auch der erwachsene Organismus aus Zellen besteht, wurde von Schwann nicht, wenigstens nicht mit voller Klarheit, verteidigt.

So brachte Schwanns Zellentheorie zweifaches dar: erstens die Erkenntnis, daß der zusammengesetzte Organismus sich aus Zellen entwickelt, zweitens eine neue Philosophie, welche induktiv, genetisch und mechanisch war. Schwann war sich der weitreichenden philosophischen Bedeutung seines Werkes bewußt; er schreibt im Vorwort: »die vorliegende Abhandlung hat zur Aufgabe, den innigsten Zusammennang beider Reiche der organischen Natur aus der Gleichheit der Entwicklungsgesetze der Elementarteile der Tiere und Pflanzen nachzuweisen«.

Auch über das Mechanische seiner Theorie war er sich klar. Schleiden behauptete (und Schwann bestritt diese Behauptung nicht), daß der Organismus ein gesetzmäßiges Aggregat von Einzelwesen niederer Ordnung sei; gegen die vitalistische Ansicht von der Einheit des Lebens im organischen Körper, gegen eine einheitliche Lebenskraft führte Schleiden aus, daß das Leben ein Resultat aus dem Zusammenarbeiten vieler Zellen sei. Schwann schreibt ebenfalls in diesem Sinne:

»Einem Organismus liegt keine nach einer bestimmten Idee wirkende Kraft zugrunde, sondern er entsteht nach blinden Gesetzen der Notwendigkeit durch Kräfte, die ebenso durch die Existenz der Materie gesetzt sind, wie die Kräfte in der anorganischen Natur. Da die Elementarstoffe in der organischen Natur von denen der anorganischen nicht verschieden sind, so kann der Grund der organischen Erscheinungen nur in einer anderen Kombination der Stoffe liegen.«

Die Bedeutung neuer Beweise (für den Darwinismus)

Im 17. und 18. Jahrhundert lehrte man, daß das menschliche Spermatozoon ein kleines Männlein sei; und es fanden sich Forscher, welche bestätigten, daß sie in der Tat durch das Mikroskop im Spermatozoon Teile des menschlichen Körpers gesehen hätten. Ihnen gegenüber behaupteten andere, daß das Tier nicht im Spermatozoon, sondern im Ei eingeschlossen liege; der berühmte Biologe Spallanzani bestätigte diese Theorie durch das Studium der Kaulquappenentwicklung. Auch herrschte damals der Glaube an das Phlogiston, das man durch Hitze aus den Substanzen austreiben wollte; und wirklich entdeckte man die Tatsache, das viele Substanzen im Feuer leichter werden. Man glaubte an vorsintflutliche Menschen; A. Scheuchzer entdeckte als Beweis eine Versteinerung, die er »homo diluvii testis* benannte; Cuvier wollte aber an diluviale Menschen nicht glauben: er erntete viel Ruhm durch den Beweis, daß Scheuchzer's Fund nur ein fossiler Salamander war - und trotzdem hat der diluviale Mensch gelebt. Und so wäre es möglich, der Geschichte der Wissenschaft Schritt für Schritt zu folgen und zu zeigen, daß sie eine Geschichte von Beweisen ist, die keine waren.

Es ist die objektive Wissenschaft, welche diese Auffassung der Tatsachen herbeiführte, welche den Unterschied zwischen Tatsache, Hypothese, Theorie, Beweis usf. aufstellte. Tatsache soll die reine, durch keine Subjektivität getrübte Erkenntnis darstellen; Hypothese eine Möglichkeit, welche noch des Beweises harrt, Theorie eine Zusammenstellung von Tatsachen zu einer einheitlichen Auffassung; an die Tatsachen muß man glauben, an die Hypothesen und Theorien darf man jedoch nicht glauben; die Tatsachen sollen ganz neutral sein und in jede Hypothese, in jede Theorie, in jede Philosophie hinein passen, die Hypothesen und Theorien dagegen nur in ihrer tatsächlichen Begründung der Wahrheit entsprechen. Diese Unterscheidungen sind aber Wortspielereien, welche von der Scholastik nur darin abweichen, daß sie um einige Jahrhunderte jünger sind. Kein aufrichtiger Forscher glaubt in seiner Praxis weder an die objektive Wissenschaft, noch an die Unterschiede von Tatsachen und Theorien, sondern bedient sich dieser Worte nur aus Höflichkeit, um seine Überzeugungen in anständige Form zu gießen; für ihn selbst gilt als die wahrste Wirklichkeit, als Tatsache, was andere als Hypothese bezeichnen würden; »objektive Tatsachen« erkennt er nicht an, sondern nur subjektive, indem jede Tatsache im Lichte seiner neuen Entdeckung neue Farben, neue Formen zeigt ; zeigt sie sie nicht, so ist sie für ihn wertlos, existiert überhaupt nicht. Darwin war beispielsweise ein äußerst objektiver Forscher, allein seine Objektivität bestand bloß darin, daß er in höflichster Form die Einwendungen seiner Gegner besprach, ohne sich durch dieselben im geringsten im Glauben an seine Lehre beirren zu lassen. Die Entwicklung der Organismenwelt, welche alle als Theorie bezeichnen, hielt er in seinem Inneren ohne Zweifel für die wahrste Tatsache von der Welt, und die »objektive« Tatsache, daß es Arten gibt, betrachtete er als falsch. Jeder Forscher folgt dieser Methode, muß ihr folgen: es wäre eine Frivolität, wenn jemand eine Hypothese aufstellte, von deren Wahrheit er nicht gleichzeitig fest überzeugt wäre ; es ist eben nur Höflichkeit, wenn er diese seine Überzeugung dem Leser als bloße Möglichkeit darbietet.

Es gibt also keine objektiven Tatsachen; jede Tatsache ist subjektiv und ist als solche nicht frei von Hypothese, von Theorie, von Philosophie; jede Tatsache, welche nicht als sinnloses Wort auf dem Papier steht, sondern welche aus dem Geiste des Menschen als sein lebendiges Produkt gesetzt wird, stellt einen ganzen Mikrokosmos dar, welcher eine neue Auffassung nicht nur einer einzelnen Erscheinung, sondern der ganzen Welt enthält. Eine Entdeckung, welche nicht die Umwälzung der gesamten Weltanschauung als Möglichkeit einschließt, ist gar keine Entdeckung.

Infolgedessen ist der Grundsatz der modernen Wissenschaft, die Tatsachen selbst sprechen zu lassen, an sich sehr richtig, nur muß man ihm gerade den entgegengesetzten Sinn geben, als ihm gemeinhin unterlegt wird. Die toten, jeder Subjektivität baren Tatsachen sind stumm und können nicht sprechen, nur die im Geiste des Menschen lebenden haben eine Sprache, und je subjektiver sie sind, desto leichter sind sie zu verstehen, desto natürlicher ist ihre Wirkung auf uns, die wir auch lebende Subjekte sind. Die toten Tatsachen können aufeinander nicht reagieren, können nichts beweisen, nichts widerlegen, können sich zu keiner Wahrheit zusammenscharen; darum hat die objektive Wissenschaft zur Logik, zur Beweisführung greifen müssen, um Bewegungsmittel, Hebel und Maschinen zu haben, durch welche die totgeschlagenen Tatsachen hin und her geschoben werden könnten. Einerseits Tatsachen, anderseits Hypothesen und Theorien: der eine schiebt die Tatsache hierher, der andere dorthin, und das nennt sich Beweisführung, bei der die Tatsachen selbst sprechen.

Doch uns, die wir die Entwicklung des Darwinismus verfolgen, bleibt nichts anderes übrig, als zu konstatieren, daß für das Aufblühen dieser Lehre die toten Tatsachen, zu gewissen Beweisen zusammengestellt, von großem Einfluß waren.

https://commons.wikimedia.org/wiki/File:Edwin_Klebs.jpg


Verlag: August Hirschfeld
» «

Die anatomische Erforschung der Krankheitsvorgänge ist die Aufgabe derjenigen Wissenschaft, welche man gegenwärtig, freilich grammaticalisch nicht richtig, kurzweg als "pathologische Anatomie" bezeichnet. Sie datirt von demjenigen Zeitpunkte, an welchem man aufhörte, die Krankheiten als fremde Wesen zu betrachten, welche den normalen Bau und Verrichtung des Körpers stören. Seit dieser Zeit giebt es für den wissenschaftlichen Forscher nur Abweichungen von den normalen Lebensvorgängen, die ihren Grund in der veränderten Beschaffenheit der Körpertheile haben müssen. Es kann nicht in Frage gestellt werden, ob jeder Krankheitsprocess eine materielle Grundlage habe; denn wir können die Existenz von Kräften nicht anerkennen, welche von der Materie abgelöst sind; sondern es ist vielmehr die Frage, ob diese materiellen Veränderungen in jedem Fall nachgewiesen werden können, und diese Frage muss verneint werden. Die pathologische Anatomie ist demnach eine unvollkommene Wissenschaft, aber der Jünger, welcher sich an ihr Studium begiebt, kann sich damit trösten, dass sie zugleich eine progressive Wissenschaft ist. In kurzer Zeit, seit dem Ende des vorigen Jahrhunderts, ist ein gewaltiges Material von Thatsachen zusammengebracht, und, was mehr sagen will, so weit gesichtet, das umfassende Gebiete dem wahren, wissenschaftlichen Verständniss erschlossen sind. Andere warten noch der Bearbeitung, welche die gegenwärtigen Untersuchungsmethoden gestatten, und andre endlich werden sich demjenigen erst erschliessen, welcher neue Wege der Forschung eröffnet.

Über die Verhältnisse der organischen Kräfte untereinander
in der Reihe der verschiedenen Organisationen,
die Gesetze und Folgen dieser Verhältnisse

Faksimile der Ausgabe von » Karl Friedrich von Kielmeyer « Stuttgart 1793
Verlag: Armin Gens

» Die Gesetz der grossen Maschine der organischen Welt «
Book review
Journal for General Philosophy of Science volume 26, pages 191-202 (1995)
» Kristian Köchy « und Ansgar Richter

Wenn moderne Wissenschaftstheoretiker zu der Einsicht gelangen, daß "die Themen 'Organisation' erst recht 'Selbstorganisation' [...] im Anschluß an die wissenschaftliche Revolution des 17. Jahrhunderts zu einem zentralen Problem geworden" sind, dann ist damit auch ein aktuelles Themenfeld biowissenschaftllicher Forschung angesprochen, das letztlich in der Frage kulmieren muß: "Was ist Leben?" Mit einer solchen Fragestellung ist allerdings heutzutage für viele Fachvertreter bereits der enge Rahmen der Disziplin "Biologie" überschritten, in der zwecks Erhaltung des Leistungsstandes solche "metaphysischen Restbestände" systematisch ausgeklammert und in den Zuständigkeitsbereich der Philosophie verwiesen werden. Diese Distanzierung stellt für die Wissenschaft vom Lebendigen allerdings eine Negierung ihrer Grundfunktion dar. die Trennung der Arbeitsfelder von Fachwissenschaft und Philosophie bietet hier nur eine Scheinlösung. Betrachtet man nämlich die innovativen und progressiven Phasen der Wissenschaftsentwicklung etwas eingehender, so wird man feststellen, daß gerade in diesen Phasen verständlicherweise metatheoretische Diskussionen in die Fachwelt hineingetragen werden, wobei sich vor allem die Wissenschaftler an der Forschungsfront auch philosophischen Analysen gegenüber offener zeigen. Im Lichte dieser Feststellungen erweist sich die Situation der modernen Biologie als höchst unbefriedigend. Sie zeichnet sich dardurch aus, daß es ihr weitgehend an einem metatheoretischen und philosophischen Diskurs fehlt. So überläßt die Biologie die Diskussion über ihre eigenen Grundbegriffe in großem Umfang fachfremden Wissenschaftlern.

Divider

Pathologie
Teratologie

Divider


Erster Theil - Allgemeine Pathologie
Verlag: Schäferische Buchhandlung
» «

Im Zeitalter der Renaissance galt es, die allgemeine Wissenschaft zu vernichten, um die individuelle zur Geltung zu bringen, also gerade das Gegenteil des heutigen Ideals.
(Emanuel Rádl)


seit dem Ende des siebzehnten Jahrhunderts - Teil 1
Verlag: Wilhelm Engelmann
» «

6. Der Verfall der Biologie nach Leibniz.

Es ist merkwürdig, wie rasch das Interesse an tiefen biologischen Problemen, das in der Zeit von Harvey bis Swammerdam so viele tüchtige Männer erfüllte, am Ende des 17. und am Anfang des 18. Jahrhunderts verschwand und einer flachen Naturanschauung Platz machte. In der vergleichenden Anatomie war bis in die zweite Hälfte des 18. Jahrhunderts kein Fortschritt zu verzeichnen. Die Bearbeitung der Histologie hörte mit Malpighi auf, und erst Bichat hat in den letzten Jahren des Jahrhunderts diese Wissenschaft von neuem entdecken müssen. Die Embryologie war zwar ein sehr oft behandeltes Gebiet, aber der Streit der Ovisten und der Animalkulisten, sowie die evolutionistischen Theorien überhaupt geben ein nur zu deutliches Bild von dem kläglichen Zustand des biologischen Denkens in jener Zeit. Die wichtige Arbeit von C. F. Wolff, welche in der Mitte des 18. Jahrhunderts erschien, wurde nicht verstanden und geriet in Vergessenheit; im 19. Jahrhundert mußte sie von neuem entdeckt und herausgegeben werden, damit man auf sie aufmerksam würde. In der Systematik hat Linné zwar nachhaltig gewirkt, aber mehr in die Breite gehend als in die Tiefe, und aus der Physiologie hat nur die Lehre von der Irritabilität der Biologie einen verhältnismäßig neuen Gedanken zugeführt.

Woher kam denn dieser Stillstand der Wissenschaft? Es ist mir nicht möglich, seine Ursachen vollständig anzuführen; aber das sehe ich deutlich, daß die Biologen der ersten Hälfte des 18. Jahrhunderts nur Epigonen von Malpighi, Swammerdam, Borelli, Stahl usf. waren, und wie es die Art des Epigonentums ist, haben sie zwar die materielle Seite ihrer großen Vorgänger nachzuahmen gewußt, ohne aber den Geist ihrer Naturanschauung erfassen zu können. Sie haben ganz richtig die Erfahrung betont, wie Reaumur und Haller; sie haben auch dicke Bücher über Naturphilosophie verfaßt, wie Bonnet; sie haben viel Neues entdeckt, wie Leeuwenhoek, doch hat ihnen die Kraft gefehlt, welche ihrer Erfahrung, ihren Theorien, ihren Entdeckungen innerliches Leben hätte verleihen können.

Eine andere ebenfalls nicht sonderlich erfreuliche Erscheinung in der Biologie des 18. Jahrhunderts ist die große Berühmtheit, die einigen Naturforschern damals zuteil wurde. Gewiß ist es dem Leser bereits aufgefallen, daß man noch heute immer von dem »berühmten Réaumur«, dem »berühmten Haller« spricht, nicht aber von dem berühmten C. F. Wolff usf. Es kommt dies daher, daß im 18. Jahrhundert mehr als zu andern Zeiten die äußeren Schicksale für den Ruhm eines Forschers entscheidend waren. Die Wissenschaft war aristokratisch, sie hatte Zutritt in die Salons der hohen Gesellschaft erlangt, und das, was sich der oberflächlichen und genial sein sollenden Auffassung dieser Kreise anpaßte, wurde mit größten weltlichen Ehren aufgenommen; dasjenige aber, was als wirklich wahr zu gelten beanspruchte und deshalb seichten Köpfen unzugänglich war, wurde mißachtet. Zu keiner Zeit, weder zuvor noch nachher, haben die Naturforscher sich gegenseitig so geehrt, wie damals. Reaumur, Haller, Bonnet Spallanzani behandeln einander in ihren Schriften als lauter Genies und Weltberühmtheiten.

Im 18. Jahrhundert wurde der erste Schritt zur Laïsierung der Biologie getan. In früheren Zeiten waren alle Biologen (ausgenommen etwa die Systematiker) Ärzte. Linke hat anfangs noch die ärztliche Praxis geübt und auch mehrere medizinische Schriften verfaßt; Swammerdam war wissenschaftlich noch in Berührung mit den medizinischen Theorien (über die Atmung, über die Drüsen usf.), Linné war jedoch seiner wissenschaftlichen Richtung nach bereits wesentlich nicht Mediziner, sondern Biologe im allgemeinen. Reaumur, Bonnet, Buffon, Cuvier waren keine Arzte mehr und pflegten nur die Biologie als solche. Seit jener Zeit ist es trotz wiederholter Bemühungen nicht mehr gelungen, beide Gebiete wieder in eine Bahn zu lenken: heute gibt es Gebiete, die der Mediziner ebenso wie der Biologe bearbeiten kann, andere dagegen, wie die Physiologie und die Morphologie der Wirbeltiere (Gebiete, welche die Entwicklung der Theorien in der Biologie eigentlich beherrschen), werden ganz überwiegend von medizinisch gebildeten Forschern in Anspruch genommen.

Der innere Niedergang der Biologie im i8, Jahrhundert hat etwa bis in die achtziger Jahre des Jahrhunderts gedauert. Mit Cuvier hat wieder eine ernstere Forschung angefangen, wenn man auch bei dem Ruhme, der sich an seinen Namen knüpft, die Nachwirkung der früheren Zeiten in Betracht ziehen muß. In Deutschland und in England ist es zu solchen Extremen, wie in Frankreich, nicht gekommen, doch hat sich mir wiederholt der Gedanke aufgedrängt, daß sich die spätere deutsche Naturphilosophie in mehrfacher Hinsicht mit der französischen Wissenschaft aus der Mitte des i8. Jahrhunderts vergleichen läßt. Die französischen Biologen haben sich in der Mitte des 18. Jahrhunderts wesentlich nur für das Geistreiche interessiert. Sie haben mit der Lösung biologischer Probleme weniger ein subjektiv empfundenes Bedürfnis nach der Erkenntnis der Wahrheit gestillt, ihre Theorien waren weit mehr für den Leser als für den Autor bestimmt: die französisch aufgefaßte Genialität war ihr Ziel. Ganz ähnlich kann man auch die deutsche Naturphilosophie als den Versuch einer genialen Auffassung der Natur - genial um jeden Preis - betrachten: das Wühlen in den abstraktesten Begriffen, das Verschmähen jeder Logik, die Geringschätzung der Erfahrung, die Betonung der Mathematik, der dunkle Stil usw. - alles trug die Merkmale der Genialität an sich.

https://commons.wikimedia.org/wiki/File:Edwin_Klebs.jpg


Verlag: August Hirschfeld
» «

Wir müssen in der Geschichte der pathologischen Anatomie zwei Perioden unterscheiden, in deren erster ausschliesslich Material gesammelt wurde, während in der zweiten die Zusammenfassung und Ordnung der Thatsachen nach allgemeinen Gesichtspunkten angestrebt wird. Die Werke der ersten Periode, welche von Vesal bis gegen das Ende des 18. Jahrhunderts reicht, sind dahei wesentlich casuistisch und unterscheiden sich in ihrem Werth je nach der geringeren oder grösseren eigenen Erfahrung der Verfasser.

Zunächst in Deutschland vollzog sich um das Jahr 1840 ein grosser Wandlungsprocess in unserer Wissenschaft, indem die mikroscopische Forschung den gröberen anatomischen Befund ergänzte und verfeinerte, und die allgemeinpathologischen Anschauungen einer Reform entgegenführte, welche durch die Anwendung der cellularen Theorie auf die pathologischen Vorgänge ihren Gipfelpunkt erreichte: Es zeigte sich, dass ein grosser Theil jener Veränderungen, welche man, namentlich in der Wiener Schule, von einer Exsudation flüssiger Theile aus dem Blute herleitete, im Wesentlichem eine Function der zelligen Gewebsbestandttheile ist. Die Reform begann mit den Untersuchungen von Schwann, welcher die jetzt allgemein anerkannte Zusammensetzung der Gewebe in ihren Grundzügen feststellte, und von Johannes Müller, welcher dieselben oder analoge Formbestandtheile in pathologischen Neubildungen nachwies, ungerechnet die vielen andern Forscher, welche mehr im Einzelnen demselben Ziele zustrebten. Noch aber herrschte die alte Blastemtheorie, jene Lehre von Schleiden, nach welcher eine freie Bildung von Zellen in Flüssigkeiten angenommen wurde. Es sind zwei Männer, welche zu gleicher Zeit und an gleichem Ort, wenn auch in verschiedenen Gebieten die Lehre von der "legitimen Succession der Zellen" begründeten: Remak auf embryologischem, Virchow auf pathologischem Gebiete. Dem letzteren gebührt unbestritten das Verdienst der schärferen Formulirung der neuen Lehre, zu deren Begründung die Arbeiten beider Männer in gleicher Weise beigetragen. Das Wort: Omnis cellula e cellula eröffnete für die Pathologie weite Gebiete der Forschung und Erkenntniss, welche die alte Blastem- und Exsudattheorie in bequemer Weise von sich abgewiesen hatte. Indem gezeigt war, wie Zelle aus Zelle hervorgeht, jede mit einem gewissen Maass von individuellem Leben ausgestattet, mussten die Besonderheiten jedes normalen und pathologischen Gewebes in viel schärferer Weise festgestellt werden, als vordem. Soviel in dieser Beziehung geleistet, so stehen wir jedoch noch beiweitem nicht am Ziel dieser Entwicklungsperiode, der vollständigen Erkenntniss normaler und pathologischer Zellenthätigkeit.

Es ist begreiflich, dass der neue Aufschwung der mikrographischen Forschung auch auf die systematische Darstellung der pathologischen Anatomie nicht ohne Einfluss bleiben konnte. In Frankreich war es namentlich Lebert, welcher in zahlreichen Werken in diesem Sinn eine Reform der Pathologie und pathologischen Anatomie anzubahnen versuchte, allein, wie dies auch noch später vielfach geschehen ist, in der irrigen Voraussetzung, dass die Morphologie der kleinsten Theile die bestimmt ausgeprägten Verschiedenheiten der grob-anatomischen Zustände wiederholen müsste. Es ist dieser Irrthum an sich sehr natürlich und wurde von einer grossen Anzahl der tüchtigsten Forscher getheilt, ja lebt sogar in dem Bewusstsein zahlreicher Aerzte neben der alten Exsudattheorie fort. Auch hier scheint die Bequemlichkeit der Menschen nicht ohne Einfluss auf ihre Meinungen geblieben zu sein, indem es allerdings ausserordentlich angenehm und nützlich wäre, mit einem Blick in das Mikroscop alle Schwierigkeiten der differentiellen Diagnose zu überwinden. So leicht aber geben sich die Naturdinge dem Beobachter nicht. Die Leistungen Leberts für die systematische Darstellung der pathologischen Anatomie, welche in seinem grossen, mit einem prächtigen Atlas ausgestatteten Werk (Traite d'anatomie pathologique. 2 Bde. Text und 2 Bde. Tafeln. Paris, 1857.) niedergelegt sind, sollen deshalb nicht geringer geschätzt werden. Für Frankreich ist er der Begründer der pathologischen Mikrographie und sein Atlas ist für die gröbere pathologische Anatomie unzweifelhaft das bedeutendste aller vorhandenen Werke.

» Monster oder Laune der Natur (2004) «
Medizin und die Lehre von Missbildungen 1780-1914
Campus Verlag
Urs Zürcher
» Rezension von Urte Helduser «

Im Jahr 1998 wurde das Pathologische Museum Rudolf Virchows in Berlin wiedereröffnet, das der berühmte Arzt und liberale Politiker ein knappes Jahrhundert zuvor eingerichtet hatte. Mit ihren zahlreichen Präparaten von spektakulären "Missgeburten", die Virchow über mehrere Jahrzehnte hinweg zusammengetragen hatte, eignete sich seine Sammlung besonders für die Popularisierung von Wissenschaft. Die kürzliche Wiedereröffnung ist auch ein Zeichen für die Renaissance dieses spektakulären Themas. Das wiedererweckte Interesse an so genannten "Missgeburten", "Monstrositäten" oder "Freaks" dokumentiert sich in einer Vielzahl medizinhistorischer und kulturwissenschaftlicher Untersuchungen der letzten Jahre. Neuere Publikationen haben sich dabei hauptsächlich auf die so genannten "Monstrositäten" des Mittelalters und der Frühen Neuzeit oder aber die "Freaks" des ausgehenden 19. und des 20. Jahrhunderts konzentriert (z.B. Lorraine Daston / Katharine Park, "Wunder und die Ordnung der Natur 1150-1750", 2002; Rosemarie Garland Thomson (Hg.), "Freakery. Cultural Spectacles of the Extraordinary Body", 1996).

Die jetzt im Campus Verlag erschienene Dissertation Urs Zürchers, "Monster oder Laune der Natur. Medizin und die Lehre von den Missbildungen", schließt diesbezüglich eine Lücke. Sie schildert die im ausgehenden 18. Jahrhundert einsetzende und im 19. Jahrhundert ihren Höhepunkt erreichende Verwissenschaftlichung des Diskurses über Monstrositäten und die Herausbildung einer einheitlichen Missbildungsforschung, die antritt, um die bis in die Antike reichende Faszination für das Monströse aus der religiösen Spekulation in das Reich der Wissenschaft zu überführen, gewissermaßen eine Verschiebung von der Theologie zur Teratologie - so der Name der entstehenden Spezialdisziplin.

Die medizinische Beschäftigung mit Missbildungen erreicht im 19. Jahrhundert einen Höhepunkt, der sich in der Herausbildung der Teratologie manifestiert. Aber auch über die disziplinäre Spezialisierung hinaus entfalten die Missbildungen bedeutsame wissensbildende Impulse. Paradigmatisch für das 19. Jahrhundert lassen sich am Beispiel der Missbildungsforschung wissenschaftliche Verfahrensweisen der Klassifizierung und Systematisierung der Natur beobachten. Zürcher liefert damit eine beeindruckende, akribisch recherchierte und anregende Fallstudie zur Wissenschaftsgeschichte des 19. Jahrhunderts.

Am Beginn der Untersuchung steht die "Theoria Generationis" Caspar Friedrich Wolffs (1759). Mit seiner Auffassung, dass entstehendes Leben keineswegs in einem Kern vorgebildet ist, wie die Verfechter der Präformationstheorie meinten, sondern vielmehr das "Geformte aus dem Ungeformten" entstehe, vertritt Wolff ein frühes Entwicklungsmodell. Für die Nachfolger wie Blumenbach, Henke, Meckel oder Soemmering geht es darum, die Missbildungen zu systematisieren und in eine Ordnung zu bringen. Als einer der Ersten setzt Samuel Thomas Soemmering dazu systematisch Abbildungen ein und entwickelt hiermit eine spezifische Ikonografie der Missgeburten. Der Zoologe Geoffroy Saint-Hilaire führt eine Versuchsreihe mit Hühnereiern durch, in der es ihm gelingt, missgebildete Embryonen zu erzeugen. Etienne Geoffroy Saint-Hilaire und sein Sohn Isidore werden als eigentliche Begründer der Teratologie in die Medizingeschichte eingehen. Zwar führten die beiden Ansätze ihrer vornehmlich deutschen Vorgänger weiter, für die Radikalität ihres Unternehmens bedurfte es jedoch nach Auffassung Zürchers des gesellschaftlichen Kontexts des revolutionären Frankreichs. Ihr Ziel einer endgültigen Erledigung der Präformationstheorie begründen Vater und Sohn mit einem aus der Revolution abgeleiteten Fortschrittsverständnis. Das Bestreben der beiden, der Teratologie einen festen Platz in den Naturwissenschaften zu sichern, ist mit der weiteren Systematisierung des Missbildungswissens verbunden: Isidore entwickelt ein Schema zur Klassifikation der Missbildungen nach dem Vorbild Linnés, in das nun alle Formen der Monstrositäten eingeordnet werden können. Die Monstrositäten haben damit endgültig ihren Platz in der natürlichen Ordnung gefunden, sie können nun in ihrer eigenen Regelhaftigkeit erkannt werden.

Am Ausgang des 19. Jahrhunderts markieren diese Tendenzen letztlich das Ende der Teratologie. Zunächst kommt es zu einer Popularisierung der Wissenschaft von den Fehlbildungen, wie Virchow sie mit der Zurschaustellung seiner anatomischen Sammlung betreibt, dies führt jedoch dazu, dass die wissenschaftliche Beglaubigung des Monströsen vor allem dazu dient, die Attraktivität von Menschen mit Missbildungen für das aufkommende Showbusiness zu steigern. Berühmtes Beispiel hierfür sind die "siamesischen Zwillinge" Chang und Eng, die auf mehreren Europa-Touren als Sensationen gezeigt wurden und zugleich Ärzten wie Virchow als Forschungsobjekt dienten. Während Virchows pathologisches Museum bereits kurz nach seiner Eröffnung 1899 mit dem Tod des berühmten Arztes 1902 nachlassende Besucherzahlen vermerken muss und schließlich verkleinert wird, erlebt der amerikanische Zirkus Barnum & Bailey zur gleichen Zeit mit seinen Freakshows auf Europa-Tournee große Erfolge. Nach Zürcher ist damit aber auch schon der Höhepunkt der Missgeburten-Schaustellerei erreicht. Die Monstrositäten verlieren ihre Attraktionskraft in dem Augenblick, in dem als Folge des Ersten Weltkriegs die Verkrüpplung zur Massenerscheinung wird.

Die einstmals mit revolutionärem Fortschrittsgeist versehene Teratologie erfährt im beginnenden 20. Jahrhundert ihren endgültigen Niedergang. Für den Zerfall der Disziplin macht Zürcher zunächst nur wissenschaftsinterne Gründe geltend. Danach ist es der Teratologie nicht gelungen, sich aus den verschiedenen Fachgebieten zwischen pathologischer Anatomie und Zoologie als einheitliches Fach zu institutionalisieren. Ebenso habe sie den Anschluss an die medizinische Entwicklung verpasst, indem sie wichtige Paradigmenwechsel nicht mitvollzogen habe. Mit dem Abbruch seiner Untersuchung zur Zeit des Ersten Weltkriegs lässt Zürcher eine Schlussfolgerung aus, die seine Analysen selbst nahe legen. So stellt er fest, dass das Missbildungswissen seit der zweiten Hälfte des 19. Jahrhunderts laut Zürcher "immer öfter in einem rassistischen und eugenischen Zusammenhang" erscheint. Zürchers Untersuchung endet - ohne dass der Autor diesen Zusammenhang herstellt - gewissermaßen dort, wo die teratologische Fortschrittsgeschichte sich endgültig in ihr Gegenteil verkehrt: bei den in den 1920er Jahren entwickelten Konzepten zur "Vernichtung lebensunwerten Lebens" und ihrer Umsetzung im Nationalsozialismus.

Berliner Medizinhistorische Museum der Charité

» Berliner Medizinhistorische Museum der Charité «

» Handbuch der pathologischen Anatomie (1863) «
Verlag: Leopold Voss
» «

Ueber den Bau der männlichen Geschlechtsorgane finden sich nur wenig Notizen und ebenso verhält es sich mit den krankhaften Veränderungen, von denen metastatische Orchitis, durch heftigen Husten entstandene Hodengeschwulst (Hernie?), Wassergeschwulst und Varix flüchtig und ohne nähere Beschreibung erwähnt werden. Von den weiblichen Geschlechtsorganen kannte man nur die Theile näher, welche der äusseren Untersuchung zugänglich sind, also Vulva, Vagina, Vaginalportion und höchstens noch den Cervix uteri mit seinem Kanal und Mündungen, über alles in der Bauchhöhle Verborgene hatte man keine Kenntniss und meist ganz falsche Vorstellungen, die Ovarien und Tuben werden nirgends erwähnt. Dem Uterus, den man offenbar für doppelt oder in Hörner ausgehend hielt, schrieb man eine eigentümliche, willkürliche Bewegungsfähigkeit und eine Liebhaberei für Wohlgerüche und Absehen gegen übelriechende Dinge zu, kurz man stellte ihn fast einem Thiere gleich, eine Ansicht, die sich auch bei späteren Autoren wiederfindet. Daher spielte unter den Veränderungen des Uterus das "Aufsteigen" desselben bis zum Halse hinauf eine grosse Rolle, wie ja auch noch heute in der Volksmedicin alle hysterischen Erscheinungen vom Aufsteigen der Mutter abgeleitet werden. Ausserdem kannte man aber auch den Prolapsus, die Retroversio, die Schieflage oder Seitenlage und selbst die Inversio nach der Einbindung (Epidem. II), so gut man diese Veränderungen eben an Lebenden beurtheilcn kann. Man kannte ferner die Uterusentzündung im Puerperium, die bei Wöchnerinnen vorkommenden Entzündungen und Ulcerationen der Scheide und Vulva und die zuweilen hieraus hervorgehenden Atresien. Uebrigens wird oft von Entzündung und Verschwörung des Uterus, oder, wie es gewöhnlich heisst, der Uteri, gesprochen, wo man sehr willkürlich aus den Symptomen Schlüsse zog. Das Carcinom der Mamma und des Uterus kannte man aus den Untersuchungen an Lebenden leidlich; sehr unbestimmte Anschauungen hatte man von Wassersucht, Aufblähung, Rothlauf, Verdrehung u. s. w. der Uteri. Uebrigens hatte man einige Kenntniss von Beckenabscessen und deren Perforation in die Scheide.

In Galen (Claudius Galents, 131 - 201 n. Chr.) finden wir einen Forscher, dessen Bestrehungen sich nicht auf die Befriedigung der Bedürfnisse der Praxis beschränkten, sondern im Sinne ächter Wissenschaft auf möglichst umfangreiche Erforschung der Natur und der Organismen gerichtet waren und welchem in dieser Hinsicht im ganzen griechischen Alterthume nur Aristoteles an die Seite gestellt werden kann. Dies beweisen aber vor Allem seine Leistungen im Gebiete der Anatomie, welche für alle Zeilen grossartig dastehen, ohschon sie sich vorzugsweise auf die Thiere beschränken. Galen erkannte den Bau des Herzens und der Gefässe, den Blutgehalt der Arterien nebst deren Vertheilung ziemlich genau und wurde nur durch seine unglücklichen theoretischen Ansichten von der Entdeckung des Blutlaufes abgehalten; ferner hatte er den Bau des Gehirns und Bückenmarkes und der von ihnen abgehenden Nerven zum grossen Theile richtig erkannt, wurde aber auf diesem Gebiete durch seine vorgefassten Meinungen irre geleitet und von der richtigen Einsicht abgelenkt. Galen untersuchte ausser vielen anderen Thieren vorzugsweise Affen und hielt den Bau der letzteren für so identisch mit dem des Menschen , dass er anatomische Untersuchungen der letzteren kaum für sehr nothwendig hielt. Dass zu seiner Zeit Menschenleichen hie und da zur Untersuchung des Körperbaues benutzt wurden, geht aus verschiedenen Stellen seiner Werke (z. B. de anat. admin. 1. 2. III. 5.) hervor, er selbst kann aber schwerlich viele solche Untersuchungen gemacht haben, da seine Beschreibungen, auch wenn er sie auf den Menschen bezieht, doch offenbar meist der Untersuchung von Thieren entnommen sind; jedenfalls kann er nie einen menschlichen weiblichen Körper untersucht haben, sonst würde er nicht die Ziege und das Kalb unter diejenigen Thiere rechnen, deren Uterus dem menschlichen gleich ist. (De dissect. uter. 3.). Uebrigens ist gerade in Bezug auf den Uterus Galen der Erste, welcher aus anatomischen Gründen die Möglichkeit des Aufsteigens des Uterus bis zum Zwerchfell und weiter widerlegt (De loc. affect. VI. 5.).

Paulus von Aegina (c. 660 n. Chr.) gab in seinem Lehrbuche eine kurze Zusammenstellung des Besten aus den Werken seiner Vorgänger und seiner eignen Erfahrungen, die sich besonders auf das Gebiet der Chirurgie und Weiberkrankheiten erstreckten. Alle totalen, der äusseren Untersuchung zugänglichen Veränderungen werden zwar sehr kurz, aber oft mit grosser Treue beschrieben, so besonders der Krebs des Uterus und der Mamma, die Fetthyperlrophie der letzleren bei Männern, die Geschwüre und Condylome der äusseren Geschlechtstheile, die Aneurysmen, die Polydaktylie, welche Paulus ganz treffend schildert, Hypospadie des geringsten Grades, während die der höheren Grade als Hermaphrodismus aufgeführt werden, die Hydrocele, Cirsocele, Hernia scrotalis, Atresia vaginae und ani, die Filaria medinenis, Varicen, bei denen auch die am Bauche unter dem Nabel vorkommenden erwähnt werden. Aus der Beschreibung der Häute der Hoden, inbesondere der eigenthümlichen Scheidenhaut, und der Fracturen und Luxationen geht hervor, dass Paulus die betreffenden Theile wohl an menschlichen Leichen untersucht haben musste. Die Veränderungen der inneren Organe werden nur nach den Symptomen beschrieben und hier der Vermuthung ziemlicher Spielraum gelassen; Hinweise auf Leichenbefunde kommen nicht vor.

Werfen wir noch einen Blick auf die Geschichte der pathologischen Zootomie in dieser Periode, so kann man schon aus der ganzen vorigen Darstellung ersehen, dass sie unter günstigeren Verhältnissen und eher begann, als die pathologische Anatomie des Menschen. Sie hatte zunächst den grossen Vortheil, dass die physiologische Zootomie einen hohen Grad der Ausbildung erreichte und sie daher viel eher eine sichere Grundlage gewann ; und ferner war sie dadurch begünstigt, dass Thierleichen ohne Scheu und Verstoss secirt werden konnten und also ein reiches Material zu Gebote stand. Dennoch beschränkt sich das, was in der pathologischen Zootomie geleistet wurde, ganz gleich wie bei der physiologischen Zootomie, fast nur auf die Beobachtungen einzelner Naturforscher und Menschenärzte, während die eigentlichen Thierärzte nur äusserst wenig zur Bereicherung dieser Zweige der Wissenschaft beitrugen.

Nachdem schon im dreizehnten Jahrhundert der grosse Franciscaner Roger Baco, seine Zeit weit überragend, auf die empirische Forschung als die Quelle der Erkenntniss hingewiesen, nachdem im vierzehnten und fünfzehnten Jahrhundert der Sinn für reales Wissen und positive Kenntniss im Gegensatz zu den inhaltsleeren Luftgebilden der scholastischen Dialektik allmälig immer mehr gewachsen, kamen endlich im sechzehnten Jahrhundert der neue, frische Geist selbstständiger Forschung, und der gewaltig alle Schranken durchbrechende Trieb nach ureigner Erkenntniss, unabhängig von den Alten und von der Schablone der Scholastik, zur vollen Entwicklung. Eine neue Culturperiode blühte auf, getragen von dem wohlhabenden und gebildeten Mittelstande, der sich endlich durch die im Mittelalter allein herrschenden Stände des Clerus und des Adels Bahn gebrochen hatte; eine Culturperiode, die sich ächt menschliche Bildung, vollste Entfaltung der Humanität zum Ziele steckte, um so mit den neuen, durch die Schule vieler Jahrhunderte geläuterten Kräften der modernen Culturvölker das zu erreichen, was schon das edle Volk der alten Griechen versucht halte. Zu Boden fiel der blinde Autoritätsglaube, der so lange schwer auf dem geistigen Leben der Völker gelastet hatte, und die Menschheit fasste wieder den Muth zur freien, wissenschaftlichen Forschung, die nur die Gesetze vernünftiger Erkenntniss und keine anderen über sich duldet.

Die alte Weltanschauung fiel, als Kopernicus und Galilei die Fesseln der Erde gelöst und mit der Bewegung der Erde auch die der Geister erweckt hatten; an die Stelle des Wunders trat die physische Gesetzmässigkeit, nachdem Kepler und Newton den Mechanismus der Weltkörper und sein Gesetz erkannt hatten. Es erstand die mechanische Naturwissenschaft und mit ihr der Sieg der iuductiven Methode, die freilich in der Medicin erst nach langen Kämpfen errungen wurde. Aber Eines theilte die Medicin schon im Anfang dieser neuen Culturperiode, den Trieb nach eigner, selbstständiger Forschung, und dieser trug bald die schönsten Früchte, denn er riss die Medicin aus dem Moder des blinden Autoritätsglaubens, aus den Fesseln der spitzfindigen Dialektik und führte sie zurück auf ihre wahre, letzte Grundlage: die Erkenntniss der Natur und der Organismen. Und so war es denn die anatomische Forschung, welche zuerst die Geister beschäftigte und den Grundstein bildete für die neue Epoche der Medicin, welche nun auch der pathologischen Anatomie neue Bahnen eröffnete', in denen sie von nun an in immer reicherer Entwickelung vorwärts schritt, bis sie aus einem unbedeutenden Anhängsel der Diagnostik zur vollständigen Wissenschaft wurde.

Die Zeilen der ausschliesslich symptomatischen Auffassung der Krankheiten, wie sie noch im vorigen Jahrhundert bei Sydenham in höchster Blüthe obwaltete, waren vorüber, bei allen bedeutenden Pathologen dringt der Grundsatz durch, dass die Erkenntniss und mit ihr die Heilung der Krankheiten in erster Linie auf Erkenntniss der Anatomie und Physiologie des Körpers begründet werden muss und dass die einzelnen Krankheiten nur mit Hülfe der Kenntniss der Veränderungen, welche sie im Körper hervorrufen, richtig beurtheilt werden können. Blieb auch die Krankheit immer noch ein mehr oder weniger personificirter Symptomencomplex, hielt man auch vielfach die anatomischen Veränderungen nur für die Producte des "Krankheitswesens", so erkannte man doch, dass die meisten der überhaupt existirenden, aufgestellten und beschriebenen Symptomencomplexe im engsten Zusammenhange mit gewissen anatomischen Veränderungen der Organe des Körpers stehen und in denselben grösstenteils ihre Erklärung finden. Und diese Erklärung der Symptomencomplexe in anatomischen Veränderungen nachzuweisen und so den Krankheiten ihren Sitz anzuweisen, nicht blos nach Vermuthungen aus den Symptomen, wie es die Alten thaten, sondern aus Leichenöffnungen, das wurde nun die Aufgabe aller Aerzte, die, unbefriedigt von dem Symptomenspiel der alten Medicin, nach neuer, positiver Begründung der Erkenntniss der Krankheiten strebten. Der pathologischen Anatomie wurde somit ein weites neues Feld eröffnet und statt zur Sammlung massenhafter Einzelheiten und Curiositäten zu dienen, wurde ihr nun die Aufgabe, eine Grundlage für die ganze Praxis zu liefern und für alle Krankheiten die anatomische Seite zu ergründen und festzustellen. Daher finden wir nun auch im achtzehnten Jahrhundert eine ganze Reihe von Werken, welche der pathologischen Anatomie ausschliesslich gewidmet sind, und letztere tritt als ein sehr wichtiger Zweig in die Reihe der übrigen Disciplinen der Medicin.

Das Gebiet der pathologischen Anatomie erstreckt sich nicht allein auf diejenigen Veränderungen der Organe und Gewebe, welche am ausgebildeten Körper vorkommen, sondern auch auf diejenigen, welche während der Bildung und Entwickelung der Organe im Ei entstehen. Die Betrachtung und Darstellung der letzleren ist Gegenstand der pathologischen Entwickelungsgeschichle. Diese Veränderungen, mögen ihre näheren Bedingungen im einzelnen Falle sein, welche sie wollen, sind sich sämmtlich darin gleich, dass sie Entstellungen der äusseren Form und Bildung bewirken, welche sich am Koitus oder Kind als Missbildungen darstellen. Von den, stets durch pathologische Entwicklung des Ei's oder Embryo's bedingten, Missbildungen sind wohl zu unterscheiden diejenigen angeborenen Krankheiten, welche durch anatomische Veränderungen der Organe und Gewebe des ausgebildeten Foetus bedingt sind, welche sich nicht mehr als Missbildungcn, sondern als Störungen der Textur darstellen, welche denen des Körpers nach der Geburt im kindlichen und reifen Alter vollkommen gleich sind. Mit dem Namen Missbildung (Monstrositas, Vitium primae formationis) bezeichnet man übrigens nicht blos die Veränderung, sondern auch den in Folge dieser Veränderung missgestalteten Foetus (Missgeburt, Monstrum, Teras) selbst, doch pflegt man im gewöhnlichen Sprachgebrauch einen Foetus oder ein neugeborenes Kind nur dann eine Missbildung, Missgeburt oder Monstrum zu nennen, wenn die Veränderung so beschaffen ist, dass sie eine bedeutende, von der normalen weit abweichende, meist die Lebensfähigkeit abschliessende Störung der Bildung bewirkte.

Die besondere Beschaffenheit oder der Charakter der Störungen der physiologischen Entwickelung und die Art und Weise, wie sie in Wirksamkeit treten, sind zwar sehr mannigfach, lassen sich aber doch leicht unter gewisse einfache Kategorien bringen. Zunächst kann man alle Missbildungen in zwei grosse Abtheilungen bringen, zu deren einer diejenigen zu stellen sind, bei denen es sich nur um eine quantitative Veränderung, eine Veränderung der Grösse und Zahl handelt, zu der anderen aber diejenigen Missbildungen gehören, bei denen das Wesentliche in qualitativer Abweichung vom normalen Bildungsgänge beruht. Die quantitative Bildungsstörung kann sich nun als eine Vermehrung oder als eine Verminderung der Bildung darstellen. Betrachten wir zunächst die erstere, so zerfallen die zugehörigen Missbildungen (Monstra per excessum) in solche, bei denen die Grösse und in solche, bei denen die Zahl vermehrt ist; Missbildungen durch abnorme Grösse des ganzen Körpers oder einzelner Organe und deren Theile kommen nicht sehr häufig zur Beobachtung, hingegen werden die durch abnorme Zahl bedingten häufig beobachtet und mit grossem Interesse; es gehören hierher die Verdoppelungen oder selbst Verdreifachungen des ganzen Körpers, einzelner Gegenden, Organe oder Theile. Die durch Verminderung der Bildung charakterisirten Missbildungen (Monstra per defectum) stellen sich bald als einfache Defecte, bald als Hemmungsbildungen dar; bei den ersteren ist ein grösserer oder kleinerer Theil des Körpers einfach gar nicht oder zu klein und kümmerlich gebildet, es handelt sich also um eine vollständige Behinderung der Bildung ; bei den zweiten, den Hemmungsbildungen, sind die embryonalen Anlagen des Körpers oder der betreffenden Theile desselben regelmässig und vollständig gebildet, aber die Ausbildung desselben in die reifen, fertigen Körperformen wird gehemmt, bleibt auf einer gewissen Stufe stehen und wir sehen demnach an dem Foetus oder ausgetragenen Kinde eine gewisse Form als Missbildung, welche für eine bestimmte Entwicklungsstufe des embryonalen Lebens normal war. Diese Arten der Missbildungen sind sehr häufig und von grossem Interesse, sie sind es gerade, an welchen sich vorzugsweise die pathologische Entwicklungsgeschichte zu einem Zweige der Wissenschaft herangebildet hat, im Gegensatze zu der früheren Lehre von den Missbilduugen, welche in denselben eine ganz besondere Classe von Geschöpfen sah, die als Spiele der Natur oder Strafen des zornigen und eifrigen Gottes in die Welt gesetzt worden, aber mit dem normalen Körper nichts zu thun hatten. Die einzelnen Arten der Hemmungsbildungen sind unter einander sehr verschieden; die beiden wichtigsten sind: die Spaltbildungen, hervorgehend aus Hemmung der gegenseitigen Verwachsung ursprünglich getrennter Theile; und die den vorigen entgegengesetzten Atresien, bedingt durch Hemmung des Oeffnens ursprünglich solider Theile. Die dritte Abtheilung der Missbildungen, bei welchen es sich wesentlich um qualitative Abweichung handelt (Monstra per fabricani alienam), sind ebenfalls häufig und gewähren das grösste wissenschaftliche Interesse, indem sie ganz eigentümliche Verirrungen der Entwicklung darstellen, welche sich in ihrem gesetzmässigen Gange nur auf Grund der physiologischen Entwickelungsgeschichte erklären lassen. Es gehören hierher die sogenannten Zwitterbildungen, die Verdoppelungen des Uterus, die meisten Missbildungen des Herzens, Veränderungen, welche sämmtlich in ihrem Wesen erst durch die wissenschaftliche Verbindung der physiologischen und pathologischen Entwicklungsgeschichte unsrer Tage erkannt wurden.


Verlag: Leopold Voss
» «

VI. Pathologische Entwickelung des Enddarmes und Uro-Genitalapparates

Bis zur 5. Woche des embryonalen Lebens findet sich noch keine äussere Oeffnung für den Enddarm und Urogenitalapparat, der Enddarm endigt zu dieser Zeit blind ; an seiner vorderen Wand communicirt er mit der Allantois, welche die Wolff'schen Gänge aufnimmt. In der 5. und 6. Woche bildet sich eine Oeffnung für die genannten Apparate, welche zur Kloake führt, in diese mündet unten der Enddarm, ohen der Sinus urogenitalis, in welchen sich die, unterdessen aus dem unteren Theile der Allantois gehildete und vom Enddarm angeschlossene Harnblase und die Geschlechtsgänge (Wolff'sche und Müller'sche Gänge) öffnen. Später schwindet die Kloake allmälig und es zeigen sich zwei getrennte Oeffnungen, eine obere für den Sinus urogenitalis und eine untere für den Enddarm. Der Sinus urogenitalis stellt sich anfangs als Fortsetzung der Harnblase dar, die Grenze zwischen beiden wird durch die Einmündung der Geschlechtsgänge bezeichnet. Später bildet sich am unteren Ende der Harnblase die Urethra aus und nun mündet diese in den Sinus und zwar an derselben Stelle wie die Geschlechtsgänge. Beim Manne erlangt mit der Entwicklung und Verlängerung des Penis der Sinus eine bedeutende Länge und stellt den zwischen dem Ostium externum und dem Samenhügel befindlichen Theil der Urethra dar ; beim Weibe dagegen schwindet der Sinus fast ganz und wird durch die seichte Einbuchtung, Scheidenvorhof, repräsentirt, in welche die Urethra und der weibliche Geschlechtsgang, die Vagina, einmünden. Gleichzeitig mit dieser Bildung der äusseren Oeffnungen geht auch die der äusseren Genitalien vor sich; schon zur Zeit als nur eine Kloakenöffnung existirt, erhebt sich über derselben ein konischer Höcker, der Genitalkörper, welcher bald ein knopfförmiges Ende erhält und unten eine tiefe Furche, Genilalrinne, zeigt ; aussen um die Kloake erheben sich aber zwei Falten, die äusseren Genitalfalten. Mit der Sonderung der Oeffnungen des Sinus urogenitalis und des Enddarms und der weiteren Entwickelung der inneren Genitalien wachsen auch Genitalhöcker und -Falten mehr und mehr ; bis zur 11. Woche haben die äusseren Geschlechtstheile einen vorwiegend weiblichen Charakter und erst in der 12. Woche tritt die entschieden geschlechtliche Sonderung ein. Beim Weibe wird der Genitalhöcker zur Clitoris, welche nun im Wachsthum zurückbleibt und von ihrem Praeputium überdeckt wird; die äusseren Genitalfalten werden zu den Schamlippen. Beim Manne wird der Genitalhöcker zum Penis, die Genitalrinne schliesst sich allmälig von hinten nach vorn und wird zur Verlängerung des Sinus urogenitalis oder zur Urethra, die äusseren Genitalfallen verwachsen untereinander und werden zum Scrotum, in welches im 8. Monat die Hoden treten. So wie die äusseren entwickeln sich auch die inneren Genitalien aus einer gemeinschaftlichen Grundlage und eine deutliche Differenzirung der Geschlechter tritt auch hier erst gegen Ende des 3. Monats ein. Zuerst bilden sich zu beiden Seiten der Wirbelsäule die Wolff'schen Körper mit den Wolffschen Gängen ; in der 7. Woche entstehen dann an der Seite der ersteren die Geschlechtsdrüsen und zwei neue Gänge, die Müller'schen, welche neben den Wolff'schen in den Sinus urogenitalis münden. Beim Manne werden die Geschlechtsdrüsen zu den Hoden, die Wolff'schen Gänge zu den Samenleitern, der mittlere Theil des Wolff'schen Körpers wird zum Nebenhoden, der obere und untere Theil desselben schwindet, doch bleiben öfters einzelne Drüsengänge zurück, die sich dann später in Cysten umwandeln können. Die Müller'schen Gänge verschwinden beim Manne grösstenteils, nur ihre unteren Enden bleiben, fliessen zusammen und bilden die Vesicula prostalica, welche zwischen den Samenleitern in den Sinus urogenitalis (Urethra) mündet; zuweilen bleibt auch das obere Ende eines Müller'schen Ganges erhalten und wird in eine langgestielte Cyste umgewandelt. Samenblasen, Prostata und Cowper'sche Drüsen bilden sich später als accessorische Organe. Beim Weibe werden die Geschlechtsdrüsen zu Eierstöcken, aus den Müller'schen Gängen entwickeln sich Tuben, Uterus und Vagina, indem sie oben getrennt bleiben, unten aber in einen Kanal verschmelzen; der Uterus behält beim Foetus bis zum 4. und 5. Monat eine gehörnte Gestalt; die Sonderung zwischen Uterus und Scheide ist im 4. Monat vollendet; zu derselben Zeit zeigt sich auch die Bauchöffnung der Tuben, etwas entfernt vom blinden Ende der Müller'schen Gänge, welches letztere entweder verödet oder in eine gestielte Cyste umgewandelt wird. Die Wolff'schen Gänge schwinden beim Weibe in der Regel ganz und nur äusserst selten hat man Spuren derselben im späteren Alter gefunden ; zuweilen wird ihr oberes Ende in eine Cyste umgewandelt. Ein Theil des Wolff'schen Körpers bleibt und stellt den Nebeneierstock dar, die übrigen Drüsenschläuche schwinden oder werden zu kleinen Cysten. Die Entwickelung des Harnapparates beginnt mit der der Allantois, dieselbe entwickelt sich in Form zweier Höcker, die sich aber bald zu einem vereinigen, ursprünglich als solide Wucherung von der vorderen Bauchwand ; tritt dann aber mit dem Darmfaserblatt in Verbindung und das Darmdrüsenblatt bildet eine Ausstülpung in dieselbe, so dass die Allantois endlich von der Bauchwand ganz frei wird und sich als eine auf der vorderen Wand des Enddarms sitzende aus Darmfaserblatt und Darmdrüsenblatt bestehende gestielte Blase darstellt. Der Stiel dieser Blase (Urachus) ist hohl und erweitert sich allmälig zur Harnblase, welche also eine Zeit lang in offnem Zusammenhange mit dem Enddarme steht, später wird dieser Verbindungsstrang mit dem Enddarme solid, so wie auch der Verbindungsstrang der Harnblase mit dem ausserhalb des Embryo zwischen Dottersack und Amnion gelagerten Allantoistheile solid wird und sich als Ligamentum vesicae medium darstellt. Die übrigen Harnorgane entstehen als hohle Ausstülpung der hinteren Wand der Harnblase oder des früheren Urachus, zunächst die Harnleiter, dann als Ausbuchtungen desselben die Nierenkelche und von diesen aus die Harnkanälchen, welche später mehr und mehr auswachsen. Die Nieren liegen anfangs hinter dem untersten Theile des Wolff'schen Körpers, rücken allmälig weiter nach oben und kommen hinter die viel grösseren Nebennieren zu liegen, welche sich um die 6. und 7. Woche vor der Aorta und zwischen den Wolff'schen Körpern bilden und ursprünglich wahrscheinlich zusammenhängen. Die pathologische Entwickelungsgeschichte des Enddarmes und Urogenitalapparatcs schliesst sich grösstentheils eng an die physiologische an; die wichtigsten Missbildungen dieses Gebietes stellen sich meist als Hemmungsbildungen, als Stehenbleiben auf einer früheren Bildungsstufe oder als Verirrung der Umbildung embryonaler Anlagen in fötale Organe dar.

Bleibt der Enddarm auf der frühesten Stufe seiner Entwickelung stehen und öffnet er sich nicht nach aussen, so geht hieraus Atresia ani hervor; wird gleichzeitig die ursprüngliche offne Verbindung zwischen Enddarm und Harnblase bleibend, so entsteht beim männlichen Geschlecht die Atresia ani vesicalis oder urethralis; aus bleibender offner Verbindung des Enddarmes mit dem Sinus urogenitalis bildet sich beim Weibe die Atresia ani vaginalis und beim Manne eine Form der A. a. urethralis hervor. Ausser dieser Form eines Stehenbleibens auf der Stufe der embryonalen Kloake kommen auch noch andere vor, indem sich bald an der entsprechenden Stelle ein Sinus findet, in welchen Enddarm, Harn- oder Geschlechtsgänge sich öffnen oder gleichzeitig eine Blasenspalte und Darmspalte vorhanden ist, durch welche die Ureteren und der Mitteldarm nach aussen münden. Diese bei Menschen nicht seltnen Missbildungen sind bisher mit Ausnahme der einfachen Atresia ani bei Thieren nur wenig beobachtet worden. (Vergl. meine Missbildungen. und spec. Theil p. 98. GURLT II. p. 148. Atretocormus aproctus.)

Bleibt die Entwicklung der äusseren männlichen Genitalien auf der Bildungsstufe der 10. Woche stehen, so entsteht die als Hypospadie bekannte, gewöhnlich als Zwitterbildung bezeichnete Missbildung, bei welcher der rudimentäre Penis keine Urethra, sondern an deren Stelle eine Furche (Genitalrinne) hat und der Sinus urogenitalis zwischen den schamlippenartigen, getrennt gebliebenen Scrotalhälften mündet. Bilden sich beim Manne die Müller'schen Gänge nicht zurück, sondern gehen sie eine ähnliche Umbildung wie beim Weibe ein, so zeigen sich an der Stelle der Vesicula prostatica Vagina, Uterus und Tuben in mehr oder weniger ausgebildetem Zustande. Einige Beobachter wollen in solchen Fällen gesehen haben, dass auf der einen Seite ein Hode mit Samenleiter und auf der entgegengesetzten Seite ein Ovarium mit Tube vorhanden waren: Hermaphroditismus lateralis; Andere wollen in solchen Fällen das gleichzeitige Vorkommen von Hoden und Eierstücken auf beiden Seiten beobachtet haben : Hermaphroditismus androgynus; jedoch ist beim Menschen das gleichzeitige Vorkommen von Hoden und Eierstock noch nicht exact nachgewiesen worden, während es bei Säugethieren und Vögeln allerdings vorkommt. - Tritt der Descensus testiculorum auf einer oder beiden Seiten nicht oder unregelmässig ein, so geht daraus der Cryptochmismus hervor; aus mangelhafter Entwicklung einer oder beider männlichen Geschlechtsdrüsen folgen Anorchismus, Monorchismus oder Microschismus. (S. im spec. Theile p. 343. Vergl. auch meine Mißbildungen p. 148. Taf. XXI. GURLT I. c. p. 184. u. f.)

Der Hypospadie des Mannes entsprechend ist die weibliche Zwitterbildung; die Clitoris ist hier abnorm gross, penisartig, die Vagina eng, der Uterus klein, die Eierstöcke meist wenig entwickelt, ebenso die Brüste, der Körperbau hat mehr männlichen als weiblichen Habitus. - Verschmelzen beim Weibe die Müller'schen Gänge bei der Bildung des Uterus und der Scheide nicht in einen Kanal, sondern entwickeln sich vollständig, so gehen daraus die verschiedenen Arten des Uterus duplex, bicornis und unicornis hervor, Mißbildungen, die bei Thieren nicht vorkommen. (S. im spec. Theile p. 404. 453. 463; Missbildungen p. 15S. Taf. XX.)

Ausser den angeführten Hemmungs- und Verirrungsbildungen der Genitalien kommen auch noch Defectbildungen, Verschmelzungen, Atresien u. s. w. vor; an der Mamma auch Doppelbildungen, indem sich statt 2 Brüste 3, 4 und selbst 5 bilden ; alle diese Missbildungen sind im speciellen Theile beschrieben worden.

An den Harnorganen kommen vorzugsweise Defecte, Atresien, Lageveränderungen und Verschmelzungsbildungen vor; eine der wichtigsten Missbildungen der Harnblase, die Blasenspalte, ist schon bei den Bauchspalten berührt worden ; mit dieser Blasenspalte combinirt, aber auch als selbstständige Missbildung kommt beim Manne zuweilen die Epispadie vor; bei derselben ist der Penis klein, rudimentär, die Urethra fehlt an ihrer normalen Stelle, liegt auf dem Bücken des Penis oder genauer ausgedrückt auf den cavernösen Körpern des Penis, ist aber nach oben gespalten und bildet daher eine offne Rinne. Bei Thieren scheint diese Missbildung nicht vorzukommen.

Divider


Verlag: Leopold Voss


Verlag: Leopold Voss

Handbuch der Geschichte der Medizin ()
» Erster Band «
» Zweiter Band «
» Dritter Band «
Verlag: Gustav Fischer
» «, » «, » «

Divider

Psychopathia sexualis

Divider

Scala evolutionis
» Polaritas sexualis qua sexus sejunctus «


» «

Divider

Homosexuellenkonzepte

Divider

Divider

Männerliebe

Divider


Die Männerliebe der Griechen, ihre Beziehungen zur Geschichte,
Erziehung, Literatur und Gesetzgebung aller Zeiten.
Forschungen über platonische Liebe

Verlag: Glarus
» «
Schriftsteller

Divider

Uranismus, Urning und Urninde
sowie Dioning Dioninge

Divider


Moralphilosophische und sozialphilosophische Studien über urnische Liebe
12 Bände (1864-1879)
Autor und Hrsg.: » «
Jurist, Journalist, Verleger, Schriftsteller, Pionier der Sexualwissenschaft

» Wikipedia « : "Auf dem deutschen Juristentag 1867 in München forderte er in einer Rede erstmals öffentlich die Straffreiheit gleichgeschlechtlicher sexueller Handlungen, da diese auf einer natürlichen Veranlagung beruhen würden, worauf es zu tumultartigen Szenen unter den Zuhörern und zum Abbruch seiner Rede kam. Ulrichs gilt als ein früher Vordenker und -kämpfer der heutigen Lesben- und Schwulenbewegung, blieb aber zu Lebzeiten mit seinen Ideen und Forderungen ein Außenseiter. Statt der angestrebten Liberalisierung musste er die zunehmende staatliche Repression gegen Homosexuelle nach der deutschen Reichsgründung 1871 miterleben, weshalb er 1880 enttäuscht ins Exil nach Italien ging. Teile seiner wissenschaftlichen Theorien zur Sexualität wurden nach seinem Tod von anderen Pionieren der Sexualwissenschaft wie Magnus Hirschfeld aufgegriffen."

» Wikipedia « : "Weil die bis dato benutzten Ausdrücke für die Vertreter des dritten Geschlechts ihm zu sehr negativ gefärbt erschienen, führte Ulrichs seine eigenen Begriffe ein. Seine Terminologie baute sich auf der Rede Pausanias in Platons Symposion (Kapitel 8 und 9), die zwei Formen der Liebesgöttin Aphrodite vorstellt: Den heterosexuellen Mann bezeichnete Ulrichs als Dioning - nach der Göttin Aphrodite Dionea, die Zeus als Vater und Dione als Mutter hatte und somit verschiedengeschlechtliche Liebe repräsentierte. Den homosexuellen Mann bezeichnete Ulrichs als Urning - nach der Göttin Aphrodite Urania, die nach der Legende aus abgetrennten Körperteilen ihres Vaters Uranus entstand, also eingeschlechtliche Liebe repräsentierte. Ulrichs' Systematik sah auch den Begriff Urninde für eine homosexuelle Frau vor."

» Hubert Kennedy «
Karl Heinrich Ulrichs, Pioneer of the Modern Gay Movement (Autobiographie - 2002)

Divider

Das dritte Geschlecht

Divider


Verlag: Richard Eckstein Nachfahre H. Krüger
» «
Schriftsteller, Verlagslektor

Divider

Monosexual, Homosexual, Heterosexual und Pygisten

Divider


Serbe's (Comissions-) Verlag
» «
österreichisch-ungarischer Schriftsteller

» DeAcademic «

Im Jahre 1848 zog er nach Berlin. Zu dieser Zeit begann er, über Homosexualität zu schreiben, motiviert, wie er sagte, durch ein "anthropologisches Interesse", Gerechtigkeitssinn und die Sorge um die Menschenrechte. Im Jahre 1869 veröffentlichte er anonym ein Flugblatt mit dem Thema: "Paragraph 143 des preußischen Strafgesetzbuches vom 14. April 1851 und seine Wiederbestätigung als Paragraph 152 im vorgeschlagenen Strafgesetzbuch für den Norddeutschen Bund. Eine offene und berufliche Korrespondenz mit Seiner Exzellenz Dr. Leonhardt, dem Königlichen preußischen Justizminister." Ein zweites Flugblatt zum selben Thema folgte bald. In seinen Schriften behauptete Kertbeny, dass das Preußische Sodomie-Gesetz, Paragraph 143, die Menschenrechte verletze. Er brachte das klassisch freiheitliche Argument vor, dass der private und freiwillige Geschlechtsverkehr nicht Sache des Strafrechts sein solle. Bezüglich seines Freundes aus den Tagen seiner Buchhändler-Lehre behauptete er, dass Homosexuelle aufgrund des preußischen Gesetzes erpressbar seien und deshalb oft in den Selbstmord getrieben würden. Kertbeny brachte auch die Ansicht vor, dass Homosexualität angeboren und unveränderlich sei, ein Argument, das später das "medizinische Modell" der Homosexualität genannt wurde. Er widersprach damit der vorherrschenden Ansicht dieser Zeit, dass Männer Sodomie aus bloßer Boshaftigkeit begingen. Homosexuelle Männer, sagte er, seien nicht von Natur aus weichlich, und er wies darauf hin, dass viele große Helden der Geschichte homosexuell waren. Er war der erste Schriftsteller, der diese Argumente vorbrachte.

In seinen Schriften prägte Kertbeny das Wort "homosexuell" als Bestandteil seines Systems für die Klassifikation von sexuellen Typen. Er nannte Männer, die von Frauen angezogen werden, "heterosexuell", Masturbatoren nannte er "monosexuell" und Anhänger des Analverkehrs nannte er "Pygisten" (griechisch pygê = Steiß). Klassische Gelehrte haben Kertbenys Wortschöpfung seitdem bedauert: Das Wort "homosexuell" verbindet das griechische Adjektiv homós ("gleich"), mit dem lateinischen Substantiv sexus ("Geschlecht") und ist damit eine Kombination griechischer und lateinischer Elemente. Das Wort "homosexuell" führe zudem zur Verwechslung des griechischen homós mit dem lateinischen homo ("Mensch" oder "Mann"). Männer wie Karl Heinrich Ulrichs, die sich als homosexuell zu erkennen gegeben hatten, begannen in der Folge für homosexuelle Rechte zu kämpfen; Kertbeny dagegen zog sich zurück. Im Jahre 1880 trug er ein Kapitel über Homosexualität zu Gustav Jägers Buch Entdeckung der Seele bei, jedoch entschied Jägers Herausgeber, das Thema sei zu umstritten, und ließ es weg. Dennoch gebrauchte Jäger die Fachsprache von Kertbeny an einer anderen Stelle des Buches. Für seine eigenen Schriften entlehnte der österreichische Sexualwissenschaftler Richard von Krafft-Ebing Kertbenys Worte homosexuell und heterosexuell aus Jägers Buch. Krafft-Ebings Arbeit war so einflussreich, dass diese Bezeichnungen zu Standard-Begriffen für die sexuelle Orientierung wurden und Ulrichs Bezeichnung Urning (für den homosexuellen Mann) ersetzten.

Karl Maria Kertbeny: Schriften zur Homosexualitätsforschung ()
Manfred Herzer (Hrsg.), Verlag Rosa Winkel / Männerschwarmskript
Enthält die beiden 1869 anonym erschienenen Broschüren
und Kertbenys Beiträge zu Gustav Jägers Buch Die Entdeckung der Seele,
sowie eine Schilderung von Kertbenys Leben
nach Dokumenten und Selbstzeugnissen von Manfred Herzer.

== Etymologie ==

» mono « in der Forschungsliteratur
Autonomie und Isonomie fremder und indigener Wortbildung (2008)
am Beispiel ausgewählter numerativer Wortbildungseinheiten
Verlag: Frank & Timme (ISBN:978-3-86596-141-9)
Anja Seiffert

» Heterogen und Homogen «
Kurzes deutsches Wörterbuch für Etymologie, Synonymik und Orthographie (1834)
S. 125, 129
Verlag: Friedrich Metz
Friedrich Schmitthenner

== ==

Divider

conträre Sexualempfindung und Conträrsexueller

(Transsexualität - 1869)